BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780367|ref|YP_003064780.1| ribonuclease protein
[Candidatus Liberibacter asiaticus str. psy62]
         (281 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780367|ref|YP_003064780.1| ribonuclease protein [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040044|gb|ACT56840.1| ribonuclease protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 281

 Score =  558 bits (1437), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 281/281 (100%), Positives = 281/281 (100%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP
Sbjct: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY
Sbjct: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG
Sbjct: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST
Sbjct: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
           MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP
Sbjct: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281


>gi|315121834|ref|YP_004062323.1| ribonuclease protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495236|gb|ADR51835.1| ribonuclease protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 284

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 225/280 (80%), Positives = 255/280 (91%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M++YF I+F+I+YDA+EHFVEEDGWAMASHISL+ALLSVFPFIVF ANLAGFLGAH+FVP
Sbjct: 1   MQKYFGIIFNIVYDAVEHFVEEDGWAMASHISLAALLSVFPFIVFCANLAGFLGAHEFVP 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           TVI V FGAWP+VIAKPITDEI QVLAVP KGLFTISALAA YFSSNG+EALR+SLNRAY
Sbjct: 61  TVISVFFGAWPDVIAKPITDEIFQVLAVPRKGLFTISALAAVYFSSNGIEALRVSLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RVVEMRSWYITRLIS GYVLLAS+TLVIMSF+FV +PLALAYV+  FP+LGN++ I+WNG
Sbjct: 121 RVVEMRSWYITRLISLGYVLLASITLVIMSFIFVVVPLALAYVKTLFPSLGNMVEIVWNG 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R+Y  +LALFIGLIFVHLFLPA K K+  +LPG+IFT ISW++GAVLFTHYIVTFSTYS 
Sbjct: 181 RLYGAVLALFIGLIFVHLFLPAGKRKVWIVLPGIIFTSISWLIGAVLFTHYIVTFSTYSA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           MYAGLASI  CLVFLYMLGV FI+GAE+NAS II+YW K+
Sbjct: 241 MYAGLASITICLVFLYMLGVIFIIGAEINASTIIHYWEKR 280


>gi|222087339|ref|YP_002545876.1| ribonuclease protein [Agrobacterium radiobacter K84]
 gi|221724787|gb|ACM27943.1| ribonuclease protein [Agrobacterium radiobacter K84]
          Length = 310

 Score =  309 bits (791), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 145/279 (51%), Positives = 206/279 (73%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M  +   ++ ++YDA+ HFVE+DG+AMASH++LS LL+VFPF++FG  LA FLGA QF  
Sbjct: 1   MPTFVRALYKVVYDAVFHFVEDDGFAMASHVALSTLLAVFPFLIFGTALASFLGASQFSS 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T + ++F  WPE IAKP+ D+++QVL +P  GL TIS LAAAYF+SNGVEALRISLNRAY
Sbjct: 61  TAVHLIFDTWPEAIAKPVADQVVQVLTIPRGGLLTISVLAAAYFASNGVEALRISLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R WY  RL S GYVL+A +   ++S + VA+PLAL Y R++ P L ++L ++++ 
Sbjct: 121 RVPETRPWYFNRLASLGYVLIAVLIFALLSILLVAVPLALNYTRQWLPGLADILDVVFSW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           RIY T+  L  GL+ +HL+L A + ++  ++PGV  T + W +GA+LF +Y+ TF+ Y+ 
Sbjct: 181 RIYGTIFLLVAGLLILHLWLAAGRRRLFDVIPGVFLTLVFWSIGALLFAYYLSTFANYTA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            YAGLAS+M  L+FLYML V FI+GAE+NA+++ +  R+
Sbjct: 241 TYAGLASVMIVLIFLYMLAVIFIMGAEINAALMKFKVRR 279


>gi|86359370|ref|YP_471262.1| putative ribonuclease protein [Rhizobium etli CFN 42]
 gi|86283472|gb|ABC92535.1| putative ribonuclease protein [Rhizobium etli CFN 42]
          Length = 307

 Score =  301 bits (772), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 151/273 (55%), Positives = 207/273 (75%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MR+    ++D++YDAI H VE+DG+AMASH++LS+LL+VFPF++FG  LA FLGA QF  
Sbjct: 1   MRKVLRTIYDVVYDAICHMVEDDGFAMASHVALSSLLAVFPFLIFGTALASFLGADQFSS 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T I ++F  WPE IAKP+ D++LQVL +   GL TIS LAAAYF+SNGVEALRISLNRAY
Sbjct: 61  TAIHLIFDTWPEAIAKPLADQVLQVLTIQRGGLLTISVLAAAYFASNGVEALRISLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R WY TRL S GYVL+A +    +S + VA+PLAL Y RK+ P   + L ++++ 
Sbjct: 121 RVQETRPWYFTRLASLGYVLIAVIIFAAISILLVAVPLALDYARKWLPLFADTLDVVFSW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           RIY T++ L IGL+ +HL+LPA K ++  ++PGV+ T + W+ GA++F +Y+ TF+ Y+ 
Sbjct: 181 RIYGTLVVLTIGLLVMHLWLPAGKRRVFDVIPGVLLTLLLWLAGALVFAYYLATFANYTA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
            YAGLAS+M  L+FLYM+GV FI+GAE+NA++I
Sbjct: 241 TYAGLASVMIVLIFLYMVGVIFIIGAEINAALI 273


>gi|190893623|ref|YP_001980165.1| ribonuclease [Rhizobium etli CIAT 652]
 gi|190698902|gb|ACE92987.1| putative ribonuclease protein [Rhizobium etli CIAT 652]
          Length = 307

 Score =  298 bits (763), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 152/273 (55%), Positives = 208/273 (76%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MR+    ++D++YDAI H VE+DG+AMASH++LS+LL+VFPF++FG  LA FLGA QF  
Sbjct: 1   MRKVLRTIYDVVYDAICHMVEDDGFAMASHVALSSLLAVFPFLIFGTALASFLGADQFSS 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T I ++F  WPE IAKP+ D++LQVL +P  GL TIS LAAAYF+SNGVEALRISLNRAY
Sbjct: 61  TAIHLIFDTWPEAIAKPLADQVLQVLTIPRGGLLTISVLAAAYFASNGVEALRISLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R WY TRL S GYVL+A +    +S + VA+PLAL Y R +FP   + L I+++ 
Sbjct: 121 RVQETRPWYFTRLASLGYVLIAVIIFAAISILLVAVPLALDYARNWFPLFADTLDIVFSW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           RIY T++ L +GL+ +HL+LPA K ++  ++PGV+ T + W+ GA++F +Y+ TF+ Y+ 
Sbjct: 181 RIYGTLVVLTVGLLVMHLWLPAGKRRVFDVIPGVLLTLLLWLAGALIFAYYLATFANYTA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
            YAGLAS+M  L+FLYM+GV FI+GAE+NA++I
Sbjct: 241 TYAGLASVMIVLIFLYMVGVIFIIGAEINAALI 273


>gi|241206535|ref|YP_002977631.1| ribonuclease BN [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860425|gb|ACS58092.1| ribonuclease BN [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 307

 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 152/273 (55%), Positives = 209/273 (76%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M +    ++D++YDAI H VE+DG+AMASH++LS+LL+VFPF++FG  LA FLGA QF  
Sbjct: 1   MPKVLRTIYDVVYDAICHMVEDDGFAMASHVALSSLLAVFPFLIFGTALASFLGADQFSS 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T I ++F  WPE IAKP+ D++LQVL +P  GL TIS LAAAYF+SNGVEALRISLNRAY
Sbjct: 61  TAIHLIFDTWPEAIAKPLADQVLQVLTIPRGGLLTISVLAAAYFASNGVEALRISLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R+WY TRL S GYVL+A +    +S + VA+PLAL Y RK+FP   + L I+++ 
Sbjct: 121 RVQETRAWYFTRLASLGYVLIAVIIFTAISILLVALPLALDYSRKWFPLFADTLDIVFSW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           RIY T++ L +GL+ +HL+LPA K ++  ++PGV+ T + W+ GA++F +Y+ TF+ Y+ 
Sbjct: 181 RIYGTLVVLTVGLLVMHLWLPAGKRRVFDVIPGVLLTLLLWLAGALIFAYYLATFANYTA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
            YAGLAS+M  L+FLYM+GV FI+GAE+NA++I
Sbjct: 241 TYAGLASVMIVLIFLYMVGVIFIIGAEINAALI 273


>gi|116254049|ref|YP_769887.1| transmembrane ribonuclease protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115258697|emb|CAK09802.1| putative transmembrane ribonuclease protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 307

 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 152/273 (55%), Positives = 209/273 (76%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M +    ++D++YDAI H VE+DG+AMASH++LS+LL+VFPF++FG  LA FLGA QF  
Sbjct: 1   MPKVLRTIYDVVYDAICHMVEDDGFAMASHVALSSLLAVFPFLIFGTALASFLGADQFSS 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T I ++F  WPE IAKP+ D++LQVL +P  GL TIS LAAAYF+SNGVEALRISLNRAY
Sbjct: 61  TAIHLIFDTWPEAIAKPLADQVLQVLTIPRGGLLTISVLAAAYFASNGVEALRISLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R+WY TRL S GYVL+A +    +S + VA+PLAL Y RK+FP   + L I+++ 
Sbjct: 121 RVQETRAWYFTRLASLGYVLIAVIIFTAISILLVALPLALDYSRKWFPLFADTLDIVFSW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           RIY T++ L +GL+ +HL+LPA K ++  ++PGV+ T + W+ GA++F +Y+ TF+ Y+ 
Sbjct: 181 RIYGTLVVLTVGLLVMHLWLPAGKRRVFDVIPGVLLTLLLWLAGALIFAYYLATFANYTA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
            YAGLAS+M  L+FLYM+GV FI+GAE+NA++I
Sbjct: 241 TYAGLASVMIVLIFLYMVGVIFIIGAEINAALI 273


>gi|332716378|ref|YP_004443844.1| ribonuclease [Agrobacterium sp. H13-3]
 gi|325063063|gb|ADY66753.1| ribonuclease [Agrobacterium sp. H13-3]
          Length = 305

 Score =  295 bits (754), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 196/270 (72%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            + +DA  HF E+DGWAMASH++LS LL++FPF++FG  LAGFLGA QF  T + ++F  
Sbjct: 10  KVAFDAYSHFAEDDGWAMASHMALSILLALFPFLIFGTALAGFLGADQFSETAVHLIFDT 69

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           WPE IA P+  ++ QVL +P  GL TIS LAAAYF+SNGVEALRISLNRAYRV E R WY
Sbjct: 70  WPEAIAGPLAAQVQQVLTIPRGGLLTISVLAAAYFASNGVEALRISLNRAYRVTETRWWY 129

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           ITRL+S  YVL+A V    +S V VA+P+A ++  + FP L + L  + +  +Y T++ L
Sbjct: 130 ITRLLSLLYVLIAVVVFTGISIVLVAVPVATSFAEQRFPWLTDALNTVSSLGLYGTIVVL 189

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            +GL+  HL+LPA K +I  + PG++ T I WV+GA +F +Y+ TF+ Y+  YAGLAS+M
Sbjct: 190 TVGLVAAHLWLPAGKRRIWDVWPGILLTMIFWVIGAAIFAYYLSTFANYAATYAGLASVM 249

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             LVFLYM+GV F+LGAE+NA+++ Y  R+
Sbjct: 250 VVLVFLYMVGVIFMLGAEVNAALMKYKVRQ 279


>gi|209551132|ref|YP_002283049.1| ribonuclease BN [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209536888|gb|ACI56823.1| ribonuclease BN [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 307

 Score =  295 bits (754), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 151/273 (55%), Positives = 207/273 (75%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M +    ++D++YDAI H VE+DG+AMASH++LS+LL+VFPF++FG  LA FLGA QF  
Sbjct: 1   MPKALRTIYDVVYDAICHMVEDDGFAMASHVALSSLLAVFPFLIFGTALASFLGADQFSS 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T I ++F  WPE IAKP+ D++LQVL +P  GL TIS LAAAYF+SNGVEALRISLNRAY
Sbjct: 61  TAIHLIFDTWPEAIAKPLADQVLQVLTIPRGGLLTISVLAAAYFASNGVEALRISLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R WY TRL S GYVL+A +    +S + VA+PLAL Y R +FP   + L I+++ 
Sbjct: 121 RVQETRPWYFTRLASLGYVLIAVIIFAAISILLVAVPLALDYARNWFPLFADTLDIVFSW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           RIY T++ L +GL+ +HL+LPA K ++  ++PGV+ T + W+ GA++F +Y+ TF+ Y+ 
Sbjct: 181 RIYGTLVVLTVGLLVMHLWLPAGKRRVFDVIPGVLLTLLLWLAGALIFAYYLATFANYTA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
            YAGLAS+M  L+FLYM+GV FI+GAE+NA++I
Sbjct: 241 TYAGLASVMIVLIFLYMVGVIFIIGAEINAALI 273


>gi|218663736|ref|ZP_03519666.1| putative ribonuclease protein [Rhizobium etli IE4771]
          Length = 307

 Score =  294 bits (752), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 150/273 (54%), Positives = 207/273 (75%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MR+    ++D++YDAI H VE+DG+AMASH++LS+LL+VFPF++FG  LA FLGA QF  
Sbjct: 1   MRKVLRTIYDVVYDAICHMVEDDGFAMASHVALSSLLAVFPFLIFGTALASFLGADQFSS 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T I ++F  WPE IAKP+ D++LQVL +   GL TIS LAAAYF+SNGVEALRISLNRAY
Sbjct: 61  TAIHLIFDTWPEAIAKPLADQVLQVLTIQRGGLLTISVLAAAYFASNGVEALRISLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R+WY TRL S GYVL+A +    +S + VA+PLAL Y R +FP   + L I+++ 
Sbjct: 121 RVQETRAWYFTRLASLGYVLIAVIIFAAISILLVAVPLALDYARNWFPLFADTLGIVFSW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           RIY T++ L +GL+ +HL+LPA K ++  ++PGV+ T + W+ GA++F +Y+ TF+ Y+ 
Sbjct: 181 RIYGTLVVLTVGLLVMHLWLPAGKRRVFDVIPGVLLTLLLWLAGALIFAYYLATFANYTA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
            YAGLAS+M  L+FLYM+G  FI+GAE+NA++I
Sbjct: 241 TYAGLASVMIVLIFLYMVGAIFIIGAEINAALI 273


>gi|159185810|ref|NP_357022.2| transporter [Agrobacterium tumefaciens str. C58]
 gi|159140944|gb|AAK89807.2| transporter [Agrobacterium tumefaciens str. C58]
          Length = 305

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 195/270 (72%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            + +DA  HF E+DGWAMASH++LS LL++FPF++FG  LAGFLGA QF  T + ++F  
Sbjct: 10  KVAFDAYSHFAEDDGWAMASHMALSILLALFPFLIFGTALAGFLGADQFSETAVHLIFDT 69

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           WPE IA P+  ++ QVL +P  GL TIS LAAAYF+SNGVEALRISLNRAYRV E R WY
Sbjct: 70  WPEAIAGPLAAQVQQVLTIPRGGLLTISVLAAAYFASNGVEALRISLNRAYRVTETRWWY 129

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           +TRL+S  YVL+A V    +S V VA+P+A ++    FP L +LL  + +  +Y T++ L
Sbjct: 130 VTRLLSLLYVLIAVVVFTGISIVLVAVPVATSFAEARFPWLTDLLNTVSSLGLYGTIVVL 189

