BLAST/PSIBLAST alignment of GI: 254780367 and GI: 116254049 at iteration 1
>gi|116254049|ref|YP_769887.1| transmembrane ribonuclease protein [Rhizobium leguminosarum bv. viciae 3841] Length = 307
>gi|115258697|emb|CAK09802.1| putative transmembrane ribonuclease protein [Rhizobium leguminosarum bv. viciae 3841] Length = 307
 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 152/273 (55%), Positives = 209/273 (76%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M +    ++D++YDAI H VE+DG+AMASH++LS+LL+VFPF++FG  LA FLGA QF  
Sbjct: 1   MPKVLRTIYDVVYDAICHMVEDDGFAMASHVALSSLLAVFPFLIFGTALASFLGADQFSS 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T I ++F  WPE IAKP+ D++LQVL +P  GL TIS LAAAYF+SNGVEALRISLNRAY
Sbjct: 61  TAIHLIFDTWPEAIAKPLADQVLQVLTIPRGGLLTISVLAAAYFASNGVEALRISLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R+WY TRL S GYVL+A +    +S + VA+PLAL Y RK+FP   + L I+++ 
Sbjct: 121 RVQETRAWYFTRLASLGYVLIAVIIFTAISILLVALPLALDYSRKWFPLFADTLDIVFSW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           RIY T++ L +GL+ +HL+LPA K ++  ++PGV+ T + W+ GA++F +Y+ TF+ Y+ 
Sbjct: 181 RIYGTLVVLTVGLLVMHLWLPAGKRRVFDVIPGVLLTLLLWLAGALIFAYYLATFANYTA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
            YAGLAS+M  L+FLYM+GV FI+GAE+NA++I
Sbjct: 241 TYAGLASVMIVLIFLYMVGVIFIIGAEINAALI 273