BLAST/PSIBLAST alignment of GI: 254780367 and GI: 86359370 at iteration 1
>gi|86359370|ref|YP_471262.1| putative ribonuclease protein [Rhizobium etli CFN 42] Length = 307
>gi|86283472|gb|ABC92535.1| putative ribonuclease protein [Rhizobium etli CFN 42] Length = 307
 Score =  301 bits (772), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 151/273 (55%), Positives = 207/273 (75%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MR+    ++D++YDAI H VE+DG+AMASH++LS+LL+VFPF++FG  LA FLGA QF  
Sbjct: 1   MRKVLRTIYDVVYDAICHMVEDDGFAMASHVALSSLLAVFPFLIFGTALASFLGADQFSS 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T I ++F  WPE IAKP+ D++LQVL +   GL TIS LAAAYF+SNGVEALRISLNRAY
Sbjct: 61  TAIHLIFDTWPEAIAKPLADQVLQVLTIQRGGLLTISVLAAAYFASNGVEALRISLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R WY TRL S GYVL+A +    +S + VA+PLAL Y RK+ P   + L ++++ 
Sbjct: 121 RVQETRPWYFTRLASLGYVLIAVIIFAAISILLVAVPLALDYARKWLPLFADTLDVVFSW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           RIY T++ L IGL+ +HL+LPA K ++  ++PGV+ T + W+ GA++F +Y+ TF+ Y+ 
Sbjct: 181 RIYGTLVVLTIGLLVMHLWLPAGKRRVFDVIPGVLLTLLLWLAGALVFAYYLATFANYTA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
            YAGLAS+M  L+FLYM+GV FI+GAE+NA++I
Sbjct: 241 TYAGLASVMIVLIFLYMVGVIFIIGAEINAALI 273