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
             GL+  HL+LPA K +I  + PG++ T I WV+GA +F +Y+ TF+ Y+  YAGLAS+M
Sbjct: 190 TAGLVAAHLWLPAGKRRIWDVWPGILLTMIFWVIGAAIFAYYLSTFANYAATYAGLASVM 249

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             LVFLYM+GV F+LGAE+NA+++ Y  R+
Sbjct: 250 VVLVFLYMVGVIFMLGAEVNAALMKYKVRQ 279


>gi|218674258|ref|ZP_03523927.1| putative ribonuclease protein [Rhizobium etli GR56]
          Length = 314

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 149/271 (54%), Positives = 204/271 (75%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV 62
           E    ++D++YDAI H VE+DG+AMASH++LS+LL+VFPF++FG  LA FLGA QF  T 
Sbjct: 10  EVLRTIYDVVYDAICHMVEDDGFAMASHVALSSLLAVFPFLIFGTALASFLGADQFSSTA 69

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
           I ++F  WPE IAKP+ D++LQVL +   GL TIS LAAAYF+SNGVEALRISLNRAYRV
Sbjct: 70  IHLIFDTWPEAIAKPLADQVLQVLTIQRGGLLTISVLAAAYFASNGVEALRISLNRAYRV 129

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E R WY TRL S GYVL+A +    +S + VA+PLAL Y R +FP   + L I+++ RI
Sbjct: 130 QETRPWYFTRLASLGYVLIAVIIFAAISILLVAVPLALDYARNWFPLFADTLDIVFSWRI 189

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
           Y T++ L +GL+ +HL+LPA K ++  ++PGV+ T + W+ GA++F +Y+ TF+ Y+  Y
Sbjct: 190 YGTLVVLTVGLLVMHLWLPAGKRRVFDVIPGVLLTLLLWLAGALIFAYYLATFANYTATY 249

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMI 273
           AGLAS+M  L+FLYM+G  FI+GAE+NA++I
Sbjct: 250 AGLASVMIVLIFLYMVGAIFIIGAEINAALI 280


>gi|15966391|ref|NP_386744.1| putative ribonuclease RNase BN (RBN) transmembrane protein
           [Sinorhizobium meliloti 1021]
 gi|307313022|ref|ZP_07592649.1| ribonuclease BN [Sinorhizobium meliloti BL225C]
 gi|307321028|ref|ZP_07600434.1| ribonuclease BN [Sinorhizobium meliloti AK83]
 gi|15075662|emb|CAC47217.1| Probable transporter [Sinorhizobium meliloti 1021]
 gi|306893303|gb|EFN24083.1| ribonuclease BN [Sinorhizobium meliloti AK83]
 gi|306899341|gb|EFN29975.1| ribonuclease BN [Sinorhizobium meliloti BL225C]
          Length = 291

 Score =  283 bits (725), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 143/275 (52%), Positives = 194/275 (70%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M  +  I++ +++DA+ HF E+DGWAMASH++LS+L++VFPF++FG  LA FLGA QF  
Sbjct: 1   MPAFVRIIWKVVFDALWHFSEDDGWAMASHVALSSLMAVFPFLIFGTALASFLGADQFAQ 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T + ++F  WPE IAKP+ DE+++VL +P   L TIS LAAAYF+SNGVEALRI+LNRAY
Sbjct: 61  TAVHLIFDTWPESIAKPVADEVVRVLTIPRGSLLTISVLAAAYFASNGVEALRIALNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R WY+TRL S G+VL A + L  +S + VA+PLA+    ++FP L  L+  + + 
Sbjct: 121 RVAESRYWYVTRLASLGFVLGAVLILAALSILLVAVPLAVRNADQWFPWLDALMAAVDDW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
            +  T+  L  GL+  HL+LPA    ++ +LPG+  T + W VGA  F  YI  FS Y T
Sbjct: 181 GLPLTLTMLTAGLLVAHLWLPAGHRNVVDVLPGIFLTLVLWSVGAYAFASYIANFSNYVT 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            YAGLASIM  LVFLYMLG  FI+GAE+NA+++ Y
Sbjct: 241 TYAGLASIMIVLVFLYMLGAIFIIGAEINAAILKY 275


>gi|222149946|ref|YP_002550903.1| ribonuclease transmembrane protein [Agrobacterium vitis S4]
 gi|221736928|gb|ACM37891.1| ribonuclease transmembrane protein [Agrobacterium vitis S4]
          Length = 298

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 138/275 (50%), Positives = 200/275 (72%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MR Y   ++ + +DA+ HF E+DGWAMASH++LS LL+VFPF++FG  LAG LGA+ F P
Sbjct: 1   MRSYLGRLYKVAFDAVWHFTEDDGWAMASHVALSILLAVFPFLIFGTALAGLLGANTFAP 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T I  +F  WPE IAKPI+++++QVL +P  GL TIS LAAAYF+SNGVEALR +LNRAY
Sbjct: 61  TAIHFIFDTWPEEIAKPISEQVVQVLTIPRGGLLTISVLAAAYFASNGVEALRTALNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R WYITRLIS G+V++      ++S + +A+P+AL +  + FP L + L ++ N 
Sbjct: 121 RVTETRPWYITRLISLGFVIMGVAAFAVISVLLIAVPIALRFAERQFPLLKDFLALVSNW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
            +  T++ L +GL   HL+LPA + +++ +LPG+  T + W++GA+ F  Y+ TF+ Y+ 
Sbjct: 181 SVLGTLILLAVGLTISHLWLPADRRRLIDVLPGICLTLLLWLLGALAFAAYLATFANYAA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            YAGLAS+M  ++FLYMLGV F++GAE NA+++ +
Sbjct: 241 TYAGLASVMVVIIFLYMLGVLFLIGAEFNAALMKF 275


>gi|150397725|ref|YP_001328192.1| putative ribonuclease BN [Sinorhizobium medicae WSM419]
 gi|150029240|gb|ABR61357.1| putative ribonuclease BN [Sinorhizobium medicae WSM419]
          Length = 290

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 194/269 (72%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
           I++ +++DA+ HF E+DGWAMASH++LS+L++VFPF++FG  LA FLGA QF  T + ++
Sbjct: 6   IIWKVVFDALWHFSEDDGWAMASHVALSSLMAVFPFLIFGTALASFLGADQFAETAVHLI 65

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
           F  WPE IAKP+ DE+++VL +P   L TIS LAAAYF+SNGVEALRI+LNRAYRV E R
Sbjct: 66  FDTWPESIAKPVADEVVRVLTIPRGSLLTISVLAAAYFASNGVEALRIALNRAYRVAESR 125

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           SWY+TRL S G+VL A + L  +S + VA+PLA+    ++FP L  ++  + +  +  T+
Sbjct: 126 SWYVTRLSSLGFVLGAVLILAALSLLLVAVPLAVRNADQWFPWLDTVMAAVDDWGLTLTL 185

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             L  GL+  HL+LP+    I+ +LPG+  T + W VG   F  YI  FS+Y+T YAGLA
Sbjct: 186 AMLTAGLLVAHLWLPSGHRNIVDVLPGIFLTLVLWSVGGYAFASYIANFSSYATTYAGLA 245

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIY 275
           SIM  LVFLYMLG  FI+GAE+NA+++ Y
Sbjct: 246 SIMVVLVFLYMLGAIFIIGAEINAAILKY 274


>gi|227823215|ref|YP_002827187.1| putative ribonuclease protein [Sinorhizobium fredii NGR234]
 gi|227342216|gb|ACP26434.1| putative ribonuclease protein [Sinorhizobium fredii NGR234]
          Length = 295

 Score =  275 bits (704), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 137/279 (49%), Positives = 195/279 (69%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M     I++ +++DA+ HF E+DGWAMASH++LS+L++VFPF++FG  L  FLGA QF  
Sbjct: 1   MPASLRIIWKVVFDALWHFSEDDGWAMASHVALSSLMAVFPFLIFGTALGSFLGADQFAV 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T + ++F AWPE IAKP+ DEI++VL +   G+ T+S +AAAYF+SNGVEALRI+LNRAY
Sbjct: 61  TAVHLIFDAWPESIAKPVADEIVEVLTIQRGGVLTLSVVAAAYFASNGVEALRIALNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R WYITRL S G+VL   + L ++S + VA+PLA+    ++ P L  +L  + N 
Sbjct: 121 RVAESRPWYITRLASLGFVLAGVLILAVISILLVAVPLAVRNADQWLPWLDAVLATVDNW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
            +   ++ L  GL+  HL+LP    KI+ +LPGV+ T + W +GA  F  Y+ TFS Y  
Sbjct: 181 GLALALVMLTGGLLVSHLWLPDGHRKIVDVLPGVLLTLLLWSIGAYAFASYLATFSNYVA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            YAGLASI+  LVFLYM+G  FI+GAE+NA+++ +  ++
Sbjct: 241 TYAGLASIVVVLVFLYMVGAIFIIGAEINAAILKFKVKR 279


>gi|163759906|ref|ZP_02166990.1| putative ribonuclease rnase bn (rbn) transmembrane protein [Hoeflea
           phototrophica DFL-43]
 gi|162282864|gb|EDQ33151.1| putative ribonuclease rnase bn (rbn) transmembrane protein [Hoeflea
           phototrophica DFL-43]
          Length = 317

 Score =  268 bits (686), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 133/271 (49%), Positives = 192/271 (70%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            +I+DA+ HF ++DGWAMASH++LS L+++FPF++FG  LA FLGA+ +  T   ++F  
Sbjct: 40  SVIWDAVTHFNDDDGWAMASHVALSILMALFPFMIFGTALASFLGANAYAETASHLIFDT 99

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           WPE IA PI++E+++VL V   GL T+S LAAA+FS+NGVEALR+SLNRAYRV E R+WY
Sbjct: 100 WPESIAAPISNEVVKVLTVERGGLLTLSVLAAAFFSANGVEALRVSLNRAYRVTETRAWY 159

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           +TR+ S  +V++A + ++ +SF+ V  PLAL   R+F P +  L+  + N RI      L
Sbjct: 160 VTRIQSLLFVVVAVLVIMAISFLLVLAPLALKLARQFVPWMETLISAVDNWRILIAAAVL 219

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            IGLI  HL+LP  + K+  +LPG+  T ++W+ GA++F  Y+  F+TY + YAGLASIM
Sbjct: 220 VIGLIVSHLWLPDGRRKLFDVLPGIGVTLVAWMAGALMFASYLKEFATYVSTYAGLASIM 279

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             LVFLY++   FILGAE+NA+++    R K
Sbjct: 280 IALVFLYIVAAIFILGAEINAALLKAAERAK 310


>gi|153008339|ref|YP_001369554.1| putative ribonuclease BN [Ochrobactrum anthropi ATCC 49188]
 gi|151560227|gb|ABS13725.1| putative ribonuclease BN [Ochrobactrum anthropi ATCC 49188]
          Length = 288

 Score =  248 bits (634), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 131/280 (46%), Positives = 185/280 (66%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MR+    +  I YD I HF  +DGWA ASHI+LS L+++FPF++F   LA FLG  +F  
Sbjct: 1   MRKIRRFLRQITYDVIGHFSSDDGWAFASHIALSGLMALFPFLIFATTLASFLGTKEFAD 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T + V+F  WP  IA PI +E++ VL V   GL T+S +AAAYF+SNGVEALRI+LNRAY
Sbjct: 61  TAVHVIFDMWPSNIAAPIANEVMNVLTVQRSGLLTLSVIAAAYFASNGVEALRIALNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV + RS    RL S G+VL+ +++L+ +SF+ V  PLA+    ++FP +      I   
Sbjct: 121 RVTDQRSIIFCRLQSLGFVLVGTLSLMAISFLLVLAPLAVRLAEQWFPDIAPFTGTIAFW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R    +  L + L  VH++LPA +  +  ILPG++ T I+W+  A+ F  Y+ TF+TY T
Sbjct: 181 RYTVAVGVLVLALFMVHIWLPAGRRSLGDILPGILITLIAWLAAAMAFAKYLETFATYVT 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            YAGLASIM  +VFLYML   FI+GAE+NA+++I+  R++
Sbjct: 241 TYAGLASIMVAIVFLYMLSAIFIIGAEINAAIMIFRKREQ 280


>gi|163844000|ref|YP_001628404.1| YihY family protein [Brucella suis ATCC 23445]
 gi|163674723|gb|ABY38834.1| YihY family protein [Brucella suis ATCC 23445]
          Length = 286

 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 126/271 (46%), Positives = 180/271 (66%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            I +D   HF  +DGWA ASHI+LS L+++FPF++F  +LA FLG  +F  T + V+FG 
Sbjct: 10  QITFDVWGHFSTDDGWAFASHIALSGLMALFPFLIFATSLASFLGTREFANTAVHVIFGM 69

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           WP  IA PI +E+  VL V  +GL T+S +AAAYF+SNGVEALRI+LNRAYRV + RS  
Sbjct: 70  WPSNIAAPIANEVKSVLTVQRRGLLTVSVIAAAYFASNGVEALRIALNRAYRVTDQRSII 129

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
             RL S G+VL+ +++L+ +SF+ V  PLA+    ++FP +      I   R    +  L
Sbjct: 130 FCRLQSLGFVLVGTLSLMAISFLLVLAPLAVRIAEQWFPDIAPFTGTIAFWRYTIAVAVL 189

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + L  VH++LPA +  +  ILPG++ T I+W+  A  F  Y+ TF+ Y + YAGLASIM
Sbjct: 190 VLALFMVHIWLPAGRRGLGDILPGIVITLIAWLAAATAFAKYLETFANYVSTYAGLASIM 249

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             +VFLYML   FI+GAE+NA+++I+  R++
Sbjct: 250 VAIVFLYMLSAIFIVGAEINAAIMIFRKREQ 280


>gi|239832980|ref|ZP_04681309.1| YihY family protein [Ochrobactrum intermedium LMG 3301]
 gi|239825247|gb|EEQ96815.1| YihY family protein [Ochrobactrum intermedium LMG 3301]
          Length = 306

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/280 (46%), Positives = 184/280 (65%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MR+    +  I +D I HF  +DGWA ASHI+LS L+++FPF++F   LA FLG  +F  
Sbjct: 21  MRKIRRFLRQITWDVIGHFSSDDGWAFASHIALSGLMALFPFLIFATTLASFLGTKEFAD 80

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T + V+F  WP  IA PI +E++ VL V   GL T+S +AAAYF+SNGVEALRI+LNRAY
Sbjct: 81  TAVHVIFDMWPSNIAAPIANEVMNVLTVQRSGLLTLSVIAAAYFASNGVEALRIALNRAY 140

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV + RS    RL S G+VL+ +++L+ +SF+ V  PLA+    ++FP +      I   
Sbjct: 141 RVTDQRSIIFCRLQSLGFVLVGTLSLMAISFLLVLAPLAVRIAEQWFPDIAPFTGTIAFW 200

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R    +  L + L  VH++LPA +  +  ILPG++ T I+W+  A+ F  Y+ TF+ Y T
Sbjct: 201 RYTVAVAVLVLALFMVHIWLPAGRRSLGDILPGILVTLIAWLAAAMAFAKYLETFANYVT 260

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            YAGLASIM  +VFLYML   FI+GAE+NA+++I+  R++
Sbjct: 261 TYAGLASIMVAIVFLYMLSAIFIIGAEINAAIMIFRKREQ 300


