PSIBLAST alignment of GI: 254780364 and protein with PDB id: 2bgi

>gi|78101589|pdb|2BGI|A Chain A, X-Ray Structure Of The Ferredoxin-Nadp(H) Reductase From Rhodobacter Capsulatus Complexed With Three Molecules Of The Detergent N-Heptyl-Beta-D-Thioglucoside At 1.7 Angstroms Length = 272
>gi|78101590|pdb|2BGJ|A Chain A, X-Ray Structure Of The Ferredoxin-Nadp(H) Reductase From Rhodobacter Capsulatus At 2.1 Angstroms Length = 272
 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 109/224 (48%), Positives = 163/224 (72%), Gaps = 3/224 (1%)

Query: 3   DVSSELAADVYC--ESVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGL-IVNGRPIFR 59
           + +    A V    ++V SV+H+TD LF F +TRP++ RFRSGEFVM+GL   NG+PI R
Sbjct: 5   ETTPIAPAKVLPDAQTVTSVRHWTDTLFSFRVTRPQTLRFRSGEFVMIGLLDDNGKPIMR 64

Query: 60  AYSIASPCRDDKLEFCSIKVDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLY 119
           AYSIASP  D++LEF SIKV  G  T+ LQ+I+ G+ I+L  K  G L++D+L+PG RL+
Sbjct: 65  AYSIASPAWDEELEFYSIKVPDGPLTSRLQHIKVGEQIILRPKPVGTLVIDALLPGKRLW 124

Query: 120 LFSMGTGIAPFASMIRDPETYKKFDEVIITHTCGRVAELQYGIDVMHEISQDEILKDLIG 179
             + GTGIAPFAS++R+PE Y+KFDEVI+ H C  VAEL+YG  ++  + +D ++ +L+ 
Sbjct: 125 FLATGTGIAPFASLMREPEAYEKFDEVIMMHACRTVAELEYGRQLVEALQEDPLIGELVE 184

Query: 180 QKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMGLSPLNPDTRI 223
            KLK+Y T T+E++ + GRIT+++ SG+ + ++G++P+NP+T  
Sbjct: 185 GKLKYYPTTTREEFHHMGRITDNLASGKVFEDLGIAPMNPETDR 228