>gi|254780367|ref|YP_003064780.1| ribonuclease protein [Candidatus Liberibacter asiaticus str. psy62]
MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP