RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780365|ref|YP_003064778.1| UTP-glucose-1-phosphate uridylyltransferase protein [Candidatus Liberibacter asiaticus str. psy62] (299 letters) >gnl|CDD|31403 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane]. Length = 291 Score = 359 bits (923), Expect = e-100 Identities = 137/294 (46%), Positives = 192/294 (65%), Gaps = 4/294 (1%) Query: 5 KKVRKAVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGK 64 K+RKAV P AGLG RF P +K IPKEML IVD+P+IQY++EEA+ AG+ + + VTGRGK Sbjct: 2 MKIRKAVIPAAGLGTRFLPATKAIPKEMLPIVDKPLIQYIVEEAVAAGIEEILIVTGRGK 61 Query: 65 GLIKDYFDIQFELEQSLRKRNKKAELTLLAESIPSIGNAVFTWQYERKGLGHAVWCARNI 124 I+D+FD +ELE +L KR K+ L + SIP + F Q E GLGHAV CA+ Sbjct: 62 RAIEDHFDTSYELENTLEKRGKRELLEEV-RSIPPLVTISFVRQKEPLGLGHAVLCAKPF 120 Query: 125 IGDNPFALLLPDMIMSPLEGENCMANMIKLYEKEGANILAVSECDPQLSCKYGMVQVGKA 184 +GD PFA+LLPD ++ + C+ MI+LYE+ G +++ V E P+ KYG++ G+ Sbjct: 121 VGDEPFAVLLPDDLVDSEKP--CLKQMIELYEETGGSVIGVEEVPPEDVSKYGVIDPGEP 178 Query: 185 IDHQVFHISDMIEKPDSSTFISNFFINGRYILHPDIFSILNDWKENEGKGEIQLTDSMRK 244 ++ V+ + M+EKP SN I GRY+L P+IF IL + K G GEIQLTD+++K Sbjct: 179 VEKGVYKVKGMVEKPKPEEAPSNLAIVGRYVLTPEIFDILEETKPGAG-GEIQLTDAIKK 237 Query: 245 LSERHDFLAYHFKGHTYDCGSKKGFVLANIAFALARQDIRSDIETDLKTLVSAL 298 L ++ LAY F+G YDCGSK G++ AN+ FAL R + ++ + LK L+ L Sbjct: 238 LLKKEPVLAYVFEGKRYDCGSKLGYIKANVEFALRRPKLGAEFKEYLKELLKEL 291 >gnl|CDD|133021 cd02541, UGPase_prokaryotic, Prokaryotic UGPase catalyses the synthesis of UDP-glucose. Prokaryotic UDP-Glucose Pyrophosphorylase (UGPase) catalyzes a reversible production of UDP-Glucose and pyrophosphate (PPi) from glucose-1-phosphate and UTP. UDP-glucose plays pivotal roles in galactose utilization, in glycogen synthesis, and in the synthesis of the carbohydrate moieties of glycolipids , glycoproteins , and proteoglycans. UGPase is found in both prokaryotes and eukaryotes, although prokaryotic and eukaryotic forms of UGPase catalyze the same reaction, they share low sequence similarity. Length = 267 Score = 344 bits (884), Expect = 2e-95 Identities = 134/271 (49%), Positives = 176/271 (64%), Gaps = 5/271 (1%) Query: 8 RKAVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLI 67 RKAV P AGLG RF P +K IPKEML IVD+PVIQY++EEA+ AG+ D + VTGRGK I Sbjct: 1 RKAVIPAAGLGTRFLPATKAIPKEMLPIVDKPVIQYIVEEAVAAGIEDIIIVTGRGKRAI 60 Query: 68 KDYFDIQFELEQSLRKRNKKAELTLLAESIPSIGNAVFTWQYERKGLGHAVWCARNIIGD 127 +D+FD +ELE++L K+ K L + I + N + Q E GLGHAV CA+ IGD Sbjct: 61 EDHFDRSYELEETLEKKGKTDLLEEVRI-ISDLANIHYVRQKEPLGLGHAVLCAKPFIGD 119 Query: 128 NPFALLLPDMIMSPLEGENCMANMIKLYEKEGANILAVSECDPQLSCKYGMVQVGKAIDH 187 PFA+LL D ++ E C+ +I+ YEK GA+++AV E P+ KYG+V+ K ID Sbjct: 120 EPFAVLLGDDLIDS--KEPCLKQLIEAYEKTGASVIAVEEVPPEDVSKYGIVKGEK-IDG 176 Query: 188 QVFHISDMIEKPDSSTFISNFFINGRYILHPDIFSILNDWKENEGKGEIQLTDSMRKLSE 247 VF + ++EKP SN I GRY+L PDIF IL + K +G GEIQLTD++ KL E Sbjct: 177 DVFKVKGLVEKPKPEEAPSNLAIVGRYVLTPDIFDILENTKPGKG-GEIQLTDAIAKLLE 235 Query: 248 RHDFLAYHFKGHTYDCGSKKGFVLANIAFAL 278 AY F+G YDCG+K G++ A + FAL Sbjct: 236 EEPVYAYVFEGKRYDCGNKLGYLKATVEFAL 266 >gnl|CDD|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars. Nucleotidyltransferases transfer nucleotides onto phosphosugars. The enzyme family includes Alpha-D-Glucose-1-Phosphate Cytidylyltransferase, Mannose-1-phosphate guanyltransferase, and Glucose-1-phosphate thymidylyltransferase. The products are activated sugars that are precursors for synthesis of lipopolysaccharide, glycolipids and polysaccharides. Length = 217 Score = 131 bits (332), Expect = 2e-31 Identities = 64/257 (24%), Positives = 108/257 (42%), Gaps = 42/257 (16%) Query: 10 AVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLIKD 69 AV AG G R P++ PK +L I +P+++Y+IE AG+ + + V G I++ Sbjct: 1 AVILAAGKGTRLRPLTDTRPKPLLPIAGKPILEYIIERLARAGIDEIILVVGYLGEQIEE 60 Query: 70 YFDIQFELEQSLRKRNKKAELTLLAESIPSIGNAVFTWQYERKGLGHAVWCARNIIGDNP 129 YF K E + Q E G AV A + +GD+ Sbjct: 61 YFG-------DGSKFGVNIE---------------YVVQEEPLGTAGAVRNAEDFLGDDD 98 Query: 130 FALLLPDMIMSPLEGENCMANMIKLYEKEGA-NILAVSECDPQLSCKYGMVQVGKAIDHQ 188 F ++ D++ E +++ + ++GA +AV E + +YG+V++ Sbjct: 99 FLVVNGDVLTDLDLSE-----LLRFHREKGADATIAVKEVEDPS--RYGVVELD-----D 146 Query: 189 VFHISDMIEKPDSSTFISNFFIN-GRYILHPDIFSILNDWKENEGKGEIQLTDSMRKLSE 247 ++ +EKP + N G YI P+I + E +GE +LTD++ L E Sbjct: 147 DGRVTRFVEKPTLPE---SNLANAGIYIFEPEILDYI---PEILPRGEDELTDAIPLLIE 200 Query: 248 RHDFLAYHFKGHTYDCG 264 Y G+ D G Sbjct: 201 EGKVYGYPVDGYWLDIG 217 >gnl|CDD|133032 cd04189, G1P_TT_long, G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase. This family is the long form of Glucose-1-phosphate thymidylyltransferase. Glucose-1-phosphate thymidylyltransferase catalyses the formation of dTDP-glucose, from dTTP and glucose 1-phosphate. It is the first enzyme in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme.There are two forms of Glucose-1-phosphate thymidylyltransferase in bacteria and archeae; short form and long form. The long form, which has an extra 50 amino acids c-terminal, is found in many species for which it serves as a sugar-activating enzyme for antibiotic biosynthesis and or other, unknown pathways, and in which dTDP-L-rhamnose is not necessarily produced.The long from enzymes also have a left-handed parallel helix domain at the c-terminus, whereas, th eshort form enzymes do not have this domain. The homotetrameric, feedback inhibited short form is found in numerous bacterial species that produce dTDP-L-rhamnose. Length = 236 Score = 112 bits (282), Expect = 2e-25 Identities = 70/275 (25%), Positives = 113/275 (41%), Gaps = 56/275 (20%) Query: 9 KAVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLIK 68 K + G G R P++ PK+++ + +P+IQY IE+ EAG+ D V G IK Sbjct: 2 KGLILAGGKGTRLRPLTYTRPKQLIPVAGKPIIQYAIEDLREAGIEDIGIVVGPTGEEIK 61 Query: 69 DYFDIQFELEQSLRKRNKKAELTLLAESIPSIG-NAVFTWQYERKGLGHAVWCARNIIGD 