HHsearch results for GI: 254780364 and protein with PDBid: 2qdx_A

>2qdx_A Ferredoxin reductase; oxidoreductase; HET: FAD; 1.55A {Pseudomonas aeruginosa} PDB: 3crz_A* 1a8p_A*
Probab=100.00  E-value=0  Score=300.16  Aligned_cols=213  Identities=45%  Similarity=0.833  Sum_probs=194.1

Q ss_pred             CCCEEEEEEEEEECCCCEEEEEEECCCCCCCCCCCEEEECCCCCCCCEEEEEEECCCCCCCCCEEEEEEECCCCCCCCCC
Q ss_conf             34211789899847998699998078999738985788031458611055643205667776017999615767653100
Q gi|254780364|r   10 ADVYCESVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIASPCRDDKLEFCSIKVDKGFFTTYLQ   89 (224)
Q Consensus        10 ~~~~~~~V~~~~~~T~~~~~l~l~~p~~~~f~aGQ~~~l~~~~~g~~~~R~ySiaS~p~~~~~~~~i~~~~~g~~s~~l~   89 (224)
                      +++|.+||++++++|+++++|++++|++++|+||||+.|+++..|+..+|+|||+|+|.++.+.++++++++|.+|++++
T Consensus         1 ~~~~~~kV~~v~~~t~~~~~~~l~~~~~~~f~pGQ~v~l~~~~~g~~~~R~ySi~s~~~~~~~~~~i~~~~~g~~s~~l~   80 (257)
T 2qdx_A            1 SNLYTERVLSVHHWNDTLFSFKTTRNPGLRFKTGQFVMIGLEVDGRPLMRAYSIASPNYEEHLEFFSIKVPDGPLTSRLQ   80 (257)
T ss_dssp             CCSEEEEEEEEEEEETTEEEEEEECCTTCCCCTTCEEEEEEEETTEEEEEEEECCSCTTSSEEEEEEECCTTCTTHHHHT
T ss_pred             CCCEEEEEEEEEECCCCEEEEEECCCCCCCCCCCCEEEEEEECCCEEEEEEEEECCCCCCCCEEEEEEEECCCCCCHHHH
T ss_conf             98577899998845898799997889989899997599987429918766667657988997899999966996232153


Q ss_pred             CCCCCCCCEECCCCCCCCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHH
Q ss_conf             00222221001688753356446768817999658680889999998653088633899994058645430488899887
Q gi|254780364|r   90 NIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIRDPETYKKFDEVIITHTCGRVAELQYGIDVMHEIS  169 (224)
Q Consensus        90 ~~~~gd~~~~~~~p~g~f~~~~~~~~~~lvlIAgGtGiaP~~silr~~~~~~~~~~i~l~~g~R~~~dl~~~~el~~l~~  169 (224)
                      ++++||.+.+.++++++|.+++..+.++++|||||||||||+||+++++..+...++.|+||+|+.+|++|.+||.++++
T Consensus        81 ~~~~Gd~v~v~~p~G~~~~~~~~~~~~~ivlIagG~GItP~~sil~~~~~~~~~~~v~l~~g~r~~~d~~~~~el~~l~~  160 (257)
T 2qdx_A           81 HLKEGDELMVSRKPTGTLVHDDLLPGKHLYLLSTGTGMAPFLSVIQDPETYERYEKVILVHGVRWVSELAYADFITKVLP  160 (257)
T ss_dssp             TCCTTCEEEECSCCBCSCCGGGBCSCSEEEEEEEGGGGHHHHHHTTCHHHHHHCSEEEEEEEESSGGGCTTHHHHHTTGG
T ss_pred             HCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHH
T ss_conf             32688645671489876224457887716999358777860277776786477886899972499799255999999987


Q ss_pred             HHHHHCCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCHHHHCCCCCCCHHHC
Q ss_conf             53321012468759998105788776672168785860699678797871212
Q gi|254780364|r  170 QDEILKDLIGQKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMGLSPLNPDTR  222 (224)
Q Consensus       170 ~~~~~~~~~~~~~~~~~~isre~~~~~GrIt~~i~~g~l~~~~~l~~~~pet~  222 (224)
                      +++........++.++++.++++..++|+++..+..+.+.+++....++|+.+
T Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~  213 (257)
T 2qdx_A          161 EHEYFGDQVKEKLIYYPLVTREPFRNQGRQTDLMRSGKLFEDIGLPPMNPQDD  213 (257)
T ss_dssp             GCTTTHHHHHHHEEEEEEESSSCCSSBSCHHHHHHHSHHHHHHTCCCCCTTTE
T ss_pred             HCCCCCEEEEEEEEEEEECCCCCCCCCCCCCCCEECCHHHHHHCCCCCCCCCC
T ss_conf             68543204310268997425787576474353002364788743557984787