>gnl|CDD|99804 cd06208, CYPOR_like_FNR, These ferredoxin reductases are related to the NADPH cytochrome p450 reductases (CYPOR), but lack the FAD-binding region connecting sub-domain. Ferredoxin-NADP+ reductase (FNR) is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins, such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap between the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2, which then transfers two electrons and a proton to NADP+ to form NADPH. CYPOR serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases, sulfite reducatase, and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. CYPOR has a C-terminal FNR-like FAD and NAD binding module, an FMN-binding domain, and an additional connecting domain (inserted within the FAD binding region) that orients the FNR and FMN -binding domains. The C-terminal domain contains most of the NADP(H) binding residues, and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule, which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.. Length = 286

 Score = 45.0 bits (107), Expect = 2e-05
 Identities = 32/100 (32%), Positives = 45/100 (45%), Gaps = 19/100 (19%)

Query: 53  NGRP-IFRAYSIASPCRD------DKLEFC----------SIKVDKGFFTTYLQNIQPGD 95
           NG+P   R YSIAS  R         L  C          + +  KG  + YL +++PGD
Sbjct: 58  NGKPHKLRLYSIASS-RYGDDGDGKTLSLCVKRLVYTDPETDETKKGVCSNYLCDLKPGD 116

Query: 96  TILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIR 135
            + +     G  +L    P   L + + GTGIAPF S +R
Sbjct: 117 DVQI-TGPVGKTMLLPEDPNATLIMIATGTGIAPFRSFLR 155