127 + G + Q E GL HAV AR+ +GD Sbjct: 62 EALG-----------------------DGSRFGVRITYILQEEPLGLAHAVLAARDFLGD 98 Query: 128 NPFALLLPDMIMSPLEGENCMANMIKLYEKE------GANILAVSECDPQLSCKYGMVQV 181 PF + L G+N + I ++ A+IL DP+ ++G+ V Sbjct: 99 EPFVVYL---------GDNLIQEGISPLVRDFLEEDADASILLAEVEDPR---RFGVAVV 146 Query: 182 --GKAIDHQVFHISDMIEKPDSSTFISNFFINGRYILHPDIFSILNDWKENEGKGEIQLT 239 G+ I ++EKP SN + G Y P IF ++ K + +GE+++T Sbjct: 147 DDGR--------IVRLVEKPK--EPPSNLALVGVYAFTPAIFDAISRLKPSW-RGELEIT 195 Query: 240 DSMRKLSER-HDFLAYHFKGHTYDCGSKKGFVLAN 273 D+++ L +R G D G+ + + AN Sbjct: 196 DAIQWLIDRGRRVGYSIVTGWWKDTGTPEDLLEAN 230 >gnl|CDD|31402 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane]. Length = 286 Score = 106 bits (265), Expect = 1e-23 Identities = 63/244 (25%), Positives = 110/244 (45%), Gaps = 41/244 (16%) Query: 8 RKAVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGR-GKGL 66 K V G G R P+++V+PK++L + D+P+I Y +E + AG+ D + V G K Sbjct: 1 MKGVILAGGSGTRLRPLTRVVPKQLLPVYDKPMIYYPLETLMLAGIRDILIVVGPEDKPT 60 Query: 67 IKDYFDIQFELEQSLRKRNKKAELTLLAESIPSIGNAVFTWQYERKGLGHAVWCARNIIG 126 K+ + ++T + Q E GL HAV A + +G Sbjct: 61 FKELLG---------DGSDFGVDIT-------------YAVQPEPDGLAHAVLIAEDFVG 98 Query: 127 DNPFALLLPDMIMSPLEGENCMANMIKLYEKE--GANILAVSECDPQLSCKYGMVQVGKA 184 D+ F L L D I ++ ++ +++ + +E GA IL DP +YG+V+ + Sbjct: 99 DDDFVLYLGDNIF-----QDGLSELLEHFAEEGSGATILLYEVDDPS---RYGVVEFDED 150 Query: 185 IDHQVFHISDMIEKPDSSTFISNFFINGRYILHPDIFSILNDWKENEGKGEIQLTDSMRK 244 + + EKP SN + G Y P +F + K + +GE+++TD++ Sbjct: 151 -----GKVIGLEEKPKEP--KSNLAVTGLYFYDPSVFEAIKQIKPSA-RGELEITDAIDL 202 Query: 245 LSER 248 E+ Sbjct: 203 YIEK 206 >gnl|CDD|31401 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis]. Length = 358 Score = 92.7 bits (230), Expect = 1e-19 Identities = 61/265 (23%), Positives = 111/265 (41%), Gaps = 36/265 (13%) Query: 9 KAVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLIK 68 KAV G G R P++ PK +L I +P+I+YV+E AG+ + V V G I+ Sbjct: 3 KAVILAGGYGTRLRPLTDDRPKPLLPIAGKPLIEYVLEALAAAGVEEIVLVVGYLGEQIE 62 Query: 69 DYFDIQFELEQSLRKRNKKAELTLLAESIPSIGNAVFTWQYERKGLGHAVWCARNIIGDN 128 +YF L + + + E G A+ A +++G + Sbjct: 63 EYFGDGEGLGVRIT----------------------YVVEKEPLGTAGALKNALDLLGGD 100 Query: 129 PFALLLPDMIMSPLEGENCMANMIKLYEKEGANILAVSECDPQLSCKYGMVQVGKAIDHQ 188 F +L D++ + ++ +++ ++K+GA S ++G+V+ D Sbjct: 101 DFLVLNGDVLT-----DLDLSELLEFHKKKGALATIALTRVLDPS-EFGVVET----DDG 150 Query: 189 VFHISDMIEKPDSSTFISNFFINGRYILHPDIFSILNDWKENEGKGEIQLTDSMRKLSER 248 + + EKP SN G YI P++F + K E +L ++ ++ Sbjct: 151 DGRVVEFREKPGPEEPPSNLINAGIYIFDPEVFDYIE--KGERFDFEEELLPAL--AAKG 206 Query: 249 HDFLAYHFKGHTYDCGSKKGFVLAN 273 D Y F+G+ D G+ + + AN Sbjct: 207 EDVYGYVFEGYWLDIGTPEDLLEAN 231 >gnl|CDD|133019 cd02538, G1P_TT_short, G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase. This family is the short form of glucose-1-phosphate thymidylyltransferase. Glucose-1-phosphate thymidylyltransferase catalyses the formation of dTDP-glucose, from dTTP and glucose 1-phosphate. It is the first enzyme in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme.There are two forms of Glucose-1-phosphate thymidylyltransferase in bacteria and archeae; short form and long form. The homotetrameric, feedback inhibited short form is found in numerous bacterial species that produce dTDP-L-rhamnose. The long form, which has an extra 50 amino acids c-terminal, is found in many species for which it serves as a sugar-activating enzyme for antibiotic biosynthesis and or other, unknown pathways, and in which dTDP-L-rhamnose is not necessarily produced. Length = 240 Score = 65.7 bits (161), Expect = 1e-11 Identities = 58/239 (24%), Positives = 101/239 (42%), Gaps = 46/239 (19%) Query: 8 RKAVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRG---- 63 K + G G R +P++KV+ K++L + D+P+I Y + + AG+ + + ++ Sbjct: 1 MKGIILAGGSGTRLYPLTKVVSKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPEDLPL 60 Query: 64 -KGLIKDYFDIQFELEQSLRKRNKKAELTLLAESIPSIGNAVFTWQYERKGLGHAVWCAR 122 K L+ D D+ + + Q + GL A Sbjct: 61 FKELLGDGSDLGIRIT--------------------------YAVQPKPGGLAQAFIIGE 94 Query: 123 NIIGDNPFALLLPDMIMSPLEGENCMANMIKLYE-KEGANILAVSECDPQLSCKYGMVQV 181 IGD+P L+L D I G+ + + KEGA + DP+ +YG+V+ Sbjct: 95 EFIGDDPVCLILGDNI---FYGQGLSPILQRAAAQKEGATVFGYEVNDPE---RYGVVEF 148 Query: 182 GKAIDHQVFHISDMIEKPDSSTFISNFFINGRYILHPDIFSILNDWKENEGKGEIQLTD 240 + + +V I EKP SN+ + G Y D+F I K + +GE+++TD Sbjct: 149 DE--NGRVLSI---EEKP--KKPKSNYAVTGLYFYDNDVFEIAKQLKPS-ARGELEITD 199 >gnl|CDD|144176 pfam00483, NTP_transferase, Nucleotidyl transferase. This family includes a wide range of enzymes which transfer nucleotides onto phosphosugars. Length = 247 Score = 62.2 bits (152), Expect = 2e-10 Identities = 57/260 (21%), Positives = 110/260 (42%), Gaps = 36/260 (13%) Query: 16 GLGMRFFPISKVIPKEMLAIVDR-PVIQYVIEEALEAGLTDFVFVTGRGKGLIKDYFDIQ 74 G G R +P+++ + K ++ ++D+ P+IQY + + AG+ + + + + + + Sbjct: 8 GSGTRLWPLTRTLAKPLVPVLDKYPMIQYTLSRLMNAGIREPIVICTQ---------EHR 58 Query: 75 FELEQSLRKRNKKAELTLLAESIPSIGNAVFTWQYERKGLGHAVWCARNIIGD--NPFAL 132 F + + L K L + A+ Q E +G AV A + +GD L Sbjct: 59 FLVAEQLG-DGSKFGLQVTY--------AL---QPEPRGTAPAVALAADFLGDDDPELVL 106 Query: 133 LLPDMIMSPLEGENCMANMIKLYEKEGANILAVSECDPQLSCKYGMVQVGKAIDHQVFHI 192 +L + ++ E + V DP YG+++ + + +V Sbjct: 107 VLGGDHIYRMDFEEAVQKARAKAADGTVTFGIVPVEDPT---GYGVIEFDE--NGRVIRF 161 Query: 193 SDMIEKPDSSTFISNFFINGRYILHPDIFSILNDWKENEGKGEIQLTDSMRKLSERHD-F 251 +EKPD SN+ G Y + +F L + + +GE ++TD++ E D Sbjct: 162 ---VEKPDLPK-ASNYASMGIYFFNSGVFLFLAKYLKELARGEDEITDAIPAALEDGDLD 217 Query: 252 LAYHFKGHTY--DCGSKKGF 269 LA+ F+G+ Y D G+ Sbjct: 218 LAFLFRGYAYWSDVGTWDSL 237 >gnl|CDD|31400 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane]. Length = 460 Score = 54.0 bits (130), Expect = 5e-08 Identities = 57/241 (23%), Positives = 89/241 (36%), Gaps = 48/241 (19%) Query: 8 RKAVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLI 67 AV AG G R S +PK + + +P++++VI+ A G D V V G G + Sbjct: 3 LSAVILAAGKGTRMK--SD-LPKVLHPVAGKPMLEHVIDAARALGPDDIVVVVGHGAEQV 59 Query: 68 KDYFDIQFELEQSLRKRNKKAELTLLAESIPSIGNAVFTWQYERKGLGHAVWCARNIIGD 127 + E++ + F Q E+ G GHAV A + D Sbjct: 60 R--------------------------EALAERDDVEFVLQEEQLGTGHAVLQALPALAD 93 Query: 128 NPFALLL---PDMIMSPLEGENCMANMIKLYEKEGAN--ILAVSECDPQLSCKYGMVQVG 182 + +L D+ PL + ++ + GA +L DP YG + Sbjct: 94 DYDGDVLVLYGDV---PLITAETLEELLAAHPAHGAAATVLTAELDDPT---GYGRIVRD 147 Query: 183 KAIDHQVFHISDMIEKPDSSTFISNF-FIN-GRYILH-PDIFSILNDWKENEGKGEIQLT 239 + +V I +E+ D+S IN G Y + L N +GE LT Sbjct: 148 G--NGEVTAI---VEEKDASEEEKQIKEINTGIYAFDGAALLRALPKLSNNNAQGEYYLT 202 Query: 240 D 240 D Sbjct: 203 D 203 >gnl|CDD|133048 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family. This is a subfamily of nucleotidyl transferases. Nucleotidyl transferases transfer nucleotides onto phosphosugars. The activated sugars are precursors for synthesis of lipopolysaccharide, glycolipids and polysaccharides. Other subfamilies of nucleotidyl transferases include Alpha-D-Glucose-1-Phosphate Cytidylyltransferase, Mannose-1-phosphate guanyltransferase, and Glucose-1-phosphate thymidylyltransferase. Length = 220 Score = 54.1 bits (131), Expect = 5e-08 Identities = 52/245 (21%), Positives = 94/245 (38%), Gaps = 65/245 (26%) Query: 16 GLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLIKDYFDIQF 75 G G R P+++ PK ML + +P+++ +I+ + G +F +I+DYF Sbjct: 7 GKGTRLRPLTENTPKPMLKVGGKPILETIIDRFIAQGFRNFYISVNYLAEMIEDYF---- 62 Query: 76 ELEQSLRKRNKKAELTLLAESIPSIGNAVFTWQYERKGLGHAVWCARNIIGDNPFAL-LL 134 K ++ E K LG A G AL LL Sbjct: 63 ---GDGSKFGVN-----------------ISYVREDKPLGTA--------G----ALSLL 90 Query: 135 PDMIMSPLEGENC-------MANMIKLYEKEGANI-LAVSECDPQLSCKYGMVQVGKAID 186 P+ P N +++ +++ A+ + V E + Q+ YG+V+ Sbjct: 91 PEKPTDPFLVMNGDILTNLNYEHLLDFHKENNADATVCVREYEVQVP--YGVVETEGG-- 146 Query: 187 HQVFHISDMIEKPDSSTFISNFFIN-GRYILHPDIFSILNDWKENEGKGEIQLTDSMRKL 245 I+ + EKP +F +N G Y+L P++ ++ +NE + D + KL Sbjct: 147 ----RITSIEEKP-----THSFLVNAGIYVLEPEVLDLI---PKNE---FFDMPDLIEKL 191 Query: 246 SERHD 250 + Sbjct: 192 IKEGK 196 >gnl|CDD|133014 cd02523, PC_cytidylyltransferase, Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline. This family contains proteins similar to prokaryotic phosphocholine (P-cho) cytidylyltransferases. Phosphocholine (PC) cytidylyltransferases catalyze the transfer of a cytidine monophosphate from CTP to phosphocholine to form CDP-choline. PC is the most abundant phospholipid in eukaryotic membranes and it is also important in prokaryotic membranes. For pathogenic prokaryotes, the cell surface PC facilitates the interaction with host surface and induces attachment and invasion. In addition cell wall PC serves as scaffold for a group of choline-binding proteins that are secreted from the cells. Phosphocholine (PC) cytidylyltransferase is a key enzyme in the prokaryotic choline metabolism pathway. It has been hypothesized to consist of a choline transport system, a choline kinase, CTP:phosphocholine cytidylyltransferase, and a choline phosphotransferase that transfers P-Cho from CDP-Cho to either lipoteichoic acid or lipopolysaccharide. Length = 229 Score = 50.7 bits (122), Expect = 5e-07 Identities = 28/119 (23%), Positives = 50/119 (42%), Gaps = 24/119 (20%) Query: 10 AVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLIKD 69 A+ AG G R P+++ PK +L I +P+++ IE EAG+ D V VTG K I++ Sbjct: 1 AIILAAGRGSRLRPLTEDRPKCLLEINGKPLLERQIETLKEAGIDDIVIVTGYKKEQIEE 60 Query: 70 YFDIQFELEQSLRKRNKKAELTLLAESIPSIGNAVFTWQYERKGLGHAVWCARNIIGDN 128 K + V+ Y ++++ AR+ + ++ Sbjct: 61 LLK-------------KYPNIKF-----------VYNPDYAETNNIYSLYLARDFLDED 95 >gnl|CDD|34365 COG4750, LicC, CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane]. Length = 231 Score = 50.3 bits (120), Expect = 7e-07 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 4/65 (6%) Query: 8 RKAVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLI 67 A+ AGLG RF P+++ PK +L + P+I+ IE+ EAG+ D V G + Sbjct: 1 MNAIILAAGLGSRFVPLTQSTPKSLLKVNGEPLIERQIEQLREAGIDDITIVV----GYL 56 Query: 68 KDYFD 72 K+ F+ Sbjct: 57 KEQFE 61 >gnl|CDD|36536 KOG1322, KOG1322, KOG1322, GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis]. Length = 371 Score = 49.1 bits (117), Expect = 1e-06 Identities = 65/268 (24%), Positives = 107/268 (39%), Gaps = 43/268 (16%) Query: 9 KAVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLIK 68 KA+ + G G R P++ PK ++ ++P+I + IE + +G+T V T Sbjct: 11 KAIILVGGYGTRLRPLTLTRPKPLVPFGNKPMILHQIEALINSGITKIVLAT-------- 62 Query: 69 DYFDIQFELEQSLRKRNKKAELTLLAESIPSIGNAVFTWQYERKGLGHAVWCARNII--- 125 Q+ E R +K L E + + + E G + AR+ + Sbjct: 63 -----QYNSESLNRHLSKAYGKELGVEIL-------ASTETEPLGTAGPLALARDFLWVF 110 Query: 126 GDNPFALLLPDMIMSPLEGENCMANMIKLYEKEGANI-LAVSECDPQLSCKYGMVQVGKA 184 D PF +L D+I M++ + GA I + V++ D KYG+V Sbjct: 111 EDAPFFVLNSDVIC-----RMPYKEMVQFHRAHGAEITIVVTKVDE--PSKYGVVV---- 159 Query: 185 IDHQVFHISDMIEKPDSSTFISNFFINGRYILHPDIFSILNDWKENEGKGEIQLTDSMRK 244 ID + +EKP +SN G YIL+P++ + + K EI Sbjct: 160 IDEDTGRVIRFVEKP--KDLVSNKINAGIYILNPEVLDRILLRPTSIEK-EI-----FPA 211 Query: 245 LSERHDFLAYHFKGHTYDCGSKKGFVLA 272 ++E H A+ G D G K F+ Sbjct: 212 MAEEHQLYAFDLPGFWMDIGQPKDFLTG 239 >gnl|CDD|36673 KOG1460, KOG1460, KOG1460, GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis, Posttranslational modification, protein turnover, chaperones]. Length = 407 Score = 48.0 bits (114), Expect = 3e-06 Identities = 59/276 (21%), Positives = 103/276 (37%), Gaps = 41/276 (14%) Query: 9 KAVFPIAG--LGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALE-AGLTDFVFVTGRGKG 65 KAV + G G RF P+S +PK + I P+I + I + +GL + + V + Sbjct: 4 KAVILVGGPQKGTRFRPLSFNVPKPLFPIAGVPMIHHHISACKQISGLAEILLVGFYEER 63 Query: 66 LIKDYFD-IQFELEQSLRKRNKKAELTLLAESIPSIGNAVFTWQYERKGLGHAVWCARN- 123 + D+ IQ E + +R + + G ++ R+ Sbjct: 64 