>gi|23502826|ref|NP_698953.1| ribonuclease BN [Brucella suis 1330]
 gi|148559336|ref|YP_001259795.1| YihY family protein [Brucella ovis ATCC 25840]
 gi|161619896|ref|YP_001593783.1| YihY family protein [Brucella canis ATCC 23365]
 gi|225628177|ref|ZP_03786212.1| YihY family protein [Brucella ceti str. Cudo]
 gi|254704986|ref|ZP_05166814.1| YihY family protein [Brucella suis bv. 3 str. 686]
 gi|254707499|ref|ZP_05169327.1| YihY family protein [Brucella pinnipedialis M163/99/10]
 gi|254708961|ref|ZP_05170772.1| YihY family protein [Brucella pinnipedialis B2/94]
 gi|254713610|ref|ZP_05175421.1| YihY family protein [Brucella ceti M644/93/1]
 gi|254716036|ref|ZP_05177847.1| YihY family protein [Brucella ceti M13/05/1]
 gi|254718029|ref|ZP_05179840.1| YihY family protein [Brucella sp. 83/13]
 gi|256030488|ref|ZP_05444102.1| YihY family protein [Brucella pinnipedialis M292/94/1]
 gi|256059950|ref|ZP_05450134.1| YihY family protein [Brucella neotomae 5K33]
 gi|256158474|ref|ZP_05456372.1| YihY family protein [Brucella ceti M490/95/1]
 gi|256253893|ref|ZP_05459429.1| YihY family protein [Brucella ceti B1/94]
 gi|256370380|ref|YP_003107891.1| ribonuclease BN, putative [Brucella microti CCM 4915]
 gi|260169395|ref|ZP_05756206.1| ribonuclease BN, putative [Brucella sp. F5/99]
 gi|260567540|ref|ZP_05838010.1| ribonuclease BN [Brucella suis bv. 4 str. 40]
 gi|261217804|ref|ZP_05932085.1| ribonuclease BN [Brucella ceti M13/05/1]
 gi|261221030|ref|ZP_05935311.1| ribonuclease BN [Brucella ceti B1/94]
 gi|261314982|ref|ZP_05954179.1| ribonuclease BN [Brucella pinnipedialis M163/99/10]
 gi|261316460|ref|ZP_05955657.1| ribonuclease BN [Brucella pinnipedialis B2/94]
 gi|261321348|ref|ZP_05960545.1| ribonuclease BN [Brucella ceti M644/93/1]
 gi|261323921|ref|ZP_05963118.1| ribonuclease BN [Brucella neotomae 5K33]
 gi|261755687|ref|ZP_05999396.1| ribonuclease BN [Brucella suis bv. 3 str. 686]
 gi|261758917|ref|ZP_06002626.1| ribonuclease BN [Brucella sp. F5/99]
 gi|265982976|ref|ZP_06095711.1| ribonuclease BN [Brucella sp. 83/13]
 gi|265987530|ref|ZP_06100087.1| ribonuclease BN [Brucella pinnipedialis M292/94/1]
 gi|265996990|ref|ZP_06109547.1| ribonuclease BN [Brucella ceti M490/95/1]
 gi|306837589|ref|ZP_07470460.1| YihY family protein [Brucella sp. NF 2653]
 gi|306842886|ref|ZP_07475523.1| YihY family protein [Brucella sp. BO2]
 gi|306843415|ref|ZP_07476016.1| YihY family protein [Brucella sp. BO1]
 gi|23348851|gb|AAN30868.1| ribonuclease BN, putative [Brucella suis 1330]
 gi|148370593|gb|ABQ60572.1| YihY family protein [Brucella ovis ATCC 25840]
 gi|161336707|gb|ABX63012.1| YihY family protein [Brucella canis ATCC 23365]
 gi|225617002|gb|EEH14049.1| YihY family protein [Brucella ceti str. Cudo]
 gi|256000543|gb|ACU48942.1| ribonuclease BN, putative [Brucella microti CCM 4915]
 gi|260157058|gb|EEW92138.1| ribonuclease BN [Brucella suis bv. 4 str. 40]
 gi|260919614|gb|EEX86267.1| ribonuclease BN [Brucella ceti B1/94]
 gi|260922893|gb|EEX89461.1| ribonuclease BN [Brucella ceti M13/05/1]
 gi|261294038|gb|EEX97534.1| ribonuclease BN [Brucella ceti M644/93/1]
 gi|261295683|gb|EEX99179.1| ribonuclease BN [Brucella pinnipedialis B2/94]
 gi|261299901|gb|EEY03398.1| ribonuclease BN [Brucella neotomae 5K33]
 gi|261304008|gb|EEY07505.1| ribonuclease BN [Brucella pinnipedialis M163/99/10]
 gi|261738901|gb|EEY26897.1| ribonuclease BN [Brucella sp. F5/99]
 gi|261745440|gb|EEY33366.1| ribonuclease BN [Brucella suis bv. 3 str. 686]
 gi|262551458|gb|EEZ07448.1| ribonuclease BN [Brucella ceti M490/95/1]
 gi|264659727|gb|EEZ29988.1| ribonuclease BN [Brucella pinnipedialis M292/94/1]
 gi|264661568|gb|EEZ31829.1| ribonuclease BN [Brucella sp. 83/13]
 gi|306276106|gb|EFM57806.1| YihY family protein [Brucella sp. BO1]
 gi|306286973|gb|EFM58490.1| YihY family protein [Brucella sp. BO2]
 gi|306407296|gb|EFM63504.1| YihY family protein [Brucella sp. NF 2653]
          Length = 286

 Score =  238 bits (607), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 125/271 (46%), Positives = 179/271 (66%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            I +D   HF  +DGWA ASHI+LS L+++FPF++F  +LA FLG  +F  T + V+F  
Sbjct: 10  QITFDVWGHFSTDDGWAFASHIALSGLMALFPFLIFATSLASFLGTREFANTAVHVIFDM 69

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           WP  IA PI +E+  VL V  +GL T+S +AAAYF+SNGVEALRI+LNRAYRV + RS  
Sbjct: 70  WPSNIAAPIANEVKSVLTVQRRGLLTVSVIAAAYFASNGVEALRIALNRAYRVTDQRSII 129

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
             RL S G+VL+ +++L+ +SF+ V  PLA+    ++FP +      I   R    +  L
Sbjct: 130 FCRLQSLGFVLVGTLSLMAISFLLVLAPLAVRIAEQWFPDIAPFTGTIAFWRYTIAVAVL 189

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + L  VH++LPA +  +  ILPG++ T I+W+  A  F  Y+ TF+ Y + YAGLASIM
Sbjct: 190 VLALFMVHIWLPAGRRGLGDILPGIVITLIAWLAAATAFAKYLETFANYVSTYAGLASIM 249

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             +VFLYML   FI+GAE+NA+++I+  R++
Sbjct: 250 VAIVFLYMLSAIFIVGAEINAAIMIFRKREQ 280


>gi|294851216|ref|ZP_06791889.1| yihY [Brucella sp. NVSL 07-0026]
 gi|294819805|gb|EFG36804.1| yihY [Brucella sp. NVSL 07-0026]
          Length = 286

 Score =  238 bits (606), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 125/271 (46%), Positives = 179/271 (66%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            I +D   HF  +DGWA ASHI+LS L+++FPF++F  +LA FLG  +F  T + V+F  
Sbjct: 10  QITFDVWGHFSTDDGWAFASHIALSGLMALFPFLIFATSLASFLGTREFANTAVHVIFDM 69

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           WP  IA PI +E+  VL V  +GL T+S +AAAYF+SNGVEALRI+LNRAYRV + RS  
Sbjct: 70  WPSNIAAPIANEVKSVLTVQRRGLLTVSVIAAAYFASNGVEALRIALNRAYRVTDQRSII 129

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
             RL S G+VL+ +++L+ +SF+ V  PLA+    ++FP +      I   R    +  L
Sbjct: 130 FCRLQSLGFVLVGTLSLMAISFLLVLAPLAVRIAEQWFPDIAPFTGTIAFWRYTIVVAVL 189

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + L  VH++LPA +  +  ILPG++ T I+W+  A  F  Y+ TF+ Y + YAGLASIM
Sbjct: 190 VLALFMVHIWLPAGRRGLGDILPGIVITLIAWLAAATAFAKYLETFANYVSTYAGLASIM 249

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             +VFLYML   FI+GAE+NA+++I+  R++
Sbjct: 250 VAIVFLYMLSAIFIVGAEINAAIMIFRKREQ 280


>gi|254700616|ref|ZP_05162444.1| YihY family protein [Brucella suis bv. 5 str. 513]
 gi|261751125|ref|ZP_05994834.1| ribonuclease BN [Brucella suis bv. 5 str. 513]
 gi|261740878|gb|EEY28804.1| ribonuclease BN [Brucella suis bv. 5 str. 513]
          Length = 286

 Score =  238 bits (606), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 125/271 (46%), Positives = 179/271 (66%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            I +D   HF  +DGWA ASHI+LS L+++FPF++F  +LA FLG  +F  T + V+F  
Sbjct: 10  QITFDVWGHFSTDDGWAFASHIALSGLMALFPFLIFATSLASFLGTREFANTAVHVIFDM 69

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           WP  IA PI +E+  VL V  +GL T+S +AAAYF+SNGVEALRI+LNRAYRV + RS  
Sbjct: 70  WPSNIAAPIANEVKSVLTVQHRGLLTVSVIAAAYFASNGVEALRIALNRAYRVTDQRSII 129

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
             RL S G+VL+ +++L+ +SF+ V  PLA+    ++FP +      I   R    +  L
Sbjct: 130 FCRLQSLGFVLVGTLSLMAISFLLVLAPLAVRIAEQWFPDIAPFTGTIAFWRYTIAVAVL 189

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + L  VH++LPA +  +  ILPG++ T I+W+  A  F  Y+ TF+ Y + YAGLASIM
Sbjct: 190 VLALFMVHIWLPAGRRGLGDILPGIVITLIAWLAAATAFAKYLETFANYVSTYAGLASIM 249

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             +VFLYML   FI+GAE+NA+++I+  R++
Sbjct: 250 VAIVFLYMLSAIFIVGAEINAAIMIFRKREQ 280


>gi|17986373|ref|NP_539007.1| ribonuclease BN [Brucella melitensis bv. 1 str. 16M]
 gi|62290826|ref|YP_222619.1| ribonuclease BN [Brucella abortus bv. 1 str. 9-941]
 gi|82700738|ref|YP_415312.1| ribonuclease BN [Brucella melitensis biovar Abortus 2308]
 gi|189025045|ref|YP_001935813.1| Ribonuclease BN [Brucella abortus S19]
 gi|237816340|ref|ZP_04595333.1| YihY family protein [Brucella abortus str. 2308 A]
 gi|254690116|ref|ZP_05153370.1| Ribonuclease BN [Brucella abortus bv. 6 str. 870]
 gi|254694606|ref|ZP_05156434.1| Ribonuclease BN [Brucella abortus bv. 3 str. Tulya]
 gi|254696231|ref|ZP_05158059.1| Ribonuclease BN [Brucella abortus bv. 2 str. 86/8/59]
 gi|254731149|ref|ZP_05189727.1| Ribonuclease BN [Brucella abortus bv. 4 str. 292]
 gi|256045579|ref|ZP_05448459.1| Ribonuclease BN [Brucella melitensis bv. 1 str. Rev.1]
 gi|256258370|ref|ZP_05463906.1| Ribonuclease BN [Brucella abortus bv. 9 str. C68]
 gi|260546093|ref|ZP_05821833.1| ribonuclease BN [Brucella abortus NCTC 8038]
 gi|260562890|ref|ZP_05833376.1| ribonuclease BN [Brucella melitensis bv. 1 str. 16M]
 gi|260755655|ref|ZP_05868003.1| ribonuclease BN [Brucella abortus bv. 6 str. 870]
 gi|260758880|ref|ZP_05871228.1| ribonuclease BN [Brucella abortus bv. 4 str. 292]
 gi|260760604|ref|ZP_05872947.1| ribonuclease BN [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884680|ref|ZP_05896294.1| ribonuclease BN [Brucella abortus bv. 9 str. C68]
 gi|261214930|ref|ZP_05929211.1| ribonuclease BN [Brucella abortus bv. 3 str. Tulya]
 gi|265992003|ref|ZP_06104560.1| ribonuclease BN [Brucella melitensis bv. 1 str. Rev.1]
 gi|297247212|ref|ZP_06930930.1| ribonuclease BN [Brucella abortus bv. 5 str. B3196]
 gi|17981963|gb|AAL51271.1| ribonuclease bn [Brucella melitensis bv. 1 str. 16M]
 gi|62196958|gb|AAX75258.1| ribonuclease BN, hypothetical [Brucella abortus bv. 1 str. 9-941]
 gi|82616839|emb|CAJ11935.1| Ribonuclease BN [Brucella melitensis biovar Abortus 2308]
 gi|189020617|gb|ACD73339.1| Ribonuclease BN [Brucella abortus S19]
 gi|237788407|gb|EEP62622.1| YihY family protein [Brucella abortus str. 2308 A]
 gi|260096200|gb|EEW80076.1| ribonuclease BN [Brucella abortus NCTC 8038]
 gi|260152906|gb|EEW87998.1| ribonuclease BN [Brucella melitensis bv. 1 str. 16M]
 gi|260669198|gb|EEX56138.1| ribonuclease BN [Brucella abortus bv. 4 str. 292]
 gi|260671036|gb|EEX57857.1| ribonuclease BN [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675763|gb|EEX62584.1| ribonuclease BN [Brucella abortus bv. 6 str. 870]
 gi|260874208|gb|EEX81277.1| ribonuclease BN [Brucella abortus bv. 9 str. C68]
 gi|260916537|gb|EEX83398.1| ribonuclease BN [Brucella abortus bv. 3 str. Tulya]
 gi|263003069|gb|EEZ15362.1| ribonuclease BN [Brucella melitensis bv. 1 str. Rev.1]
 gi|297174381|gb|EFH33728.1| ribonuclease BN [Brucella abortus bv. 5 str. B3196]
          Length = 286

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 125/271 (46%), Positives = 178/271 (65%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            I +D   HF  +DGWA ASHI+LS L+++FPF++F  +LA FLG  +F  T + V+F  
Sbjct: 10  QITFDVWGHFSTDDGWAFASHIALSGLMALFPFLIFATSLASFLGTREFANTAVHVIFDM 69

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           WP  IA PI +E+  VL V   GL T+S +AAAYF+SNGVEALRI+LNRAYRV + RS  
Sbjct: 70  WPSNIAAPIANEVKSVLTVQRHGLLTVSVIAAAYFASNGVEALRIALNRAYRVTDQRSII 129

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
             RL S G+VL+ +++L+ +SF+ V  PLA+    ++FP +      I   R    +  L
Sbjct: 130 FCRLQSLGFVLVGTLSLMAISFLLVLAPLAVRIAEQWFPDIAPFTGTIAFWRYTIAVAVL 189

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + L  VH++LPA +  +  ILPG++ T I+W+  A  F  Y+ TF+ Y + YAGLASIM
Sbjct: 190 VLALFMVHIWLPAGRRGLGDILPGIVITLIAWLAAATAFAKYLETFANYVSTYAGLASIM 249

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             +VFLYML   FI+GAE+NA+++I+  R++
Sbjct: 250 VAIVFLYMLSAIFIVGAEINAAIMIFRKREQ 280


