RPSBLAST alignment of GI: 254780364 and protein with PDBid: 3a1f

>3a1f_A Cytochrome B-245 heavy chain; GP91(PHOX), NADPH binding domain, oxidoreductase; 2.00A {Homo sapiens} Length = 186
 Score = 37.1 bits (85), Expect = 0.004
 Identities = 15/94 (15%), Positives = 32/94 (34%), Gaps = 8/94 (8%)

Query: 117 RLYLFSMGTGIAPFASMIR-------DPETYKKFDEVIITHTCGRVAELQYGIDVMHEIS 169
            + L   G G+ PFAS+++       +  T  K  ++     C      ++  D++  + 
Sbjct: 19  VVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLE 78

Query: 170 QDEILKDLIG-QKLKFYRTVTQEDYLYKGRITNH 202
                ++  G      Y T   E       + + 
Sbjct: 79  SQMQERNNAGFLSYNIYLTGWDESQANHFAVHHD 112