VFTDFISAIQQEFKVPVR----------------------YLREDNPLGTAGGLYHFRDQ 101 Query: 124 IIGDNP--FALLLPDMIMS-PLEGENCMANMIKLYEKEGANILAVSECDPQLSCKYGMVQ 180 I+ +P +L D+ S PL+ M G L V++ + + +G + Sbjct: 102 ILAGSPSAVFVLNADVCCSFPLQD---MLE--AHRRYGGIGTLLVTKVSREQASNFGCL- 155 Query: 181 VGKAIDHQVFHISDMIEKPDSSTFISNFFINGRYILHPDIFSILNDWKENEGKGEIQLTD 240 V +V H +EKP STF+S+ G Y+ P+IF+ + + D Sbjct: 156 VEDPSTGEVLH---YVEKP--STFVSDIINCGVYLFTPEIFNAIAEVYRQRQDLLEVEKD 210 Query: 241 SMRKLSERHDFLAYHFKGHTYDCGSKKGFVLANIAF 276 DF+ + GSK+ + F Sbjct: 211 LPLLQPGPADFIRLEQDVLSPLAGSKQLYAYETTDF 246 >gnl|CDD|133020 cd02540, GT2_GlmU_N_bac, N-terminal domain of bacterial GlmU. The N-terminal domain of N-Acetylglucosamine-1-phosphate uridyltransferase (GlmU). GlmU is an essential bacterial enzyme with both an acetyltransferase and an uridyltransferase activity which have been mapped to the C-terminal and N-terminal domains, respectively. This family represents the N-terminal uridyltransferase. GlmU performs the last two steps in the synthesis of UDP-N-acetylglucosamine (UDP-GlcNAc), which is an essential precursor in both the peptidoglycan and the lipopolysaccharide metabolic pathways in Gram-positive and Gram-negative bacteria, respectively. Length = 229 Score = 45.2 bits (108), Expect = 2e-05 Identities = 52/233 (22%), Positives = 89/233 (38%), Gaps = 48/233 (20%) Query: 15 AGLG--MRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLIKDYFD 72 AG G M+ S +PK + + +P++++V++ A G V V G G +K Sbjct: 6 AGKGTRMK----SD-LPKVLHPLAGKPMLEHVLDAARALGPDRIVVVVGHGAEQVKKA-- 58 Query: 73 IQFELEQSLRKRNKKAELTLLAESIPSIGNAVFTWQYERKGLGHAVWCARN-IIGDNPFA 131 LA N F Q E+ G GHAV A + Sbjct: 59 --------------------LANP-----NVEFVLQEEQLGTGHAVKQALPALKDFEGDV 93 Query: 132 LLLP-DMIMSPLEGENCMANMIKLYEKEGANILAVSECDPQLSCKYGMVQVGKAIDHQVF 190 L+L D+ PL + +++ + + GA++ V + + YG + I Sbjct: 94 LVLYGDV---PLITPETLQRLLEAHREAGADV-TVLTAELEDPTGYGRI-----IRDGNG 144 Query: 191 HISDMIEKPDSSTF-ISNFFIN-GRYILH-PDIFSILNDWKENEGKGEIQLTD 240 + ++E+ D++ + +N G Y +F L N +GE LTD Sbjct: 145 KVLRIVEEKDATEEEKAIREVNAGIYAFDAEFLFEALPKLTNNNAQGEYYLTD 197 >gnl|CDD|133065 cd06915, NTP_transferase_WcbM_like, WcbM_like is a subfamily of nucleotidyl transferases. WcbM protein of Burkholderia mallei is involved in the biosynthesis, export or translocation of capsule. It is a subfamily of nucleotidyl transferases that transfer nucleotides onto phosphosugars. Length = 223 Score = 44.9 bits (107), Expect = 2e-05 Identities = 17/57 (29%), Positives = 29/57 (50%) Query: 16 GLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLIKDYFD 72 GLG R + K +PK + + RP ++Y++E G++ V G I++YF Sbjct: 7 GLGTRLRSVVKDLPKPLAPVAGRPFLEYLLEYLARQGISRIVLSVGYLAEQIEEYFG 63 >gnl|CDD|133041 cd04198, eIF-2B_gamma_N, The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2. N-terminal domain of gamma subunit of the eukaryotic translation initiation factor 2B (eIF-2B): eIF-2B is a guanine nucleotide-exchange factor which mediates the exchange of GDP (bound to initiation factor eIF2) for GTP, generating active eIF2.GTP complex. EIF2B is a complex multimeric protein consisting of five subunits named alpha, beta, gamma, delta and epsilon. Subunit gamma shares sequence similarity with epsilon subunit, and with a family of bifunctional nucleotide-binding enzymes such as ADP-glucose pyrophosphorylase, suggesting that epsilon subunit may play roles in nucleotide binding activity. In yeast, eIF2B gamma enhances the activity of eIF2B-epsilon leading to the idea that these subunits form the catalytic subcomplex. Length = 214 Score = 44.6 bits (106), Expect = 3e-05 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Query: 9 KAVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTD-FVFVTGRGKGLI 67 +AV G G R +P++ IPK +L + ++P+I Y ++ +AG D V V + I Sbjct: 2 QAVILAGGGGSRLYPLTDNIPKALLPVANKPMIWYPLDWLEKAGFEDVIVVVPEEEQAEI 61 Query: 68 KDYFD 72 Y Sbjct: 62 STYLR 66 >gnl|CDD|133001 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity. N-terminal domain of eEIF-2B epsilon and gamma, subunits of eukaryotic translation initiators, is a subfamily of glycosyltranferase 2 and is predicted to have glycosyltranferase activity. eIF-2B is a guanine nucleotide-exchange factor which mediates the exchange of GDP (bound to initiation factor eIF2) for GTP, generating active eIF2.GTP complex. EIF2B is a complex multimeric protein consisting of five subunits named alpha, beta, gamma, delta and epsilon. Subunit epsilon shares sequence similarity with gamma subunit, and with a family of bifunctional nucleotide-binding enzymes such as ADP-glucose pyrophosphorylase, suggesting that epsilon subunit may play roles in nucleotide binding activity. In yeast, eIF2B gamma enhances the activity of eIF2B-epsilon leading to the idea that these subunits form the catalytic subcomplex. Length = 216 Score = 44.6 bits (106), Expect = 3e-05 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Query: 15 AGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTD-FVFVT 60 G G RF P++ IPK +L + + P+I Y +E +AG+ + FV Sbjct: 8 DGFGSRFLPLTSDIPKALLPVANVPLIDYTLEWLEKAGVEEVFVVCC 54 >gnl|CDD|31406 COG1213, COG1213, Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane]. Length = 239 Score = 43.3 bits (102), Expect = 8e-05 Identities = 36/137 (26%), Positives = 60/137 (43%), Gaps = 28/137 (20%) Query: 6 KVRKAVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVT-GRGK 64 KAV AG G R P IPK ++ + R +I IE +AG+T+FV VT G Sbjct: 2 HPMKAVILAAGFGSRLGP---DIPKALVEVGGREIIYRTIENLAKAGITEFVVVTNGYRA 58 Query: 65 GLIKDYFDIQFELEQSLRKRNKKAELTLLAESIPSIGNAVFTWQYERKGLGHAVWCARNI 124 L++++ L+K A++ V YE+ G+++ A++ Sbjct: 59 DLVEEF----------LKKYPFNAKI-------------VINSDYEKTNTGYSLLLAKDY 95 Query: 125 IGDNPFALLLPDMIMSP 141 + F L++ D + P Sbjct: 96 MDGR-FILVMSDHVYEP 111 >gnl|CDD|133047 cd06425, M1P_guanylylT_B_like_N, N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins. GDP-mannose