>gi|256112306|ref|ZP_05453227.1| Ribonuclease BN [Brucella melitensis bv. 3 str. Ether]
 gi|265993739|ref|ZP_06106296.1| ribonuclease BN [Brucella melitensis bv. 3 str. Ether]
 gi|262764720|gb|EEZ10641.1| ribonuclease BN [Brucella melitensis bv. 3 str. Ether]
          Length = 286

 Score =  236 bits (601), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 125/271 (46%), Positives = 178/271 (65%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            I +D   HF  +DGWA ASHI+LS L+++FPF++F  +LA FLG  +F  T + V+F  
Sbjct: 10  QITFDVWGHFSTDDGWAFASHIALSGLMALFPFLIFATSLASFLGTREFANTAVHVIFDM 69

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           WP  IA PI +E+  VL V   GL T+S +AAAYF+SNGVEALRI+LNRAYRV + RS  
Sbjct: 70  WPSNIAAPIANEVKSVLTVQRHGLLTVSVIAAAYFASNGVEALRIALNRAYRVTDQRSII 129

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
             RL S G+VL+ +++L+ +SF+ V  PLA+    ++FP +      I   R    +  L
Sbjct: 130 FCRLQSLGFVLVGTLSLMAISFLLVLAPLAVRIAEQWFPDIAPFTGTIAFWRYTIAVAVL 189

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + L  VH++LPA +  +  ILPG++ T I+W+  A  F  Y+ TF+ Y + YAGLASIM
Sbjct: 190 VLELFMVHIWLPAGRRGLGDILPGIVITLIAWLAAATAFAKYLETFANYVSTYAGLASIM 249

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             +VFLYML   FI+GAE+NA+++I+  R++
Sbjct: 250 VAIVFLYMLSAIFIVGAEINAAIMIFRKREQ 280


>gi|225853414|ref|YP_002733647.1| YihY family protein [Brucella melitensis ATCC 23457]
 gi|256263106|ref|ZP_05465638.1| ribonuclease BN [Brucella melitensis bv. 2 str. 63/9]
 gi|225641779|gb|ACO01693.1| YihY family protein [Brucella melitensis ATCC 23457]
 gi|263093007|gb|EEZ17157.1| ribonuclease BN [Brucella melitensis bv. 2 str. 63/9]
 gi|326409977|gb|ADZ67042.1| YihY family protein [Brucella melitensis M28]
 gi|326539694|gb|ADZ87909.1| YihY family protein [Brucella melitensis M5-90]
          Length = 286

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 125/271 (46%), Positives = 178/271 (65%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            I +D   HF  +DGWA ASHI+LS L+++FPF++F  +LA FLG  +F  T + V+F  
Sbjct: 10  QITFDVWGHFSTDDGWAFASHIALSGLMALFPFLIFATSLASFLGTREFANTAVHVIFDM 69

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           WP  IA PI +E+  VL V   GL T+S +AAAYF+SNGVEALRI+LNRAYRV + RS  
Sbjct: 70  WPSNIAVPIANEVKSVLTVQRHGLLTVSVIAAAYFASNGVEALRIALNRAYRVTDQRSII 129

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
             RL S G+VL+ +++L+ +SF+ V  PLA+    ++FP +      I   R    +  L
Sbjct: 130 FCRLQSLGFVLVGTLSLMAISFLLVLAPLAVRIAEQWFPDIAPFTGTIAFWRYTIAVAVL 189

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + L  VH++LPA +  +  ILPG++ T I+W+  A  F  Y+ TF+ Y + YAGLASIM
Sbjct: 190 VLALFMVHIWLPAGRRGLGDILPGIVITLIAWLAAATAFAKYLETFANYVSTYAGLASIM 249

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             +VFLYML   FI+GAE+NA+++I+  R++
Sbjct: 250 VAIVFLYMLSAIFIVGAEINAAIMIFRKREQ 280


>gi|307942625|ref|ZP_07657973.1| YihY family protein [Roseibium sp. TrichSKD4]
 gi|307774264|gb|EFO33477.1| YihY family protein [Roseibium sp. TrichSKD4]
          Length = 284

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 124/263 (47%), Positives = 166/263 (63%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           ++ DA+ HFV +DG+AMASH++LSALL+VFP ++F A LAGF+G H       ++VF AW
Sbjct: 13  VLKDALGHFVNDDGYAMASHVALSALLAVFPLLIFIAALAGFMGFHDAADRASNLVFDAW 72

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           PE +AKP+ DEI +VL VP   L T   + A +F+SNGVEA+R +LNRAYR  E RS   
Sbjct: 73  PENVAKPLVDEIHRVLTVPRGDLLTFGVVGALWFASNGVEAMRSALNRAYRQQEKRSIVF 132

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            RL S G V+L +V L+  +F+ V  PL +  V  + PA    L+ I   R       L 
Sbjct: 133 LRLQSLGLVILGAVVLIAYTFLVVLAPLVIKTVVNWIPAAEEFLVTIDVARYSVAGSLLT 192

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           IGL+  H  LP+   K   +LPGV+ T + W+V   +F  Y+  F+TY T Y GLA IM+
Sbjct: 193 IGLLLTHWILPSGSRKFRELLPGVVATLVMWMVAGAVFGAYLAKFATYVTTYGGLAGIMS 252

Query: 251 CLVFLYMLGVFFILGAELNASMI 273
            +VFLY+  + FILG ELNASMI
Sbjct: 253 AVVFLYICSLGFILGGELNASMI 275


>gi|319781313|ref|YP_004140789.1| ribonuclease BN [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167201|gb|ADV10739.1| ribonuclease BN [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 283

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 124/270 (45%), Positives = 176/270 (65%), Gaps = 10/270 (3%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           ++YDA+ HF  +DGWAMASH+++++L+++FPF++F   LA FLGA  F  T + +VF  W
Sbjct: 11  VLYDALGHFNTDDGWAMASHLAITSLMALFPFLIFATTLASFLGAQAFSDTAVHLVFDTW 70

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           PE IAKPI  E+L VL V    L T   + AAYF+SNG+EALR SLNRAYRV E R    
Sbjct: 71  PEQIAKPIAREVLNVLTVRRTDLLTYGVVLAAYFASNGIEALRTSLNRAYRVSETRGIIY 130

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIP----LALAYVRKFFPALGNLLLIIWNGRIYATM 186
            R+ S  +VL+A+   + +S + V  P    LA A++    P +G + L  W    Y   
Sbjct: 131 RRVQSIIFVLIATAGFLAISVLLVFAPLLARLAEAHIDWIKPYMGTITL--WR---YVIA 185

Query: 187 LALFIGLIF-VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
            A+ +G +F VH +LPA K + +S++PG++FT  +W++G+ +F  Y+  FS+Y T YAGL
Sbjct: 186 SAVIVGGLFAVHFWLPAGKRRFVSLVPGIVFTLAAWLIGSTIFATYLDHFSSYVTTYAGL 245

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           ASIM  +VFLYM+   FILG ELNA++  Y
Sbjct: 246 ASIMIAVVFLYMVSAIFILGGELNAAISRY 275


>gi|260466711|ref|ZP_05812898.1| ribonuclease BN [Mesorhizobium opportunistum WSM2075]
 gi|259029574|gb|EEW30863.1| ribonuclease BN [Mesorhizobium opportunistum WSM2075]
          Length = 283

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 173/270 (64%), Gaps = 10/270 (3%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           ++YDAI HF  +DGWAMASH+++++L+++FPF++F   L  FLGA  F  T + +VF  W
Sbjct: 11  VLYDAIGHFNTDDGWAMASHLAITSLMALFPFLIFATTLGSFLGAQAFADTAVHLVFDTW 70

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+ IAKPI  E+L VL V    L T   L AAYF+SNG+EALR SLNRAYRV E R    
Sbjct: 71  PDQIAKPIAHEVLNVLTVRRTDLLTYGVLLAAYFASNGIEALRTSLNRAYRVTETRGIIY 130

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIP----LALAYVRKFFPALGNLLLIIWNGRIYATM 186
            R+ S  +VL+A+   + +S + V  P    LA A+     P  G + L  W    Y   
Sbjct: 131 RRVQSIFFVLIATAGFLAISVLLVFAPLLARLAEAHFEWIKPYTGTITL--WR---YVIA 185

Query: 187 LALFIGLIF-VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
            A+ IG +F VH +LPA K + +S++PG+IFT  +W++G+ +F  Y+  FS+Y T YAGL
Sbjct: 186 SAVIIGGLFAVHYWLPAGKRRFVSLVPGIIFTLAAWLIGSTIFATYLDHFSSYVTTYAGL 245

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           ASIM  +VFLY++   FILG ELNA++  Y
Sbjct: 246 ASIMIAVVFLYIVSAIFILGGELNAAISRY 275


>gi|13473007|ref|NP_104574.1| hypothetical protein mll3481 [Mesorhizobium loti MAFF303099]
 gi|14023755|dbj|BAB50360.1| mll3481 [Mesorhizobium loti MAFF303099]
          Length = 310

 Score =  226 bits (575), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 123/270 (45%), Positives = 173/270 (64%), Gaps = 10/270 (3%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           ++YDA+ HF  +DGWAMASH+++++L+++FPF++F   L  FLGA  F  T + +VF  W
Sbjct: 38  VLYDALGHFNTDDGWAMASHLAITSLMALFPFLIFATTLGSFLGAQAFADTAVHLVFDTW 97

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+ IAKPI  E+L VL V    L T   L AAYF+SNG+EALR SLNRAYRV E R    
Sbjct: 98  PDQIAKPIAHEVLNVLTVRRTDLLTYGVLLAAYFASNGIEALRTSLNRAYRVTETRGIIY 157

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIP----LALAYVRKFFPALGNLLLIIWNGRIYATM 186
            R+ S  +VL+A+   + +S + V  P    LA A+     P  G + L  W    Y   
Sbjct: 158 RRVQSIFFVLIATAGFLAISVLLVFAPLLARLAEAHFEWIKPYTGTITL--WR---YVIA 212

Query: 187 LALFIGLIF-VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
            A+ IG +F VH +LPA K + +S++PG++FT  +W++G+ +F  Y+  FS+Y T YAGL
Sbjct: 213 SAVIIGGLFAVHYWLPAGKRRFVSLVPGIVFTLAAWLIGSTMFATYLDHFSSYVTTYAGL 272

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           ASIM  +VFLY++   FILG ELNA++  Y
Sbjct: 273 ASIMIAVVFLYIVSAIFILGGELNAAISRY 302


>gi|110635357|ref|YP_675565.1| putative ribonuclease BN [Mesorhizobium sp. BNC1]
 gi|110286341|gb|ABG64400.1| putative ribonuclease BN [Chelativorans sp. BNC1]
          Length = 283

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 119/274 (43%), Positives = 178/274 (64%), Gaps = 8/274 (2%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           I+ DA  HF  +DGWAMASH+++SA++++FPF++F A LA FLGA  F  T + +VF  W
Sbjct: 10  IVRDAFGHFNADDGWAMASHLAVSAIMALFPFLIFAAALASFLGADAFADTAVHIVFDTW 69

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+ +A+P+  E+  VL V    + T   + AA+F+SNGVEALR+SLNRAYRV E RS   
Sbjct: 70  PKEVAEPLAREVRNVLGVRRGDVLTFGVVLAAFFASNGVEALRLSLNRAYRVEERRSMIF 129

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIP----LALAYVRKFFPALGNLLLIIWNGRIYATM 186
            RL S G+VL+A++    +S + V  P    +A++ +    P +G + L  W  R    +
Sbjct: 130 LRLQSLGFVLIATLGFTAISVLLVIAPVAANIAVSRIEWIEPYMGTITL--W--RYIVAV 185

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           + L   L+ VH++LPA   K+  I+PG+IFT + W+ G+ +F  Y+  FS+Y+T YAGLA
Sbjct: 186 VVLVFALVVVHIWLPAGSRKLTDIIPGIIFTLLGWIAGSSIFAAYLGRFSSYTTTYAGLA 245

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           SIM  +VFLY++   FILG E+NA+++ Y   ++
Sbjct: 246 SIMVAVVFLYIISAIFILGGEINAAIMRYREARR 279


>gi|146343275|ref|YP_001208323.1| ribonuclease BN-like family transmembrane protein [Bradyrhizobium
           sp. ORS278]
 gi|146196081|emb|CAL80108.1| putative ribonuclease BN-like family transmembrane protein
           [Bradyrhizobium sp. ORS278]
          Length = 301

 Score =  222 bits (565), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 118/268 (44%), Positives = 169/268 (63%), Gaps = 2/268 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +F ++ DA   F+ +DGWA+ASHI+LS L+++FPF++   +LAGFLG+         ++ 
Sbjct: 11  IFHVVMDAFYTFLADDGWAIASHIALSTLMALFPFLIVLTSLAGFLGSKDLADQAATLIL 70

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
             WP  +A  +T EI  VL        TI A+ A YF+SNGVEALR++LNRAY V+E R 
Sbjct: 71  ETWPAQVADALTGEIHDVLTTTRTDALTIGAVLAVYFASNGVEALRVALNRAYGVIEQRR 130

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFP-ALGNLLLIIWNGRIYATM 186
           WY  RL S GY L+A+VT + MSF+ V  PL LA  R+F P A+      +   R   T+
Sbjct: 131 WYWLRLESIGYTLVAAVTALAMSFLIVLGPLMLATARRFLPLAVDANERFVNLSRYGITI 190

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF-STYSTMYAGL 245
            AL + L  +H +LPA +   M I+PG++FT+++ +V  ++F  Y+  F + Y TMYAGL
Sbjct: 191 SALIVALFILHAWLPAGRRSFMQIMPGIVFTFVASLVSGIVFGQYLARFANNYVTMYAGL 250

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMI 273
           AS++  LVFLY +   F+ G ELNAS+I
Sbjct: 251 ASVIIALVFLYFIAAIFVYGGELNASII 278


>gi|254502756|ref|ZP_05114907.1| YihY family protein [Labrenzia alexandrii DFL-11]
 gi|222438827|gb|EEE45506.1| YihY family protein [Labrenzia alexandrii DFL-11]
          Length = 294

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 162/262 (61%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           ++ DAI HF  +DG+AMASH++LS LL++FP ++F A+LAGF G      TV ++VF AW
Sbjct: 16  VLKDAIGHFSRDDGFAMASHVALSGLLAIFPLLIFIASLAGFFGMVGAADTVSELVFDAW 75

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+ +A P+  EI  VL VP   L T  A+AA +F+SNGVEALR +LNRAYR +E RS+ +
Sbjct: 76  PKTVAAPVVREIENVLTVPRSDLLTFGAVAALWFASNGVEALRTALNRAYRQIEKRSFIL 135

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            R+ S   V+L +V L+  +F+ V  PL +  +R F P +   LL I   R       L 
Sbjct: 136 LRIQSLALVILGAVILLAYTFLVVLAPLGIEALRGFVPQVEPFLLSINIARYTLAGSLLI 195

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           +GL   H  LP+ K     I PGVI T + W+V    F  Y+  F+ Y + Y GLA IMT
Sbjct: 196 VGLFMTHWLLPSGKRSFSDIWPGVIATLLLWIVSGSAFGAYLARFANYVSTYGGLAGIMT 255

