HHsearch alignment for GI: 254780364 and conserved domain: cd06191

>cd06191 FNR_iron_sulfur_binding Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain. FNR was intially identified as a chloroplast reductase activity catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methnae assimilation in a variety of organisms. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which vary in
Probab=100.00  E-value=2e-39  Score=260.98  Aligned_cols=169  Identities=24%  Similarity=0.425  Sum_probs=151.8

Q ss_pred             EEEEEEEECCCCEEEEEEECCC--CCCCCCCCEEEECCCCCCCCEEEEEEECCCCCCCCCEEEEEEECCCCCCCCCCC-C
Q ss_conf             7898998479986999980789--997389857880314586110556432056677760179996157676531000-0
Q gi|254780364|r   15 ESVISVKHYTDRLFRFCITRPK--SFRFRSGEFVMLGLIVNGRPIFRAYSIASPCRDDKLEFCSIKVDKGFFTTYLQN-I   91 (224)
Q Consensus        15 ~~V~~~~~~T~~~~~l~l~~p~--~~~f~aGQ~~~l~~~~~g~~~~R~ySiaS~p~~~~~~~~i~~~~~g~~s~~l~~-~   91 (224)
T Consensus         1 lrV~~v~~~t~d~~~~~l~~~~~~~~~f~pGQ~v~~~~~~~g~~~~R~ySias~p~~~~l~~~Vk~~~~G~~S~~l~~~l   80 (231)
T cd06191           1 LRVAEVRSETPDAVTIVFAVPGPLQYGFRPGQHVTLKLDFDGEELRRCYSLCSSPAPDEISITVKRVPGGRVSNYLREHI   80 (231)
T ss_pred             CEEEEEEEECCCEEEEEEECCCCCCCCCCCCEEEEEEEEECCEEEEECCCCCCCCCCCEEEEEEEEECCCCHHHHHHHCC
T ss_conf             98999999489909999983898888859986799997168968771346678999998999999965996788997468


Q ss_pred             CCCCCCEECCCCCCCCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHH
Q ss_conf             22222100168875335644676881799965868088999999865308863389999405864543048889988753
Q gi|254780364|r   92 QPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIRDPETYKKFDEVIITHTCGRVAELQYGIDVMHEISQD  171 (224)
Q Consensus        92 ~~gd~~~~~~~p~g~f~~~~~~~~~~lvlIAgGtGiaP~~silr~~~~~~~~~~i~l~~g~R~~~dl~~~~el~~l~~~~  171 (224)
T Consensus        81 ~~Gd~v~i-~gP~G~f~l~~~-~~~~~lliAgG~GItP~~s~l~~~~~~~~~~~v~l~yg~r~~~d~~~~~eL~~l~~~~  158 (231)
T cd06191          81 QPGMTVEV-MGPQGHFVYQPQ-PPGRYLLVAAGSGITPLMAMIRATLQTAPESDFTLIHSARTPADMIFAQELRELADKP  158 (231)
T ss_pred             CCCCEEEE-EECCCCCEECCC-CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHHC
T ss_conf             99999999-705346500678-8887999952753273899999999857898589998269979946699999998648


Q ss_pred             HHHCCCCCCCEEEEEEECCCCC
Q ss_conf             3210124687599981057887
Q gi|254780364|r  172 EILKDLIGQKLKFYRTVTQEDY  193 (224)
Q Consensus       172 ~~~~~~~~~~~~~~~~isre~~  193 (224)
T Consensus       159 ~--------~~~~~~~~s~~~~  172 (231)
T cd06191         159 Q--------RLRLLCIFTRETL  172 (231)
T ss_pred             C--------CCEEEEEEECCCC
T ss_conf             9--------9299999916787