pyrophosphorylase (GTP: alpha-d-mannose-1-phosphate guanyltransferase) catalyzes the formation of GDP-d-mannose from GTP and alpha-d-mannose-1-Phosphate. It contains an N-terminal catalytic domain and a C-terminal Lefthanded-beta-Helix fold domain. GDP-d-mannose is the activated form of mannose for formation of cell wall lipoarabinomannan and various mannose-containing glycolipids and polysaccharides. The function of GDP-mannose pyrophosphorylase is essential for cell wall integrity, morphogenesis and viability. Repression of GDP-mannose pyrophosphorylase in yeast leads to phenotypes, such as cell lysis, defective cell wall, and failure of polarized growth and cell separation. Length = 233 Score = 43.0 bits (102), Expect = 1e-04 Identities = 61/222 (27%), Positives = 101/222 (45%), Gaps = 51/222 (22%) Query: 9 KAVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLIK 68 KA+ + G G R P++ +PK ++ ++P+I++ IE +AG+ + + L Sbjct: 2 KALILVGGYGTRLRPLTLTVPKPLVEFCNKPMIEHQIEALAKAGVKEII--------LAV 53 Query: 69 DYFDIQFELEQSLRKRNKKAELTLLAESIPSIGNAVFTWQYERKGLGHA--VWCARNIIG 126 +Y ++ L++ KK + + SI E + LG A + AR+++G Sbjct: 54 NYR--PEDMVPFLKEYEKKLGIKI----TFSI---------ETEPLGTAGPLALARDLLG 98 Query: 127 --DNPFALLLPDMIMS-PLEGENCMANMIKLYEKEGAN--ILA--VSECDPQLSCKYGMV 179 D PF +L D+I PL A ++ ++K GA IL V + KYG+V Sbjct: 99 DDDEPFFVLNSDVICDFPL------AELLDFHKKHGAEGTILVTKVEDPS-----KYGVV 147 Query: 180 QVGKAIDHQVFHISDMIEKPDSSTFISNFFIN-GRYILHPDI 220 D I +EKP F+ N IN G YIL+P + Sbjct: 148 ----VHDENTGRIERFVEKP--KVFVGNK-INAGIYILNPSV 182 >gnl|CDD|133044 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family. This is a subfamily of nucleotidyl transferases. Nucleotidyl transferases transfer nucleotides onto phosphosugars. The activated sugars are precursors for synthesis of lipopolysaccharide, glycolipids and polysaccharides. Other subfamilies of nucleotidyl transferases include Alpha-D-Glucose-1-Phosphate Cytidylyltransferase, Mannose-1-phosphate guanyltransferase, and Glucose-1-phosphate thymidylyltransferase. Length = 221 Score = 41.8 bits (99), Expect = 2e-04 Identities = 26/128 (20%), Positives = 49/128 (38%), Gaps = 28/128 (21%) Query: 15 AGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLIKDYFDIQ 74 AGLG R P++ PK ++ + +P+I + ++ AG+ V T I+ + Sbjct: 7 AGLGTRMRPLTDTRPKPLVPVAGKPLIDHALDRLAAAGIRRIVVNTHHLADQIEAHL--- 63 Query: 75 FELEQSLRKRNKKAELTLLAESIPSIGNAVFTWQYERKGL---GHAVWCARNIIGDNPFA 131 + + L + T E L G + A ++GD PF Sbjct: 64 ---------GDSRFGLRI-------------TISDEPDELLETGGGIKKALPLLGDEPFL 101 Query: 132 LLLPDMIM 139 ++ D++ Sbjct: 102 VVNGDILW 109 >gnl|CDD|133040 cd04197, eIF-2B_epsilon_N, The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2. N-terminal domain of epsilon subunit of the eukaryotic translation initiation factor 2B (eIF-2B): eIF-2B is a guanine nucleotide-exchange factor which mediates the exchange of GDP (bound to initiation factor eIF2) for GTP, generating active eIF2.GTP complex. EIF2B is a complex multimeric protein consisting of five subunits named alpha, beta, gamma, delta and epsilon. Subunit epsilon shares sequence similarity with gamma subunit, and with a family of bifunctional nucleotide-binding enzymes such as ADP-glucose pyrophosphorylase, suggesting that epsilon subunit may play roles in nucleotide binding activity. In yeast, eIF2B gamma enhances the activity of eIF2B-epsilon leading to the idea that these subunits form the catalytic subcomplex. Length = 217 Score = 39.9 bits (94), Expect = 9e-04 Identities = 14/52 (26%), Positives = 25/52 (48%) Query: 20 RFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLIKDYF 71 RF P++K P+ +L + + P+I Y +E G+ + IK+Y Sbjct: 13 RFRPLTKEKPRCLLPLANVPLIDYTLEFLALNGVEEVFVFCCSHSDQIKEYI 64 >gnl|CDD|30797 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]. Length = 393 Score = 38.2 bits (89), Expect = 0.003 Identities = 30/128 (23%), Positives = 58/128 (45%), Gaps = 7/128 (5%) Query: 151 MIKLYEKEGANI-LAVSECDPQLSCKYGMVQVGKAIDHQVFHISDMIEKPDSSTFISNFF 209 M+ + + GA++ +AV E + + ++G++ V + I + +EKP ++ Sbjct: 138 MLDFHIESGADVTVAVKEVPREEASRFGVMNVDEN-----GRIIEFVEKPADGPPSNSLA 192 Query: 210 INGRYILHPDI-FSILNDWKENEGKGEIQLTDSMRKLSERHDFLAYHFKGHTYDCGSKKG 268 G YI + D+ +L + ++ D + KL ER AY F G+ D G+ Sbjct: 193 SMGIYIFNTDLLKELLEEDAKDPNSSHDFGKDIIPKLLERGKVYAYEFSGYWRDVGTIDS 252 Query: 269 FVLANIAF 276 + AN+ Sbjct: 253 YYEANMDL 260 >gnl|CDD|133026 cd04183, GT2_BcE_like, GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule. GT2_BcbE_like: The bcbE gene is one of the genes in the capsule biosynthetic locus of Pasteurella multocida. Its deducted product is likely involved in the biosynthesis of the polysaccharide capsule, which is found on surface of a wide range of bacteria. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Length = 231 Score = 38.0 bits (89), Expect = 0.003 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 7/85 (8%) Query: 11 VFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLIKDY 70 + P+AGLG RF PK ++ + +P+I++VIE + + F+F+ +D Sbjct: 2 IIPMAGLGSRFKKAGYTYPKPLIEVDGKPMIEWVIESLAKIFDSRFIFI-------CRDE 54 Query: 71 FDIQFELEQSLRKRNKKAELTLLAE 95 + +F L++SL+ A + L Sbjct: 55 HNTKFHLDESLKLLAPNATVVELDG 79 >gnl|CDD|133050 cd06428, M1P_guanylylT_A_like_N, N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase. N-terminal domain of the M1P-guanylyltransferase A-isoform like proteins: The proteins of this family are likely to be a isoform of GDP-mannose pyrophosphorylase. Their sequences are highly conserved with mannose-1-phosphate guanyltransferase, but generally about 40-60 bases longer. GDP-mannose pyrophosphorylase (GTP: alpha-d-mannose-1-phosphate guanyltransferase) catalyzes the formation of GDP-d-mannose from GTP and alpha-d-mannose-1-Phosphate. It contains an N-terminal catalytic domain that resembles a dinucleotide-binding Rossmann fold and a C-terminal LbH fold domain. GDP-d-mannose