Query: 251 CLVFLYMLGVFFILGAELNASM 272
            L+FLY+  + FILG ELNA++
Sbjct: 256 ALIFLYICSLAFILGGELNAAI 277


>gi|148252707|ref|YP_001237292.1| ribonuclease BN-like family transmembrane protein [Bradyrhizobium
           sp. BTAi1]
 gi|146404880|gb|ABQ33386.1| putative ribonuclease BN-like family transmembrane protein
           [Bradyrhizobium sp. BTAi1]
          Length = 301

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 117/268 (43%), Positives = 169/268 (63%), Gaps = 2/268 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +F ++ DA   F+ +DGWA+ASHI+LS L+++FPF++   +LAGFLG+ +       ++ 
Sbjct: 11  IFHVVMDAFYTFLADDGWAIASHIALSTLMALFPFLIVLTSLAGFLGSKELADQAATLML 70

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
             WP  +A  +T EI  VL        TI A+ A YF+SNGVEALR++LNRAY V+E R 
Sbjct: 71  ETWPAQVADALTGEIHDVLTTTRTDALTIGAVLAVYFASNGVEALRVALNRAYGVIEQRR 130

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFP-ALGNLLLIIWNGRIYATM 186
           WY  RL S GY L+A+ T + MSF+ V  PL LA  R++ P A+      +   R   T+
Sbjct: 131 WYWLRLESIGYTLVAAFTALAMSFLIVLGPLVLATARRYLPLAVEANERFVNLSRYGITI 190

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF-STYSTMYAGL 245
            AL + L  +H +LPA +   M I+PG++FT+I+ +V  ++F  Y+  F + Y TMYAGL
Sbjct: 191 SALIVALFILHAWLPAGRRSFMQIMPGIVFTFIASLVSGIVFGQYLARFANNYVTMYAGL 250

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMI 273
           AS++  LVFLY +   F+ G ELNAS+I
Sbjct: 251 ASVIIALVFLYFIAAIFVYGGELNASII 278


>gi|319409429|emb|CBI83078.1| ribonuclease RNAse bn transmembrane protein [Bartonella
           schoenbuchensis R1]
          Length = 284

 Score =  218 bits (556), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 116/278 (41%), Positives = 173/278 (62%), Gaps = 1/278 (0%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           ++   C    I+ +A+ H+V ++G A ASHI LS LL+ FPF +FGA+LA F     + P
Sbjct: 2   IKNVLCYGCRILINAVSHYVRDNGSAFASHIVLSGLLAFFPFCIFGASLASFFWDFAYTP 61

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
             I+ +    P+ IA+P + EI+ VL    +GL T+S + AAYF+SNGVEALR +LN+AY
Sbjct: 62  QKIEALMHLLPDAIAEPFSKEIVNVLVTQRRGLLTLSFVGAAYFASNGVEALRAALNKAY 121

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RVV+ RS +  R  S  +V++ ++ + ++SF+ V  PL +   +  FP +   + +I   
Sbjct: 122 RVVDQRSLFFCRFQSLFFVIIGTIGISVISFLLVLAPLLIKITQNHFPFIVEYIGVIRLW 181

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R    ++ LFI L+ VH +LPA + K+  ILPG+I T   W   ++ F HY+  F+  ST
Sbjct: 182 RYTIAVVVLFISLLIVHKWLPAKRRKLRDILPGIIVTLFLWFSASITFAHYLTMFNYVST 241

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            YAGLASIM  ++FLYML   FILG E+NA+++ Y  R
Sbjct: 242 -YAGLASIMIAIIFLYMLSAIFILGGEINAAIMFYRTR 278


>gi|118593797|ref|ZP_01551163.1| Ribonuclease BN [Stappia aggregata IAM 12614]
 gi|118433592|gb|EAV40257.1| Ribonuclease BN [Stappia aggregata IAM 12614]
          Length = 296

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 120/282 (42%), Positives = 165/282 (58%), Gaps = 2/282 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R+   +++ ++ DAI HF  +DG+AMASH++LS LL++FP ++F A+LA FLG      T
Sbjct: 4   RQTVLVIYAVLKDAIGHFARDDGFAMASHVALSGLLAIFPLLIFIASLAAFLGMTGAADT 63

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           V +++F AWP  +A P+  EI  VL +    L T  A+AA +FSSNGVEALR +LNRAYR
Sbjct: 64  VSELLFDAWPRSVASPVVREIQNVLTIRRGDLVTFGAVAALWFSSNGVEALRTALNRAYR 123

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             E RS  + RL S G VLL +  L+  +F+ V  PLA+  ++ F P +   LL I   R
Sbjct: 124 QHETRSIVLLRLQSIGLVLLGASILLAYTFLVVLAPLAIEGLKVFVPQVETFLLSINVAR 183

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                  L IGL   H  LPA       + PGV  T   W++    F  Y+ +F+ Y + 
Sbjct: 184 YTLAGSLLIIGLFITHWLLPAGHRTFRDLWPGVFATLFMWIIAGSAFGAYLASFANYVST 243

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNA--SMIIYYWRKKP 281
           Y GLA IMT L+FLY+  + FILG ELNA  S    YW ++ 
Sbjct: 244 YGGLAGIMTALIFLYICALVFILGGELNAAISRQRRYWHRRK 285


>gi|217976474|ref|YP_002360621.1| ribonuclease BN [Methylocella silvestris BL2]
 gi|217501850|gb|ACK49259.1| ribonuclease BN [Methylocella silvestris BL2]
          Length = 288

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 118/263 (44%), Positives = 163/263 (61%), Gaps = 1/263 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +F ++YDA  +FV++DGWA++SHI+LS L S+FPF++F   LAGFLG+       + ++F
Sbjct: 4   MFHVLYDAAMNFVQDDGWAISSHIALSILTSMFPFLIFVTALAGFLGSADLSQEAVQILF 63

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
             WPE +AKP+  E+  VL     GL T+  + + YFSS+GVEALRI+LNRAY V E R 
Sbjct: 64  QTWPEQVAKPLASEVHNVLTQTRGGLVTLGGVLSIYFSSSGVEALRIALNRAYGVAETRP 123

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           WY+ RL S GYV++ +V L+ ++   V  PL       F P L  L  ++   R     L
Sbjct: 124 WYVLRLESIGYVMIGAVALLTLTLSVVFAPLIWTIALHFAPHLEPLDRLVTFSRFGIATL 183

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFS-TYSTMYAGLA 246
            L + L+ VH FLPA +  +  I PG++FT+  WV G  +F  Y+  F+  Y T YAGLA
Sbjct: 184 VLLLALVIVHKFLPAGRRTLWQIFPGIVFTFALWVAGGAIFGSYLAEFARNYVTTYAGLA 243

Query: 247 SIMTCLVFLYMLGVFFILGAELN 269
           S+M  LVFLYM+   FI G ELN
Sbjct: 244 SVMIALVFLYMISSIFIAGGELN 266


>gi|49474789|ref|YP_032831.1| ribonuclease RNAse BN transmembrane protein [Bartonella quintana
           str. Toulouse]
 gi|49240293|emb|CAF26771.1| Ribonuclease RNAse bn transmembrane protein [Bartonella quintana
           str. Toulouse]
          Length = 284

 Score =  211 bits (538), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 110/275 (40%), Positives = 173/275 (62%), Gaps = 1/275 (0%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +R+ F   + ++ DA+ H+  ++G A ASH++LS LL+ FPF +FG +LA F  A  + P
Sbjct: 2   LRDIFWYSYRVLVDAVSHYWRDNGSAFASHVALSGLLAFFPFFIFGTSLASFSSAFTYTP 61

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
             I  +    P+VIA+P++ EI+ VL +   G+ T+S + AAYF+SNG+EALR +LN+AY
Sbjct: 62  QKIKALVQLLPDVIAEPLSKEIINVLTIQRGGVLTVSVIGAAYFASNGIEALRTALNKAY 121

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RVV+ RS    R  S  +V++ ++ LV++SF+ +  PL +  ++     +   + +I   
Sbjct: 122 RVVDRRSLLFCRFQSLFFVIVGAIGLVVISFLLILAPLLIKIMQNHSFFITEYIGVIRLW 181

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R     + LF+ L+ VH +LPA + K + ILPG++ T   W + ++ F HY+  F+  ST
Sbjct: 182 RYIIAAVVLFVSLLIVHKWLPAGRRKFIDILPGIVVTMFVWFMASIAFAHYLTMFNYIST 241

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            YAGL SIM  ++FLYML   FILG E+NA++I Y
Sbjct: 242 -YAGLTSIMVAIIFLYMLSAIFILGGEINAAIIFY 275


>gi|27376485|ref|NP_768014.1| hypothetical protein bll1374 [Bradyrhizobium japonicum USDA 110]
 gi|27349625|dbj|BAC46639.1| bll1374 [Bradyrhizobium japonicum USDA 110]
          Length = 297

 Score =  211 bits (537), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 111/269 (41%), Positives = 170/269 (63%), Gaps = 4/269 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           ++ ++ DA   F+ +DGWA+ASHI+LS L+++FPF++   +LAGF G+ +       ++ 
Sbjct: 7   IYVVVMDAFYTFLADDGWAIASHIALSTLMALFPFLIVLTSLAGFFGSKELADQAASLML 66

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
             WP+ +A  ++ EI  VL     G+ TI A  + YF+SNGVEALR++LNRAY VVEMR 
Sbjct: 67  EVWPKQVADSLSGEIHDVLTTTRTGVLTIGAALSVYFASNGVEALRVALNRAYAVVEMRR 126

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPAL--GNLLLIIWNGRIYAT 185
           WY  RL S GY L+A+ T + M+F+ V  PL +   R+  P     N  ++ W  R   T
Sbjct: 127 WYWLRLESIGYTLVAAFTALAMAFLIVLGPLIIEATRRHIPLFVESNESILTWL-RYGIT 185

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF-STYSTMYAG 244
           + AL + LI +H ++PA +   + ILPG++FT ++ ++  ++F  Y+  F + Y TMYAG
Sbjct: 186 IGALVVALIILHAWVPAGRRSFLQILPGIVFTMVASLISGIVFGQYLARFANNYVTMYAG 245

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMI 273
           LAS++  LVFLY +   F+ G ELNA++I
Sbjct: 246 LASVIIALVFLYFIAAIFVYGGELNAAII 274


>gi|49476272|ref|YP_034313.1| ribonuclease RNAse BN transmembrane protein [Bartonella henselae
           str. Houston-1]
 gi|49239080|emb|CAF28383.1| Ribonuclease RNAse bn transmembrane protein [Bartonella henselae
           str. Houston-1]
          Length = 284

 Score =  211 bits (537), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 110/275 (40%), Positives = 175/275 (63%), Gaps = 1/275 (0%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           ++  F   + I+ DA+ H+  ++G A ASH++LS LL++FPF +FGA+LA F+GA  + P
Sbjct: 2   LKRIFWYSYRILVDAVSHYWRDNGSAFASHVALSGLLALFPFFIFGASLASFIGAFTYTP 61

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
             I  +    P+VIA+P++ +I+ VL +  +G+ T+S + AAYF+SNGVEALR +LN+AY
Sbjct: 62  QKIKALLQLLPDVIAEPLSQDIVNVLTIQRRGVLTVSVIGAAYFASNGVEALRTALNKAY 121

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RVV+ RS    R  S  +V+L +  LV++SF+ +  PL +  ++     +   + +I   
Sbjct: 122 RVVDRRSLLFCRFQSLFFVILGAFGLVVISFLLILAPLIIKIMQDHSFFITEYIGVIRLW 181

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R     + LF+ L+ VH +LPA + K + +LPG++ T   W + ++ F  Y+  F   ST
Sbjct: 182 RYIIAAVVLFVSLLIVHKWLPAERRKFIDVLPGIVVTMSVWFMASLAFAQYLTMFDYIST 241

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            YAGLASIM  ++FLY+L   FILG E+NA+++ Y
Sbjct: 242 -YAGLASIMVAIIFLYILSAIFILGGEINAAIMFY 275


>gi|240851358|ref|YP_002972761.1| ribonuclease RNAse BN transmembrane protein [Bartonella grahamii
           as4aup]
 gi|240268481|gb|ACS52069.1| ribonuclease RNAse BN transmembrane protein [Bartonella grahamii
           as4aup]
          Length = 288

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 112/275 (40%), Positives = 172/275 (62%), Gaps = 1/275 (0%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +R  F   + I+ DA+ H+  ++G A ASH++LS LL+ FPF +FG +LA FLGA  + P
Sbjct: 2   LRNIFWYSYRILVDAVSHYWRDNGSAFASHVALSGLLAFFPFFIFGTSLASFLGAFTYTP 61

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
             I  +    P+VIA+P++ EI+ VL +   G+ T+S + AAYF+SNGVEALR +LNRAY
Sbjct: 62  QKIKALVQLLPDVIAEPLSQEIINVLTIQRGGVLTVSVIGAAYFASNGVEALRTALNRAY 121

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RVV+ RS    R  S  +V+L +V L+++S + +  PL +  ++     +   + +I   
Sbjct: 122 RVVDRRSLLFCRFQSLFFVILGAVGLIVISVLLILTPLLIKIMQNHPFFITEYIGVIRLW 181

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R     + LF+ L+ VH +LPA + K + ILPG++ T   W + ++ F  Y+  F   ST
Sbjct: 182 RYIIAAVVLFVSLLIVHKWLPAERRKFIDILPGIVLTMFVWFMASIAFAQYLTMFDYIST 241

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            YAGLASIM  ++FLY+L   FILG E+NA+++ +
Sbjct: 242 -YAGLASIMVAIIFLYILSAIFILGGEINAAIMFH 275


>gi|92118944|ref|YP_578673.1| ribonuclease BN [Nitrobacter hamburgensis X14]
 gi|91801838|gb|ABE64213.1| ribonuclease BN [Nitrobacter hamburgensis X14]
          Length = 297

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 111/268 (41%), Positives = 172/268 (64%), Gaps = 2/268 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           V+ +  DA   F+ +DGWA+ASHI+LSAL+++FPF++   +LAGFLG+        +++ 
Sbjct: 7   VYRVGTDAFYTFLADDGWAIASHIALSALMALFPFLIVLTSLAGFLGSKGLADQAAELMI 66

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
             WP+ +A  ++ EI  VL    +   T+ A+ A YF+SNGVE+LR++LNRAY V+E R 
Sbjct: 67  QIWPDQVANALSGEIHDVLTTTRRDALTVGAVLAVYFASNGVESLRVALNRAYAVIEPRR 126

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATM 186
           WY  RL S GY L+A+VT + M+F+ V  PL +A  +++ P +      + N  R   T+
Sbjct: 127 WYWLRLESIGYTLVAAVTALAMAFLIVLGPLIIAAAKRYIPLIVESNESLLNIARYGITV 186

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF-STYSTMYAGL 245
           +A+FI L+ +H +LPA +   + I+PG+IFT ++ +   + F  Y+  F + Y TMYAGL
Sbjct: 187 IAMFIALVILHAWLPAGRRSFLQIIPGIIFTMLASLASGIGFGLYLARFANNYVTMYAGL 246

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMI 273
           AS++  LVFLY +   F+ G ELNA++I
Sbjct: 247 ASVVIALVFLYFIAAIFVFGGELNAAII 274


>gi|319406347|emb|CBI79984.1| ribonuclease RNAse bn transmembrane protein [Bartonella sp. AR
           15-3]
          Length = 286

