BLAST/PSIBLAST alignment of GI: 254780367 and GI: 315121834 at iteration 1
>gi|315121834|ref|YP_004062323.1| ribonuclease protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 284
>gi|313495236|gb|ADR51835.1| ribonuclease protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 284
 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 225/280 (80%), Positives = 255/280 (91%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M++YF I+F+I+YDA+EHFVEEDGWAMASHISL+ALLSVFPFIVF ANLAGFLGAH+FVP
Sbjct: 1   MQKYFGIIFNIVYDAVEHFVEEDGWAMASHISLAALLSVFPFIVFCANLAGFLGAHEFVP 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           TVI V FGAWP+VIAKPITDEI QVLAVP KGLFTISALAA YFSSNG+EALR+SLNRAY
Sbjct: 61  TVISVFFGAWPDVIAKPITDEIFQVLAVPRKGLFTISALAAVYFSSNGIEALRVSLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RVVEMRSWYITRLIS GYVLLAS+TLVIMSF+FV +PLALAYV+  FP+LGN++ I+WNG
Sbjct: 121 RVVEMRSWYITRLISLGYVLLASITLVIMSFIFVVVPLALAYVKTLFPSLGNMVEIVWNG 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R+Y  +LALFIGLIFVHLFLPA K K+  +LPG+IFT ISW++GAVLFTHYIVTFSTYS 
Sbjct: 181 RLYGAVLALFIGLIFVHLFLPAGKRKVWIVLPGIIFTSISWLIGAVLFTHYIVTFSTYSA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           MYAGLASI  CLVFLYMLGV FI+GAE+NAS II+YW K+
Sbjct: 241 MYAGLASITICLVFLYMLGVIFIIGAEINASTIIHYWEKR 280