is the activated form of mannose for formation of cell wall lipoarabinomannan and various mannose-containing glycolipids and polysaccharides. The function of GDP-mannose pyrophosphorylase is essential for cell wall integrity, morphogenesis and viability. Repression of GDP-mannose pyrophosphorylase in yeast leads to phenotypes including cell lysis, defective cell wall, and failure of polarized growth and cell separation. Length = 257 Score = 37.6 bits (88), Expect = 0.004 Identities = 59/244 (24%), Positives = 101/244 (41%), Gaps = 52/244 (21%) Query: 18 GMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLIKDYFDIQFEL 77 G RF P+S +PK + + +P+I + IE A + D +K+ I F Sbjct: 11 GTRFRPLSLDVPKPLFPVAGKPMIHHHIEAC--AKVPD-----------LKEVLLIGFYP 57 Query: 78 EQSLRKRNKKAELTLLAESIPSIGNAVFTWQY--ERKGLGHA--VWCARNII-GDNPFAL 132 E A+ E I +Y E K LG A ++ R+ I NP A Sbjct: 58 ESVFSDFISDAQ----QEFNVPI-------RYLQEYKPLGTAGGLYHFRDQILAGNPSAF 106 Query: 133 LLPDMIMSPLEGENC----MANMIKLYEKEGAN--ILAVSECDPQLSCKYGMVQVGKAID 186 + L + C + +++ ++K GA+ IL E + + YG + V Sbjct: 107 FV-------LNADVCCDFPLQELLEFHKKHGASGTILGT-EASREQASNYGCI-VEDPST 157 Query: 187 HQVFHISDMIEKPDSSTFISNFFIN-GRYILHPDIFS-ILNDWKENEGKGEIQLTDSMRK 244 +V H +EKP TF+S+ IN G Y+ P+IF I ++ + + ++ ++ Sbjct: 158 GEVLH---YVEKP--ETFVSD-LINCGVYLFSPEIFDTIKKAFQSRQQEAQLGDDNNREG 211 Query: 245 LSER 248 +E Sbjct: 212 RAEV 215 >gnl|CDD|36675 KOG1462, KOG1462, KOG1462, Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis]. Length = 433 Score = 35.7 bits (82), Expect = 0.015 Identities = 22/95 (23%), Positives = 43/95 (45%), Gaps = 5/95 (5%) Query: 9 KAVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLIK 68 +AV G G R ++ +PK +L I ++P+I Y + +AG T+ + V + L Sbjct: 11 QAVVLAGGGGTRMPEVTSRLPKALLPIGNKPMILYPLNSLEQAGFTEIIVVVNEDEKL-- 68 Query: 69 DYFDIQFELEQSLRKRNKKAELTLLAESIPSIGNA 103 DI+ L ++ + + + + + G A Sbjct: 69 ---DIESALGSNIDLKKRPDYVEIPTDDNSDFGTA 100 >gnl|CDD|133009 cd02516, CDP-ME_synthetase, CDP-ME synthetase is involved in mevalonate-independent isoprenoid production. 4-diphosphocytidyl-2-methyl-D-erythritol synthase (CDP-ME), also called 2C-methyl-d-erythritol 4-phosphate cytidylyltransferase catalyzes the third step in the alternative (non-mevalonate) pathway of Isopentenyl diphosphate (IPP) biosynthesis: the formation of 4-diphosphocytidyl-2C-methyl-D-erythritol from CTP and 2C-methyl-D-erythritol 4-phosphate. This mevalonate independent pathway that utilizes pyruvate and glyceraldehydes 3-phosphate as starting materials for production of IPP occurs in a variety of bacteria, archaea and plant cells, but is absent in mammals. Thus, CDP-ME synthetase is an attractive targets for the structure-based design of selective antibacterial, herbicidal and antimalarial drugs. Length = 218 Score = 34.4 bits (80), Expect = 0.038 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Query: 10 AVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVT 60 A+ AG G R IPK+ L + +PV+++ +E L D + V Sbjct: 3 AIILAAGSGSRM---GADIPKQFLELGGKPVLEHTLEAFLAHPAIDEIVVV 50 >gnl|CDD|32251 COG2068, COG2068, Uncharacterized MobA-related protein [General function prediction only]. Length = 199 Score = 34.1 bits (78), Expect = 0.042 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 5/56 (8%) Query: 10 AVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKG 65 AV AG R PK + + +P+++ E AL AGL + VTG Sbjct: 8 AVVLAAGRSSRMGQ-----PKLLAPLDGKPLVRASAETALSAGLDRVIVVTGHRVA 58 >gnl|CDD|133015 cd02524, G1P_cytidylyltransferase, G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose. Alpha-D-Glucose-1-phosphate Cytidylyltransferase catalyzes the production of CDP-D-Glucose from alpha-D-Glucose-1-phosphate and MgCTP as substrate. CDP-D-Glucose is the precursor for synthesizing four of the five naturally occurring 3,6-dideoxy sugars-abequose (3,6-dideoxy-D-Xylo-hexose), ascarylose (3,6-dideoxy-L-arabino-hexose), paratose (3,6-dideoxy-D-ribohexose), and tyvelose (3,6-dideoxy-D-arabino-hexose. Deoxysugars are ubiquitous in nature where they function in a variety of biological processes, including cell adhesion, immune response, determination of ABO blood groups, fertilization, antibiotic function, and microbial pathogenicity. Length = 253 Score = 34.1 bits (79), Expect = 0.044 Identities = 18/56 (32%), Positives = 31/56 (55%) Query: 16 GLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLIKDYF 71 GLG R +++ PK M+ I RP++ ++++ G DF+ G +IK+YF Sbjct: 7 GLGTRLSEETELKPKPMVEIGGRPILWHIMKIYSHYGHNDFILCLGYKGHVIKEYF 62 >gnl|CDD|145475 pfam02348, CTP_transf_3, Cytidylyltransferase. This family consists of two main Cytidylyltransferase activities: 1) 3-deoxy-manno-octulosonate cytidylyltransferase,, EC:2.7.7.38 catalysing the reaction:- CTP + 3-deoxy-D-manno-octulosonate <=> diphosphate + CMP-3-deoxy-D-manno-octulosonate, 2) acylneuraminate cytidylyltransferase EC:2.7.7.43,, catalysing the reaction:- CTP + N-acylneuraminate <=> diphosphate + CMP-N-acylneuraminate. NeuAc cytydilyltransferase of Mannheimia haemolytica has been characterized describing kinetics and regulation by substrate charge, energetic charge and amino-sugar demand. Length = 197 Score = 33.4 bits (77), Expect = 0.080 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 25 SKVIP-KEMLAIVDRPVIQYVIEEALEAGLTDFVFVT 60 SK +P K +L + +P+I VIE AL++ L D V V Sbjct: 10 SKRLPGKNLLKLGGKPLIARVIEAALQSKLFDKVVVA 46 >gnl|CDD|133025 cd04182, GT_2_like_f, GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families. Length = 186 Score = 32.1 bits (74), Expect = 0.20 Identities = 13/47 (27%), Positives = 24/47 (51%), Gaps = 5/47 (10%) Query: 15 AGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTG 61 AG R K +L + +P++++ ++ AL AGL+ + V G Sbjct: 8 AGRSSRMGG-----NKLLLPLDGKPLLRHALDAALAAGLSRVIVVLG 49 >gnl|CDD|40024 KOG4827, KOG4827, KOG4827, Uncharacterized conserved protein [Function unknown]. Length = 279 Score = 31.8 bits (71), Expect = 0.21 Identities = 25/113 (22%), Positives = 39/113 (34%), Gaps = 21/113 (18%) Query: 109 YERKGLGHAVWCARNIIGDNPFALLLPDMIMSPLEGENCMANMI--------------KL 154 E K H GD+ + L + + P E +A++ + Sbjct: 113 AEEKDAFHNFL-----KGDDFEKIQLHSLTIFPPGREFVIASVAARCDPEDGKYHDEAFI 167 Query: 155 YEKEGANILAVSECDPQLSCKYGMVQVGKAIDHQVFHI--SDMIEKPDSSTFI 205 EGANILA S+ P+ +C+Y A H PD++ F Sbjct: 168 CHDEGANILASSQGSPKGACQYPRQLKLPAKWSFNSHTIGESSEPAPDTAAFT 220 >gnl|CDD|133006 cd02513, CMP-NeuAc_Synthase, CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety. CMP-N-acetylneuraminic acid synthetase (CMP-NeuAc synthetase) or acylneuraminate cytidylyltransferase catalyzes the transfer the CMP moiety of CTP to the anomeric hydroxyl group of NeuAc in the presence of Mg++. It is the second to last step in the sialylation of the oligosaccharide component of glycoconjugates by providing the activated sugar-nucleotide cytidine 5'-monophosphate N-acetylneuraminic acid (CMP-Neu5Ac), the substrate for sialyltransferases. Eukaryotic CMP-NeuAc synthetases are predominantly located in the nucleus. The activated CMP-Neu5Ac diffuses from the nucleus into the cytoplasm. Length = 223 Score = 31.7 bits (73), Expect = 0.23 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 25 SKVIP-KEMLAIVDRPVIQYVIEEALEAGLTDFVFVT 60 SK IP K + + +P+I + IE ALE+ L D V V+ Sbjct: 12 SKGIPGKNIRPLGGKPLIAWTIEAALESKLFDRVVVS 48 >gnl|CDD|36674 KOG1461, KOG1461, KOG1461, Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis]. Length = 673 Score = 31.8 bits (72), Expect = 0.23 Identities = 13/51 (25%), Positives = 24/51 (47%) Query: 20 RFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLIKDY 70 RF P++ P+ +L + + P+I Y +E AG+ + I +Y Sbjct: 37 RFRPLTLEKPRVLLPLANVPMIDYTLEWLERAGVEEVFVFCSAHAAQIIEY 87 >gnl|CDD|31178 COG0836, {ManC}, Mannose-1-phosphate guanylyltransferase [Cell envelope biogenesis, outer membrane]. Length = 333 Score = 31.7 bits (72), Expect = 0.25 Identities = 44/217 (20%), Positives = 82/217 (37%), Gaps = 38/217 (17%) Query: 16 GLGMRFFPIS-KVIPKEMLAIV-DRPVIQYVIEEALE-AGLTDFVFVTGRGKGLIKDYFD 72 G G R +P+S K PK+ L + D ++Q ++ + + + VT + Y Sbjct: 10 GSGSRLWPLSRKDYPKQFLKLFGDLSLLQQTVKRLAFLGDIEEPLVVTN------EKYRF 63 Query: 73 IQFELEQSLRKRNKKAELTLLAE-----SIPSIGNAVFTWQYERKGLGHAVWCARNIIGD 127 I E L + + + ++ E + P+I A A+ G Sbjct: 64 IVKE---QLPEIDIENAAGIILEPEGRNTAPAIALA-------------ALSATAE--GG 105 Query: 128 NPFALLLPD--MIMSPLEGENCMANMIKLYEKEGANILAVSECDPQLSCKYGMVQVG-KA 184 + L+LP +I N + K E+ G + P YG ++ G Sbjct: 106 DALVLVLPSDHVIADEEAFLNAVKKAEKAAEEGGIVTFGIPPTRP--ETGYGYIETGESI 163 Query: 185 IDHQVFHISDMIEKPDSSTFISNFFINGRYILHPDIF 221 ++ V+ + +EKPD T + +G Y+ + +F Sbjct: 164 AENGVYKVDRFVEKPDLETAKK-YVESGEYLWNSGMF 199 >gnl|CDD|31404 COG1211, IspD, 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism]. Length = 230 Score = 29.8 bits (67), Expect = 0.81 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Query: 10 AVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFV 59 AV AG G R +PK+ L + RP++++ +E LE+ D + V Sbjct: 7 AVILAAGFGSRM---GNPVPKQYLELGGRPLLEHTLEAFLESPAIDEIVV 53 >gnl|CDD|133003 cd02509, GDP-M1P_Guanylyltransferase, GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose. GDP-mannose-1-phosphate guanylyltransferase, also called GDP-mannose pyrophosphorylase (GDP-MP), catalyzes the formation of GDP-Mannose from mannose-1-phosphate and GTP. Mannose is a key monosaccharide for glycosylation of proteins and lipids. GDP-Mannose is the activated donor for mannosylation of various biomolecules. This enzyme is known to be bifunctional, as both mannose-6-phosphate isomerase and mannose-1-phosphate guanylyltransferase. This CD covers the N-terminal GDP-mannose-1-phosphate guanylyltransferase domain, whereas the isomerase function is located at the C-terminal half. GDP-MP is a member of the nucleotidyltransferase family of enzymes. Length = 274 Score = 29.5 bits (67), Expect = 1.3 Identities = 13/52 (25%), Positives = 25/52 (48%), Gaps = 6/52 (11%) Query: 176 YGMVQVGKAIDHQVFHISDMIEKPDSST---FIS--NFFIN-GRYILHPDIF 221 YG ++ G+ + V+ + +EKPD T ++ N+ N G ++ F Sbjct: 151 YGYIEAGEKLGGGVYRVKRFVEKPDLETAKEYLESGNYLWNSGIFLFRAKTF 202 >gnl|CDD|36468 KOG1254, KOG1254, KOG1254, ATP-citrate lyase [Energy production and conversion]. Length = 600 Score = 28.8 bits (64), Expect = 1.7 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 45 IEEALEAGLTDFVFVTGRGKGLIKDYFDIQFELEQSL 81 +E + G + +FV GR G I Y D Q L+Q L Sbjct: 553 ADEYINIGALNGLFVLGRSIGFIGHYLD-QKRLKQGL 588 >gnl|CDD|31280 COG1083, NeuA, CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane]. Length = 228 Score = 28.7 bits (64), Expect = 1.9 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Query: 25 SKVIP-KEMLAIVDRPVIQYVIEEALEAGLTDFVFVTGRGKGLIKD 69 SK I K + +P+I Y IE AL + L D V ++ + ++++ Sbjct: 14 SKGIKNKNIRKFGGKPLIGYTIEAALNSKLFDKVVISSDSEEILEE 59 >gnl|CDD|145819 pfam02867, Ribonuc_red_lgC, Ribonucleotide reductase, barrel domain. Length = 516 Score = 28.3 bits (64), Expect = 2.6 Identities = 10/24 (41%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Query: 217 HPDIFSILNDWKENEGKGEIQLTD 240 HPDI L D K+N G E++ + Sbjct: 89 HPDIEEFL-DLKKNNGDEEVRARN 111 >gnl|CDD|35434 KOG0213, KOG0213, KOG0213, Splicing factor 3b, subunit 1 [RNA processing and modification]. Length = 1172 Score = 28.1 bits (62), Expect = 2.7 Identities = 20/89 (22%), Positives = 38/89 (42%), Gaps = 10/89 (11%) Query: 1 MGSLKKVRKAVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFVT 60 +GS+ KA+ + G+ PI ++P+ + +R E ++ D V Sbjct: 858 LGSILGAIKAIVNVIGMTKMTPPIKDLLPRLTPILKNR-------HEKVQENCIDLVGTI 910 Query: 61 G-RGKGLI--KDYFDIQFELEQSLRKRNK 86 RG + +++ I FEL + L+ K Sbjct: 911 ADRGPEYVSAREWMRICFELLELLKAHKK 939 >gnl|CDD|48466 cd00782, MutL_Trans, MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the C-terminal domain of DNA mismatch repair (MutL/MLH1/PMS2) family. This