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 173/272 (63%), Gaps = 1/272 (0%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           + I  +A+ H++ ++G A ASH++LS LL+ FPF +FG +LA FLGA  + P  I+ +  
Sbjct: 10  YHIFCNAVSHYLRDNGNAFASHVALSGLLAFFPFFIFGTSLASFLGAFTYTPQKIEALVQ 69

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
             P+ IA+P++ EI+ VL      L T+S + AAYF+SNGV ALR +LN+AYRV++ RS 
Sbjct: 70  LLPDAIAEPLSKEIITVLTTQRGDLLTLSVIGAAYFASNGVSALRAALNKAYRVIDRRSL 129

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +  R  S  +V++ ++ LV++SF+ V  PL +  ++ +   +   + +I   R    ++ 
Sbjct: 130 FFCRFQSLFFVIIGTIGLVVISFLLVLAPLLIKIMQNYPCHITEYISMIRLWRYVIAIIV 189

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LF  L+ VH +LPA + K++ ILPG++ T   W + ++ F  Y++ F+ Y++ YAGL SI
Sbjct: 190 LFTSLLIVHKWLPAGQRKVIDILPGILVTIFVWFLTSIAFAQYLIMFN-YTSTYAGLTSI 248

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           M  ++FLY+L   FILG E+NA++I Y    K
Sbjct: 249 MIAIIFLYILSAIFILGGEINAAIIFYRDHSK 280


>gi|154244265|ref|YP_001415223.1| putative ribonuclease BN [Xanthobacter autotrophicus Py2]
 gi|154158350|gb|ABS65566.1| putative ribonuclease BN [Xanthobacter autotrophicus Py2]
          Length = 300

 Score =  208 bits (530), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 119/270 (44%), Positives = 164/270 (60%), Gaps = 9/270 (3%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +  I  DA   F  +DGWA+ASHI+LSAL+S+FPF++F   LAGFL         I ++ 
Sbjct: 13  IIHIPLDAFWTFAADDGWAIASHIALSALMSLFPFLIFVTALAGFLNLQPLANETIQLIL 72

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
             WP+ +A PI+ EI  V+      + T   + A YFSSNG+E+LRI LNRAY V EMRS
Sbjct: 73  ETWPQQVAGPISREIYNVVNQVRTDVLTYGVVLAIYFSSNGIESLRIGLNRAYGVKEMRS 132

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPL----ALAYVRKFFPALGNLLLIIWNGRIY 183
           WY  RL S GYVLLA+V+++ +SF+ V  PL    A+A V    P  G + LI    R  
Sbjct: 133 WYWLRLESIGYVLLAAVSMLALSFLVVLGPLLWQAAVAQVPALAPFSGAITLI----RFG 188

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF-STYSTMY 242
           AT + L + L+  HL+LPA +  +  + PG++ T + W+V A  F  Y+  F + Y + Y
Sbjct: 189 ATAIILVVSLVVAHLWLPAGRRSLAEVAPGILVTLVLWLVAATAFGFYLAEFPANYVSTY 248

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASM 272
           AGLAS+M  LVFLY+    F+ G ELNA++
Sbjct: 249 AGLASVMIALVFLYLTASIFVFGGELNAAI 278


>gi|319899464|ref|YP_004159561.1| ribonuclease RNAse bn transmembrane protein [Bartonella
           clarridgeiae 73]
 gi|319403432|emb|CBI77000.1| ribonuclease RNAse bn transmembrane protein [Bartonella
           clarridgeiae 73]
          Length = 284

 Score =  208 bits (530), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 108/275 (39%), Positives = 175/275 (63%), Gaps = 1/275 (0%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +++ F   + I  +A+ H++ ++G A ASH++LS LL+ FPF +FG +LA FLGA ++ P
Sbjct: 2   IKKAFWYSYRIFVNAVSHYLRDNGNAFASHVALSGLLAFFPFFIFGTSLASFLGAFKYTP 61

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
             I+ +    P+ IA+P++ EI+ VL      L T+S + AAYF+SNGV ALRI+LN+AY
Sbjct: 62  QKIEALVQLLPDAIAEPLSKEIITVLTTQRGDLLTLSVIGAAYFASNGVGALRIALNKAY 121

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV++ RS +  R  S  +V++ +V LV +SF+ V  PL +  ++ +   +   + II   
Sbjct: 122 RVIDRRSLFFCRFQSLFFVIIGTVGLVAISFLLVLAPLLIKIMQNYSSHITEYIGIIRLW 181

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R    ++ L   L+ VH +LPA + K++ ILPG++ T   W + ++ F  Y+  F+ Y++
Sbjct: 182 RYIIAIVVLLTSLLIVHKWLPAGQRKLIDILPGILVTIFVWFLTSIAFAQYLTMFN-YTS 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            YAGL SIM  ++FLY+L   FILG E+NA+++ Y
Sbjct: 241 TYAGLTSIMVAIIFLYILSAIFILGGEINAAIMFY 275


>gi|75674946|ref|YP_317367.1| ribonuclease BN [Nitrobacter winogradskyi Nb-255]
 gi|74419816|gb|ABA04015.1| ribonuclease BN [Nitrobacter winogradskyi Nb-255]
          Length = 297

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 112/268 (41%), Positives = 168/268 (62%), Gaps = 2/268 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           ++ I  DA   F+ +DGWA+ASHI+LSAL+++FPF++    LAGF G+ +      D++ 
Sbjct: 7   LYTIGTDAFYTFLADDGWAIASHIALSALMALFPFLIVLTALAGFFGSKELADQAADLML 66

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
             WP+ +A  ++ EI  VL        T+  + A YF+SNGVE+LR++LNRAY V+E R 
Sbjct: 67  QIWPDQVANTLSREIHDVLTTSRGDALTVGLVLAVYFASNGVESLRVALNRAYAVIEPRR 126

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATM 186
           WY  RL S GY L+A+VT + M+F+ V  PL +A  R+  P +      + N  R   T+
Sbjct: 127 WYWLRLESIGYTLVAAVTTLAMAFLIVLGPLIIAAARRHVPLIVESNESLLNIARYGITI 186

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF-STYSTMYAGL 245
           LA+F  L+ +H +LPA +   + I+PG+IFT ++ ++  V F  Y+  F + Y TMYAGL
Sbjct: 187 LAMFTALVILHAWLPAGRRSFVQIIPGIIFTMLASLISGVGFGLYLARFANNYVTMYAGL 246

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMI 273
           AS++  LVFLY +   F+ G ELNA++I
Sbjct: 247 ASVIIALVFLYFIAAIFVFGGELNAAII 274


>gi|182680153|ref|YP_001834299.1| ribonuclease BN [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182636036|gb|ACB96810.1| ribonuclease BN [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 302

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 111/274 (40%), Positives = 162/274 (59%), Gaps = 1/274 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +  +  +A   FVE+DGWA+ASHI+LSAL S+FPF++F   LA FLG+       +  +F
Sbjct: 17  ILSLFLEAFYRFVEDDGWAIASHIALSALTSMFPFLIFVTALAAFLGSQNLPEEAVTFLF 76

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
             WP  +A P+  EI  VL     GL T+S + A YFSS+GVEALRI+LNRAY V ++R 
Sbjct: 77  NTWPAEVAGPLAQEIHNVLTQARGGLLTLSVVLAIYFSSSGVEALRIALNRAYDVKDVRP 136

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           WY+ RL S  YV + +  L+  + + V  PL    + +F P +  L   +   R      
Sbjct: 137 WYLLRLESIVYVFIGAFGLLTFALLIVLAPLIWEIILRFAPGMAPLQQYVTVLRFSIVTA 196

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFS-TYSTMYAGLA 246
            L + L+ +H +LPA +  +  I+ G++ T++ W+ G + F  Y+  F+  Y T YAGLA
Sbjct: 197 ILLLALVIMHKYLPAGRRHLRDIIVGILLTFVLWIAGGMAFGSYLAEFARNYVTTYAGLA 256

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           S+M  LVF YML   FI G ELNA+++ +  RK+
Sbjct: 257 SVMIALVFFYMLACIFIYGGELNAAILRHSRRKQ 290


>gi|328542071|ref|YP_004302180.1| ribonuclease rnase bn (Rbn) transmembrane protein [polymorphum
           gilvum SL003B-26A1]
 gi|326411821|gb|ADZ68884.1| Putative ribonuclease rnase bn (Rbn) transmembrane protein
           [Polymorphum gilvum SL003B-26A1]
          Length = 291

 Score =  205 bits (521), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 118/273 (43%), Positives = 172/273 (63%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           + +   I + ++ DA+ HF  +DGWAMASH++LS+LL++FP ++F A LAGFLG      
Sbjct: 3   LSKRLVIGYRVLGDALGHFNRDDGWAMASHVALSSLLALFPLLIFIAALAGFLGLTGTAA 62

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            V +++F AWPE +A P+ +EI +VL VP   L T   +AA +F+SNGVEA+R++LNRAY
Sbjct: 63  RVSELIFEAWPEQVAAPVANEIKKVLTVPRGDLLTFGVVAALWFASNGVEAVRVALNRAY 122

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV++ R + + RL S   VLL S+ L+  +F+ V  PLALA    +FP L +    I   
Sbjct: 123 RVIDTRPFVLLRLQSILLVLLCSIGLIAFTFLMVLAPLALAAAHAWFPWLADFAGRINAV 182

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R  A  L    GLI VH  LPA + + + ILPGV  T   W+     F  Y+  ++ Y +
Sbjct: 183 RYGAASLVAVAGLIVVHAVLPAGRRRFVDILPGVAATLALWLAAGAAFGAYLAGYADYVS 242

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
            YAGLA +M+ LVFLY++ +  ++G ELNA++I
Sbjct: 243 TYAGLAGVMSALVFLYIVALALLIGGELNAALI 275


>gi|316936222|ref|YP_004111204.1| ribonuclease BN [Rhodopseudomonas palustris DX-1]
 gi|315603936|gb|ADU46471.1| ribonuclease BN [Rhodopseudomonas palustris DX-1]
          Length = 297

 Score =  205 bits (521), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 113/275 (41%), Positives = 165/275 (60%), Gaps = 3/275 (1%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MR+     + +  DA   F+ +DGWA+ASHI+LS L+++FPF++   +LAGF+G+ +   
Sbjct: 1   MRQ-IRTAYAVAVDAFYTFLADDGWAIASHIALSTLMALFPFLIVLTSLAGFIGSRELAD 59

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
              +++   WP  +A  ++ EI  VL     G+ TI  L A YF+SNGVE+LR+ LNRAY
Sbjct: 60  QAAELLLDVWPAQVASTLSGEIHDVLTTTRGGVLTIGLLLALYFASNGVESLRVGLNRAY 119

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPAL-GNLLLIIWN 179
            VVE R WY+ RL S GY L+A+ T + M F+ V  PL LA  R + P L  N   ++  
Sbjct: 120 AVVEPRPWYLLRLESIGYTLVAAFTALAMGFLIVLGPLILATARHYVPVLVQNNEPLLTI 179

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF-STY 238
            R    + AL + L  +H +LPA +     ILPG++FT  + ++  V F  Y+  F + Y
Sbjct: 180 ARYGIAITALTVALFLLHAYLPAGRRSFKQILPGIVFTIAASLISGVAFGMYLARFANNY 239

Query: 239 STMYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
            TMYAGL S++  LVFLY +   F+ G ELNA++I
Sbjct: 240 VTMYAGLGSVIIALVFLYFIAAIFVYGGELNAAII 274


>gi|319404860|emb|CBI78461.1| ribonuclease RNAse bn transmembrane protein [Bartonella rochalimae
           ATCC BAA-1498]
          Length = 275

 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 106/260 (40%), Positives = 164/260 (63%), Gaps = 1/260 (0%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           + H+  ++G A ASH++LS LL+ FPF +FG +LA FLGA  + P  I+ +    P+ IA
Sbjct: 1   MSHYFRDNGSAFASHVALSGLLAFFPFFIFGTSLASFLGAFTYTPQKIEALVQLLPDAIA 60

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
           +P++ EI+ VL      L T+S + AAYF+SNGV ALR +LN+AYRV++ RS +  R  S
Sbjct: 61  EPLSKEIITVLTTQRGDLLTLSVIGAAYFASNGVGALRTALNKAYRVIDRRSLFFCRFQS 120

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIF 195
             +V++ +V LV++SF+ V  PL +  ++     +   + II   R    ++ LF  L+ 
Sbjct: 121 LFFVIIGTVGLVVISFLLVLAPLLIKIMQNHSSQITEYIGIIRLWRYIIAIVVLFTSLLI 180

Query: 196 VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFL 255
           VH +LPA + K+  ILPG++ T   W + ++ F  Y+  F+ Y++ YAGL SIM  ++FL
Sbjct: 181 VHKWLPAGQRKVRDILPGILVTIFVWFLTSIAFAQYLTMFN-YASTYAGLTSIMVAIIFL 239

Query: 256 YMLGVFFILGAELNASMIIY 275
           Y+L   FILG E+NA++I Y
Sbjct: 240 YILSAIFILGGEINAAIIFY 259


>gi|85714895|ref|ZP_01045881.1| ribonuclease BN [Nitrobacter sp. Nb-311A]
 gi|85698381|gb|EAQ36252.1| ribonuclease BN [Nitrobacter sp. Nb-311A]
          Length = 286

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 108/262 (41%), Positives = 164/262 (62%), Gaps = 2/262 (0%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           DA   F+ +DGWA+ASHI+LS L+++FPF++   +LAGF G+ +       ++   WPE 
Sbjct: 2   DAFYTFLADDGWAIASHIALSVLMALFPFLIVLTSLAGFFGSKELADQAAQLMLQIWPEQ 61

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
           +A  ++ EI  VL        TI  + A YF+SNGVE+LR++LNRAY V+E R WY  RL
Sbjct: 62  VANTLSSEIHDVLTTSRGDALTIGLVLAVYFASNGVESLRVALNRAYAVIESRRWYWLRL 121

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIG 192
            S GY L+A+VT + M+F+ V  PL +A  ++  P +      + N  R   T+LA+F+ 
Sbjct: 122 ESIGYTLVAAVTALAMAFLIVLGPLIIAAAKRHIPLIVESNESLLNIARYGITILAMFVA 181

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF-STYSTMYAGLASIMTC 251
           L+ +H +LPA +     I+PG++FT ++ ++  + F  Y+  F + Y TMYAGLAS++  
Sbjct: 182 LLILHAWLPAGRRSFRQIIPGIVFTMLASLMSGIGFGLYLARFANNYVTMYAGLASVVIA 241

Query: 252 LVFLYMLGVFFILGAELNASMI 273
           LVFLY +   F+ G ELNA++I
Sbjct: 242 LVFLYFIAAIFVFGGELNAAII 263


>gi|319407820|emb|CBI81473.1| ribonuclease RNAse bn transmembrane protein [Bartonella sp. 1-1C]
          Length = 271

 Score =  202 bits (514), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 105/256 (41%), Positives = 164/256 (64%), Gaps = 1/256 (0%)

Query: 20  VEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPIT 79
           + ++G A ASH++LS LL+ FPF +FG +LA FLGA  + P  I+ +    P+ IA+P++
Sbjct: 1   MRDNGSAFASHVALSGLLAFFPFFIFGTSLASFLGAFTYTPQKIEALVQLLPDAIAEPLS 60

Query: 80  DEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYV 139
            EI+ VL      L T+S + AAYF+SNGV ALR +LN+AYRV++ RS +  R  S  +V
Sbjct: 61  KEIITVLTTQRGDLLTLSVIGAAYFASNGVGALRTALNKAYRVIDRRSLFFCRFQSLFFV 120

Query: 140 LLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLF 199
           ++ +V LV++SF+ V  PL +  ++ +   +   + II   R    ++ LF  L+ VH +
Sbjct: 121 IIGTVGLVVISFLLVLAPLLIKIMQNYSSQITEYIGIIRLWRYIIAIVVLFTSLLIVHKW 180

Query: 200 LPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLG 259
           LPA + K++ ILPG++ T   W + ++ F  Y+  F+ Y++ YAGL SIM  ++FLY+L 
Sbjct: 181 LPAGQRKVIDILPGILVTIFVWFLTSIAFAQYLTMFN-YASTYAGLTSIMVAIIFLYILS 239

Query: 260 VFFILGAELNASMIIY 275
             FILG E+NA++I Y
Sbjct: 240 AIFILGGEINAAIIFY 255


>gi|39937810|ref|NP_950086.1| ribonuclease BN [Rhodopseudomonas palustris CGA009]
 gi|192293593|ref|YP_001994198.1| ribonuclease BN [Rhodopseudomonas palustris TIE-1]
 gi|39651670|emb|CAE30192.1| putative ribonuclease RNAse BN (RBN) transmembrane protein
           [Rhodopseudomonas palustris CGA009]
 gi|192287342|gb|ACF03723.1| ribonuclease BN [Rhodopseudomonas palustris TIE-1]
          Length = 297

 Score =  201 bits (511), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 108/263 (41%), Positives = 164/263 (62%), Gaps = 4/263 (1%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           DA+  F+ +DGWA+ASHI+LS L+++FPF++   +LAGF+G+ +   +  +++   WP  
Sbjct: 13  DALYTFLADDGWAIASHIALSTLMALFPFLIVLTSLAGFVGSRELADSAAELLLDVWPAQ 72

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
           +A  ++ EI  VL     G+ TI  + A YF+SNGVE+LR+ LNRAY V+E R WY+ RL
Sbjct: 73  VASTLSGEIHDVLTTTRGGVLTIGLVLALYFASNGVESLRVGLNRAYAVIEPRPWYLLRL 132

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPAL--GNLLLIIWNGRIYATMLALFI 191
            S GY L+A+ T + M F+ V  PL +A  R + P L   N  L+ +  R    + AL +
Sbjct: 133 ESIGYTLVAAFTALAMGFLIVLGPLIVATARHYVPLLVHDNEPLLTF-ARYGIAITALTV 191

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF-STYSTMYAGLASIMT 250
            L  +H +LPA +     ILPG++FT  + ++  + F  Y+  F + Y +MYAGLAS++ 
Sbjct: 192 ALFLLHAYLPAGRRSFRQILPGIVFTITASLISGMTFGMYLARFANNYVSMYAGLASVII 251

Query: 251 CLVFLYMLGVFFILGAELNASMI 273
            LVFLY +   F+ G ELNA++I
Sbjct: 252 ALVFLYFIAAIFVYGGELNAAII 274


>gi|115526840|ref|YP_783751.1| ribonuclease BN [Rhodopseudomonas palustris BisA53]
 gi|115520787|gb|ABJ08771.1| ribonuclease BN [Rhodopseudomonas palustris BisA53]
          Length = 297

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 109/270 (40%), Positives = 167/270 (61%), Gaps = 8/270 (2%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           +D+  DA   F+ +DGWA+ASHI+LS+L+++FPF++   ++AGF+G+        +++  
Sbjct: 8   YDVAMDAFYTFLADDGWAIASHIALSSLMALFPFLIVLTSIAGFVGSKNLADQAAELMLQ 67

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            WP  +A  ++ +I  VL        TI  L A YF+SNGVE+LR++LNRAY VV+MRSW
Sbjct: 68  IWPVQVADALSVQIHDVLTTTRGDALTIGLLLAIYFASNGVESLRVALNRAYAVVDMRSW 127

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPAL----GNLLLIIWNGRIYA 184
           Y  RL S GY ++A+ T + M+F+ V  PL L   R++ P +      LL ++  G    
Sbjct: 128 YWLRLESIGYTMVAAFTALAMAFLIVLGPLLLETARRYVPLMVESNETLLTVVRYG---I 184

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF-STYSTMYA 243
           T+ A+ + L  +H +LP  +     ILPG++FT ++ ++  V F  Y+  F S Y TMYA
Sbjct: 185 TIAAMTVALFILHAWLPCGRRTFRQILPGIVFTMLASLLSGVGFGMYLARFASNYVTMYA 244

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMI 273
           GLAS++  LVFLY +   F+ G ELNA++I
Sbjct: 245 GLASVIIALVFLYFIAAIFVYGGELNAAII 274


>gi|254472479|ref|ZP_05085879.1| YihY family protein [Pseudovibrio sp. JE062]
 gi|211958762|gb|EEA93962.1| YihY family protein [Pseudovibrio sp. JE062]
          Length = 296

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 166/271 (61%), Gaps = 12/271 (4%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           + ++ DA+ HF  +DG+A+ASH++LS+L+++FPF++F A  +GFLG +    +  +++F 
Sbjct: 11  YQVLADALGHFNSDDGYAVASHVALSSLMALFPFLIFVAAFSGFLGLNSVAQSATELIFD 70

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            WPE +A P++ EI  VL  P   L T   +   +FSSNGVEA+R+ LNRAYRV + RSW
Sbjct: 71  VWPERVAGPVSGEIKAVLTQPRGDLLTFGVVVTLWFSSNGVEAMRVGLNRAYRVRDNRSW 130

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLA------LAYVRKFFPALGNLLLIIWNGRI 182
           +  R  S   VL+ +  L++ +F+ V  PLA      LA V + F    N++      R 
Sbjct: 131 FFCRTQSILAVLIGTAVLMVSTFLIVFGPLAWEWAVHLAPVMEKFSYKANIV------RY 184

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
             T L L   L+  H++LPA + + + +LPG+  T I W+V    F  Y+  ++ Y ++Y
Sbjct: 185 GITSLLLLFALLAAHMYLPAGRRRFLEVLPGIALTMILWIVAGTAFGAYLARWANYVSLY 244

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMI 273
           AGLA IMT ++F+Y+  V FILG E NA+++
Sbjct: 245 AGLAGIMTAIIFMYLTAVIFILGGEFNAALM 275


>gi|298293398|ref|YP_003695337.1| ribonuclease BN [Starkeya novella DSM 506]
 gi|296929909|gb|ADH90718.1| ribonuclease BN [Starkeya novella DSM 506]
          Length = 277

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 116/266 (43%), Positives = 158/266 (59%), Gaps = 3/266 (1%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           FDI +DA   FVE+DGWA++SHI+LSAL+S+FPF++F   LA F          + ++  
Sbjct: 5   FDIAWDAFWRFVEDDGWAISSHIALSALMSLFPFLIFVTALAAFFDLKTLADETVQLMLE 64

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
           AWP  +A PI  EI  VL      + TI  + A YFSSNG+E+LRI LNRAY V E R+W
Sbjct: 65  AWPAQVAAPIGREIRNVLTQVRTDVLTIGVVLAIYFSSNGIESLRIGLNRAYGVRESRAW 124

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIP-LALAYVRKFFPALGNLLLIIWNGRIYATML 187
           Y  RL S GYV++ +  L+ +SF+ V  P L LA VR + PAL     +I   R  AT  
Sbjct: 125 YWLRLESIGYVVVGAAGLLALSFLVVLGPVLWLAAVR-WVPALQPFGWVITFLRYAATSA 183

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF-STYSTMYAGLA 246
            L + L+  H++LPA +  +  + PG++ T   W+     F  Y+  F + Y T YAGLA
Sbjct: 184 ILIVALVVAHVWLPAGRRTLAEVAPGILVTLGLWLAAGAAFGRYLAEFANNYVTTYAGLA 243

Query: 247 SIMTCLVFLYMLGVFFILGAELNASM 272
           S+M  LVFLY     F+ G ELNA++
Sbjct: 244 SVMIALVFLYTTASIFVYGGELNAAI 269


>gi|158426274|ref|YP_001527566.1| ribonuclease BN [Azorhizobium caulinodans ORS 571]
 gi|158333163|dbj|BAF90648.1| ribonuclease BN [Azorhizobium caulinodans ORS 571]
          Length = 324

 Score =  199 bits (505), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 163/267 (61%), Gaps = 1/267 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
            + ++ DA+  F+ +DGWA+ASHI+LS L+S+FPF++F   LAGFL         I ++ 
Sbjct: 33  TYRVVMDAVWTFLADDGWAIASHIALSILMSLFPFLIFLTALAGFLDLRPLANEAIQLIL 92

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
             WP+ +A+PI  EI  V+      + T+    A YFSSNG+E+LRI LNRAY + E R+
Sbjct: 93  ETWPDAVAEPIAREIHNVVNQVRADVLTVGVALAIYFSSNGIESLRIGLNRAYGMKEHRA 152

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           WY  R+ S  +VL+ +  ++ +SF+ +  PL    +    PAL  +  ++   R  +T L
Sbjct: 153 WYRLRVSSVLFVLVGAAGMLALSFLVILGPLIWQTMVNNVPALKPISGVVTFARFASTAL 212

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST-YSTMYAGLA 246
            L I L+  HL+LPA + +++ +LPG+  T   W+V A +F  Y+  FS+ Y T YAGLA
Sbjct: 213 ILIIALLMAHLWLPAGRRRLLDVLPGIGVTLTLWLVAATVFGIYLGEFSSNYVTTYAGLA 272

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMI 273
           S+M  LVFLY+    FI G ELNA+++
Sbjct: 273 SVMIALVFLYLTATAFIFGGELNAAIL 299


>gi|91975407|ref|YP_568066.1| ribonuclease BN [Rhodopseudomonas palustris BisB5]
 gi|91681863|gb|ABE38165.1| ribonuclease BN [Rhodopseudomonas palustris BisB5]
          Length = 297

 Score =  199 bits (505), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 164/270 (60%), Gaps = 6/270 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           V+ +  DA   F+ +DGWA+ASHI+LS+L+++FPF++   +LAGF G+        +++ 
Sbjct: 7   VYAVGMDAFYTFLADDGWAIASHIALSSLMALFPFLIVLTSLAGFFGSKDLADQAAELLL 66

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
             WP  +A  ++ EI  VL     G  TI  + A YF+SNGVE+LR++LNRAY V+E+R 
Sbjct: 67  DIWPAQVASTLSGEIHDVLTTTRGGALTIGLVLALYFASNGVESLRVALNRAYAVIEVRP 126

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPAL---GNLLLIIWNGRIYA 184
           WY+ RL S GY L+A+ T + M+F+ V  PL LA  R + P L      LL +   R   
Sbjct: 127 WYLLRLESIGYTLVAAFTALAMAFLIVLGPLILATARHYVPLLVEDNQTLLTV--ARYGI 184

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF-STYSTMYA 243
           T+ AL + L+ +H  LPA    +  I PG+ FT ++ +   + F  Y+  F + Y TMYA
Sbjct: 185 TIGALILALVILHARLPAGHRTLKQIAPGIAFTIVASLASGMGFGFYLARFANNYVTMYA 244

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMI 273
           GLAS++  LVFLY +   F+ G ELNA++I
Sbjct: 245 GLASVIIALVFLYFIAAIFVYGGELNAAII 274


>gi|86747942|ref|YP_484438.1| ribonuclease BN [Rhodopseudomonas palustris HaA2]
 gi|86570970|gb|ABD05527.1| Ribonuclease BN [Rhodopseudomonas palustris HaA2]
          Length = 297

 Score =  198 bits (503), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 163/270 (60%), Gaps = 6/270 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           V+ +  DA   F+ +DGWA+ASHI+LS+L+++FPF++   ++AGF G+        +++ 
Sbjct: 7   VYAVAMDAFYTFLADDGWAIASHIALSSLMALFPFLIVLTSVAGFFGSKDLADQAAELML 66

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
             WP  +A  ++ EI  VL        TI  L A YF+SNGVE+LR++LNRAY V+EMR 
Sbjct: 67  QIWPAQVASTLSGEIHDVLTTTRGDALTIGLLLALYFASNGVESLRVALNRAYAVIEMRP 126

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPAL---GNLLLIIWNGRIYA 184
           WY+ RL S GY L+A+ T + M+F+ V  PL LA  R + P +      LL +   R   
Sbjct: 127 WYMLRLESIGYTLVAAFTALAMAFLIVLGPLILATARHYVPLMVEDNQTLLTV--ARYGI 184

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF-STYSTMYA 243
           T+ AL + L  +H  LPA    +  I+PG+ FT ++ +   V F  Y+  F + Y TMYA
Sbjct: 185 TVGALILALFILHARLPAGHRTVKQIVPGIAFTVVASLASGVGFGLYLARFANNYVTMYA 244

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMI 273
           GLAS++  LVFLY +   F+ G ELNA++I
Sbjct: 245 GLASVIIALVFLYFIAAIFVYGGELNAAII 274


>gi|218460242|ref|ZP_03500333.1| putative ribonuclease protein [Rhizobium etli Kim 5]
          Length = 150

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 113/142 (79%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MR+    ++D++YDAI H VE+DG+AMASH++LS+LL+VFPF++FG  LA FLGA QF  
Sbjct: 1   MRKVLRTIYDVVYDAICHMVEDDGFAMASHVALSSLLAVFPFLIFGTALASFLGADQFSS 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T I ++F  WPE IAKP+ D++LQVL +   GL TIS LAAAYF+SNGVEALRISLNRAY
Sbjct: 61  TAIHLIFDTWPEAIAKPLADQVLQVLTIQRGGLLTISVLAAAYFASNGVEALRISLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLA 142
           RV E R+WY TRL S GYVL+A
Sbjct: 121 RVQETRAWYFTRLASLGYVLIA 142


>gi|90426354|ref|YP_534724.1| ribonuclease BN [Rhodopseudomonas palustris BisB18]
 gi|90108368|gb|ABD90405.1| ribonuclease BN [Rhodopseudomonas palustris BisB18]
          Length = 297

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 110/262 (41%), Positives = 159/262 (60%), Gaps = 2/262 (0%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           DA   F+ +DGWA+ASHI+LS+L+++FPF++   +LAGF G+        +++   WP  
Sbjct: 13  DAFYTFLADDGWAIASHIALSSLMALFPFLIVLTSLAGFFGSKGLADQAAELMLQVWPIQ 72

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
           +A  ++ EI  VL        TI  L A YF+SNG+E+LR++LNRAY V E RSWY  RL
Sbjct: 73  VADALSGEIHDVLTTTRGDALTIGLLLAIYFASNGIESLRVALNRAYAVTETRSWYWLRL 132

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA-TMLALFIG 192
            S GY L+A+ T + M+F+ V  PL LA  R++ P +      + N   Y  T+  L I 
Sbjct: 133 ESIGYTLVAAFTALAMAFLIVLGPLLLAAARRYVPLVIEDNATLLNVTRYGITITVLIIA 192

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF-STYSTMYAGLASIMTC 251
           L  +H +LP  +     ILPG+IFT ++ ++  + F  Y+  F S Y TMYAGLAS++  
Sbjct: 193 LFLLHAWLPCGRRTFWQILPGIIFTMVASLLSGIGFGMYLARFASNYVTMYAGLASVIIA 252