transducer domain is homologous to the second domain of the DNA gyrase B subunit, which is known to be important in nucleotide hydrolysis and the transduction of structural signals from ATP-binding site to the DNA breakage/reunion regions of the enzymes. Included in this group are proteins similar to human MLH1, hPMS2, hPMS1, hMLH3 and E. coli MutL, MLH1 forms heterodimers with PMS2, PMS1 and MLH3. These three complexes have distinct functions in meiosis. hMLH1-hPMS2 also participates in the repair of all DNA mismatch repair (MMR) substrates. Roles for hMLH1-hPMS1 or hMLH1-hMLH3 in MMR have not been established. Cells lacking either hMLH1 or hPMS2 have a strong mutator phenotype and display microsatellite instability (MSI). Mutation in hMLH1 causes predisposition to HNPCC, Muir-Torre syndrome and Turcot syndrome (HNPCC variant). Mutation in hPMS2 causes predisposition to HPNCC and Turcot syndrome. Mutation in hMLH1 accounts for a large fraction of HNPCC families. There is no convincing evidence to support hPMS1 having a role in HNPCC predisposition. It has been suggested that hMLH3 may be a low risk gene for colorectal cancer; however there is little evidence to support it having a role in classical HNPCC. It has been suggested that during initiation of DNA mismatch repair in E. coli, the mismatch recognition protein MutS recruits MutL in the presence of ATP. The MutS(ATP)-MutL ternary complex formed, then recruits the latent endonuclease MutH.. Length = 122 Score = 28.3 bits (63), Expect = 2.8 Identities = 12/40 (30%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Query: 190 FHISDMIEKPDSSTFISN---FFINGRYILHPDIFSILND 226 F IS I KPD + F+NGR + + +N+ Sbjct: 27 FRISGYISKPDFGRSSKDRQFLFVNGRPVRDKLLSKAINE 66 >gnl|CDD|112090 pfam03260, Lipoprotein_11, Lepidopteran low molecular weight (30 kD) lipoprotein. Length = 253 Score = 28.2 bits (63), Expect = 2.9 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Query: 60 TGRGKGLIKDYFDIQFEL---EQSLRKRNKKAELTL 92 G GK ++K YF IQF L E +++ NK+ L L Sbjct: 80 VGEGKDIVKKYFPIQFRLIFAENTVKLINKRDNLAL 115 >gnl|CDD|36671 KOG1458, KOG1458, KOG1458, Fructose-1,6-bisphosphatase [Carbohydrate transport and metabolism]. Length = 343 Score = 27.2 bits (60), Expect = 5.5 Identities = 25/106 (23%), Positives = 43/106 (40%), Gaps = 22/106 (20%) Query: 73 IQFELEQSLRKRNKKAELTLL----AESIPSIGNAVFTWQYERKGLGH--AVWCARNIIG 126 +F LE+ + +N ELT L + +I +AV + GL + + N G Sbjct: 24 TRFVLEEQRKGKNATGELTQLLNSLQTACKAIASAV-----RKAGLAKLYGLAGSVNSTG 78 Query: 127 DNPFALLLPDMIMSPLEGENCMANMIKLYEKEGANILAVSECDPQL 172 D L D++ + L N ++ G + VSE + +L Sbjct: 79 DEQKKL---DVLSNDL-----FINALR---SSGRTKVLVSEENEEL 113 >gnl|CDD|88581 cd05395, RasGAP_RASA4, Ras GTPase activating-like 4 protein (RASAL4), also known as Ca2+ -promoted Ras inactivator (CAPRI), is a member of the GAP1 family. Members of the GAP1 family are characterized by a conserved domain structure comprising N-terminal tandem C2 domains, a highly conserved central RasGAP domain, and a C-terminal pleckstrin-homology domain that is associated with a Bruton's tyrosine kinase motif. RASAL4, like RASAL, is a cytosolic protein that undergoes a rapid translocation to the plasma membrane in response to a receptor-mediated elevation in the concentration of intracellular free Ca2+ ([Ca2+]i). However, unlike RASAL, RASAL4 does not sense oscillations in [Ca2+]i.. Length = 337 Score = 27.0 bits (59), Expect = 6.4 Identities = 8/16 (50%), Positives = 14/16 (87%) Query: 63 GKGLIKDYFDIQFELE 78 G+GL+K++ D+ F+LE Sbjct: 50 GQGLVKEFLDLLFKLE 65 >gnl|CDD|146987 pfam04609, MCR_C, Methyl-coenzyme M reductase operon protein C. Methyl coenzyme M reductase (MCR) catalyses the final step in methanogenesis. MCR is composed of three subunits, alpha (pfam02249), beta (pfam02241) and gamma (pfam02240). Genes encoding the beta (mcrB) and gamma (mcrG) subunits are separated by two open reading frames coding for two proteins C and D. The function of proteins C and D (this family) is unknown. This family nowalso includes family MtrC_related,. Length = 268 Score = 26.7 bits (59), Expect = 7.4 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Query: 232 GKGEIQLTDSMRKLSERHDFLAYHFKGHTYDCGSKK 267 G+ QLT ++L HD +H G+ DC K Sbjct: 113 GRRIAQLTPEEKELINEHDLAVFHL-GNFKDCIVYK 147 >gnl|CDD|144638 pfam01119, DNA_mis_repair, DNA mismatch repair protein, C-terminal domain. This family represents the C-terminal domain of the mutL/hexB/PMS1 family. This domain has a ribosomal S5 domain 2-like fold. Length = 118 Score = 26.7 bits (60), Expect = 7.8 Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 11/54 (20%) Query: 176 YGMVQVGKAID----HQVFHISDMIEKPDSSTFISN-----FFINGRYILHPDI 220 YG + + +S I KP+ S SN F+NGR + + Sbjct: 5 YGREFAENLLPIDAEDEGLRLSGFISKPELSR--SNRDYQYLFVNGRPVRDKLL 56 >gnl|CDD|38277 KOG3067, KOG3067, KOG3067, Translin family protein [General function prediction only]. Length = 226 Score = 26.5 bits (58), Expect = 8.8 Identities = 14/63 (22%), Positives = 21/63 (33%), Gaps = 11/63 (17%) Query: 200 DSSTFISNFFINGRYILHPDIFSILNDWKENEGKGEIQLTDSMRKLSERHDFLAYHFKGH 259 + S N G Y + + +ND R L+ ++D L F G Sbjct: 149 ELSRQSVNSVTAGDYHRPLHVSNFINDLHSG-----------FRLLNLKNDSLRKRFDGL 197 Query: 260 TYD 262 YD Sbjct: 198 KYD 200 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.139 0.414 Gapped Lambda K H 0.267 0.0638 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,678,339 Number of extensions: 199814 Number of successful extensions: 547 Number of sequences better than 10.0: 1 Number of HSP's gapped: 525 Number of HSP's successfully gapped: 66 Length of query: 299 Length of database: 6,263,737 Length adjustment: 93 Effective length of query: 206 Effective length of database: 4,254,100 Effective search space: 876344600 Effective search space used: 876344600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 57 (25.9 bits)