Query: 252 LVFLYMLGVFFILGAELNASMI 273
           LVFLY +   F+ G ELNA++I
Sbjct: 253 LVFLYFIAAIFVYGGELNAAII 274


>gi|121601639|ref|YP_988389.1| YihY family protein [Bartonella bacilliformis KC583]
 gi|120613816|gb|ABM44417.1| YihY family protein [Bartonella bacilliformis KC583]
          Length = 285

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 111/279 (39%), Positives = 173/279 (62%), Gaps = 1/279 (0%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M     + + I+ +AI H+   DG A ASH++LS LL+ FPF +FG   AGF+GA  + P
Sbjct: 1   MIRNISLCYHILINAISHYWRGDGSAFASHVALSGLLAFFPFFIFGTFFAGFIGAFTYTP 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
             I  +    P+ I KP+  EI+ VL +  + + T+S   AAYF+SNG+EALR +LN+AY
Sbjct: 61  QKIAALVQLLPDAITKPLMKEIINVLTIQRRDVLTLSVFGAAYFASNGIEALRTALNKAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RVV+ RS+   R  S  +V++ ++ LV++SF  V  P+ +  +++  P +   + +I   
Sbjct: 121 RVVDYRSFIFCRFQSLFFVIIGAIGLVVISFSLVLAPVLVKMMQQHSPFITEYVGVIRLW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYI-VTFSTYS 239
           R    ++   I L+ VH +LPA K K++ ILPG++ T  +W + ++ F HY+ +T   Y 
Sbjct: 181 RYTIAIVISLISLLIVHKWLPAGKRKLIDILPGIVVTMFAWFLASMAFAHYLNLTMLNYV 240

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           + YAGLASIM  ++FLYML   FILG E+NA++++Y  R
Sbjct: 241 STYAGLASIMVAIIFLYMLSAIFILGGEINAAIMLYRDR 279


>gi|323138225|ref|ZP_08073297.1| ribonuclease BN [Methylocystis sp. ATCC 49242]
 gi|322396477|gb|EFX99006.1| ribonuclease BN [Methylocystis sp. ATCC 49242]
          Length = 281

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 108/259 (41%), Positives = 155/259 (59%), Gaps = 2/259 (0%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPE 72
           YDA   F  +DGWA+ASHI+LS L ++FPF++F   LAGF G  +       ++F AWP 
Sbjct: 8   YDAYLKFERDDGWAIASHIALSTLTALFPFLIFITALAGFFGRQEVADAAAKIIFEAWPP 67

Query: 73  VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
            IA P++ E+  VL  P  G+ TI A+   YF+S+GVEALR++LNRAY   + R W+  R
Sbjct: 68  RIAGPLSAEVQSVLTEPRHGMATIGAVLGIYFASSGVEALRVALNRAYDARDQRPWWWLR 127

Query: 133 LISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF-I 191
           L +  +V + + +L+ + F+ V  PLA A   +  PAL + L  ++    Y    A+  +
Sbjct: 128 LEAIVFVFIGAASLLAIGFLLVLAPLARAIATQHAPALMHELEPLYAPVRYGVTTAVVSV 187

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFS-TYSTMYAGLASIMT 250
            L+  H+FLPA +  +  I+PG   T ++ +    LF  Y+  F+ +Y + YAGLASIM 
Sbjct: 188 ALLAAHVFLPAGQRPLARIVPGFALTLLASLACGALFGAYLAEFAGSYVSTYAGLASIMM 247

Query: 251 CLVFLYMLGVFFILGAELN 269
            LVFLY L V FI GAELN
Sbjct: 248 ALVFLYSLAVIFIYGAELN 266


>gi|163869287|ref|YP_001610543.1| ribonuclease RNAse BN transmembrane protein [Bartonella tribocorum
           CIP 105476]
 gi|161018990|emb|CAK02548.1| ribonuclease RNAse bn transmembrane protein [Bartonella tribocorum
           CIP 105476]
          Length = 283

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 112/275 (40%), Positives = 169/275 (61%), Gaps = 1/275 (0%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           ++  F   + I  DAI H+  + G A ASH++LS LL+ FPF +FG   A FLGA  + P
Sbjct: 2   LKNIFWYSYRIFGDAISHYWRDSGSAFASHVALSGLLAFFPFFIFGTFFARFLGAFTYTP 61

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
             I  +    P+VIA+P++ EI+ VL +   G+ T+S +  AYF+SNG+EALR +LN+AY
Sbjct: 62  QKIKALVQLLPDVIAEPLSQEIVNVLTLHQGGVLTLSIIGTAYFASNGIEALRTALNKAY 121

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV + RSW+  R  S  +V+L +  LV+MSF+ +  PL +  ++     +   + +I   
Sbjct: 122 RVTDRRSWFFCRFQSLFFVILGAFGLVVMSFLLILAPLLIKIMQNHPFFMTEYIGVIRLW 181

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R    ++ LFI L+ VH +LPA + K + ILPG++ T   W + ++ F  Y+  F   ST
Sbjct: 182 RYTIAVVILFISLLIVHKWLPAGQRKFIDILPGIVVTMFVWFMASLAFAQYLTMFDYIST 241

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            YAGLASIM  ++FLY+L   FILG E+NA+++ Y
Sbjct: 242 -YAGLASIMVAIIFLYILSAIFILGGEINAAIMFY 275


>gi|23010564|ref|ZP_00051208.1| COG1295: Predicted membrane protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 310

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 157/267 (58%), Gaps = 1/267 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           VFD+   A + FV  DGWA+ASHI+LS L S+FPF++  A LAG  G+         ++F
Sbjct: 17  VFDVAGLAAQRFVAHDGWAIASHIALSMLTSLFPFLILVAALAGLFGSKSLADEAGTLIF 76

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
            A P  +AKPI  E+ ++L     G+ T+ AL A YFSS+GVE+LR+ LNRAY + EMR 
Sbjct: 77  DAVPREVAKPIVGEVHRLLTEQRGGVLTLGALLALYFSSSGVESLRVGLNRAYGIREMRP 136

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           W++TRL S GYV+  +  ++  +F+ V  PL    +    P L  L L +  GRI  T +
Sbjct: 137 WWLTRLESIGYVVCGAFAMLAFAFLVVLGPLIWRQLVFVAPGLEPLGLTVAIGRIVITAV 196

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST-YSTMYAGLA 246
            + + L+  H F+ A +   +S++PG+  T   W +  + F  Y+  FS  Y++ Y GLA
Sbjct: 197 LIAMVLVIAHKFVAAGRRPFLSVMPGIAVTLGLWFLAGLGFGFYLDRFSNAYASTYGGLA 256

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMI 273
           + M  LVFLY L   F+ G E+N ++I
Sbjct: 257 TAMIFLVFLYWLAAMFLFGGEVNGTVI 283


>gi|220924378|ref|YP_002499680.1| ribonuclease BN [Methylobacterium nodulans ORS 2060]
 gi|219948985|gb|ACL59377.1| ribonuclease BN [Methylobacterium nodulans ORS 2060]
          Length = 293

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 106/266 (39%), Positives = 153/266 (57%), Gaps = 1/266 (0%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           F+I   A + FV  DGWA+ASHI+LS L S+FPF++    LA   G+        +++F 
Sbjct: 7   FEIAAIAAQRFVAHDGWAIASHIALSLLTSLFPFLILLTALASVFGSKSLADEASNLLFE 66

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            WP  +A P+  E+ +VL     GL T+ AL A YFSS+GVE+LR+ LNRAY + E+R W
Sbjct: 67  VWPSEVAGPVATEVHRVLTEQRGGLLTVGALLALYFSSSGVESLRVGLNRAYGLREVRPW 126

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           ++TRL S GYV+ A+  ++  +F+ V  PL    +    P L  L L I   R++ T L 
Sbjct: 127 WLTRLESIGYVICAAFAMLAFTFLVVLGPLMWRGLILVAPGLEPLGLTIAVVRVFLTALL 186

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFS-TYSTMYAGLAS 247
           + + L+  H F+ A +     +LPGV  T   WV+  + F  Y+  FS  Y + Y GLA+
Sbjct: 187 IALVLVIAHKFIAAGRRPWHMVLPGVAVTLGMWVLAGLGFGMYLDRFSGAYVSTYGGLAT 246

Query: 248 IMTCLVFLYMLGVFFILGAELNASMI 273
            M  LVFLY L   F+ G E+N ++I
Sbjct: 247 AMVFLVFLYWLAAMFLFGGEINGTII 272


>gi|170750736|ref|YP_001756996.1| ribonuclease BN [Methylobacterium radiotolerans JCM 2831]
 gi|170657258|gb|ACB26313.1| ribonuclease BN [Methylobacterium radiotolerans JCM 2831]
          Length = 295

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 110/260 (42%), Positives = 154/260 (59%), Gaps = 1/260 (0%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVI 74
           A + FV  DGWA+ASHI+LS+L S+FPF++  A LAG  G          ++F AWP  I
Sbjct: 4   AAQRFVSHDGWAIASHIALSSLTSLFPFLILLAALAGLFGTQSLADEAGVLIFDAWPREI 63

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
           AKPI  E+ +VL     G+ T+ AL A YFSS+GVE+LR+ LNRAY + E R W++TRL 
Sbjct: 64  AKPIVGEVHRVLTEQRSGVLTLGALFALYFSSSGVESLRVGLNRAYGLRESRPWWLTRLE 123

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLI 194
           S GYV+  +  ++  + + V  PL    V    P L  L L +  GRI  T L L + L+
Sbjct: 124 SIGYVICGAFAMLAFALLVVLGPLIWRNVVLVAPGLEPLSLTVAIGRIAVTALLLAVVLV 183

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST-YSTMYAGLASIMTCLV 253
             H F+ A +  I+S+LPG+  T + W    + F +Y+  FS  Y++ Y GLA+ M  LV
Sbjct: 184 IAHKFVAAGRRSILSVLPGIGVTLVLWFFAGLGFGYYLDRFSNAYASTYGGLATAMVFLV 243

Query: 254 FLYMLGVFFILGAELNASMI 273
           FLY L   F+ G E+N ++I
Sbjct: 244 FLYWLAAMFLFGGEINGTVI 263


>gi|299132223|ref|ZP_07025418.1| ribonuclease BN [Afipia sp. 1NLS2]
 gi|298592360|gb|EFI52560.1| ribonuclease BN [Afipia sp. 1NLS2]
          Length = 294

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 112/275 (40%), Positives = 158/275 (57%), Gaps = 5/275 (1%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           F I  DA   F+ +DGWA+ASHI+LSAL++ FPF++  A+LAGFLG+         ++  
Sbjct: 8   FQIGIDAFNAFLADDGWAIASHIALSALMAFFPFLIVLASLAGFLGSKDLADQAAGLMLQ 67

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            WP   A  +  +I  VL        T+  + + YFSSNGVE+LR+ LNRAY V E R W
Sbjct: 68  VWPSQAADALVTQIHDVLTQTRGDALTLGLVLSVYFSSNGVESLRVGLNRAYGVTETRPW 127

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           Y  RL S GY L+A++  ++++ + V  PL LA  R + P +      + N   YA  L 
Sbjct: 128 YWLRLESIGYTLIAALISLVLALLLVLGPLLLATARYYLPLIIEPKAHLLNFSRYAIALV 187

Query: 189 LFIGLIFV-HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF-STYSTMYAGLA 246
             +  +FV H +LPA    +  I+PG+ FT I+ +V A  F  Y+  F + Y T YAGLA
Sbjct: 188 SLVSALFVLHAWLPAGHRTLRQIMPGIAFTVIASLVSAAGFGQYLARFANNYVTTYAGLA 247

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
           S++  LVFLY +   FI G  LNA++I    RK+P
Sbjct: 248 SVVIALVFLYFIAAIFIFGGALNAAII---RRKQP 279


>gi|170742693|ref|YP_001771348.1| ribonuclease BN [Methylobacterium sp. 4-46]
 gi|168196967|gb|ACA18914.1| ribonuclease BN [Methylobacterium sp. 4-46]
          Length = 293

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 102/272 (37%), Positives = 151/272 (55%), Gaps = 1/272 (0%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
            +I   A + FV  DGWA+ASHI+LS L S+FPF++    LA   G         +++F 
Sbjct: 7   LEIAAIAAQRFVAHDGWAIASHIALSLLTSLFPFLILLTALASVFGTKSLADEASNLLFE 66

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            WP  +A P+  E+ +VL     G+ TI AL A YFSS+GVE+LR+ LNRAY + E R W
Sbjct: 67  VWPSEVAGPVAAEVHRVLTEQRGGILTIGALLALYFSSSGVESLRVGLNRAYGLRESRPW 126

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           ++TRL S GYV+  +  ++  +F+ V  PL    +    P +  L L I   R+  T L 
Sbjct: 127 WLTRLESIGYVICGAFAMLAFTFLVVLGPLVWRALVMVAPGIEPLGLTIAVVRVALTALL 186

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST-YSTMYAGLAS 247
           + + L+  H F+ A +     +LPGV  T   WV+  + F  Y+  FS+ Y + Y GLA+
Sbjct: 187 IALVLVIAHKFIAAGRRPWHMVLPGVAVTLGMWVIAGLGFGTYLDRFSSAYVSTYGGLAT 246

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            M  L+F+Y L   F+ G E+N ++I    R+
Sbjct: 247 AMVFLIFVYWLAAMFLFGGEVNGTLIAARRRR 278


>gi|188581440|ref|YP_001924885.1| ribonuclease BN [Methylobacterium populi BJ001]
 gi|179344938|gb|ACB80350.1| ribonuclease BN [Methylobacterium populi BJ001]
          Length = 317

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 157/267 (58%), Gaps = 1/267 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           + D++  A + FV  DGWA+ASHI+LS L S+FPF++  A LAG +G          ++F
Sbjct: 25  ILDVMGLAAQRFVAHDGWAIASHIALSMLTSLFPFLILLAALAGLIGTKSLADEAGTLIF 84

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
            A P  +AKPI  E+ ++L     G+ T+ AL A YFSS+GVE+LR+ LNRAY + EMR 
Sbjct: 85  DAVPREVAKPIVGEVHRLLTEQRGGVLTLGALLALYFSSSGVESLRVGLNRAYGIREMRP 144

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           W++TRL S GYV+  +  ++  + + V  PL    +    P L  L L +  GRI  T  
Sbjct: 145 WWLTRLESIGYVVCGAFAMLAFALLVVLGPLIWRQLVFVAPGLEPLALTVAIGRIGVTAF 204

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST-YSTMYAGLA 246
            + + L+  H F+ A +  ++S+LPG+  T   W +  + F +Y+  FS  Y++ Y GLA
Sbjct: 205 LIALVLVIAHKFVAAGRRPVLSVLPGIAVTLGLWFLAGLGFGYYLDRFSNAYASTYGGLA 264

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMI 273
           + M  LVFLY L   F+ G E+N ++I
Sbjct: 265 TAMIFLVFLYWLAAMFLFGGEVNGTVI 291


>gi|240138821|ref|YP_002963296.1| putative ribonuclease RNAse BN [Methylobacterium extorquens AM1]
 gi|240008793|gb|ACS40019.1| putative ribonuclease RNAse BN [Methylobacterium extorquens AM1]
          Length = 300

 Score =  172 bits (436), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 105/270 (38%), Positives = 159/270 (58%), Gaps = 1/270 (0%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
           F  + D+   A + FV  DGWA+ASHI+LS L S+FPF++  A LAG +G+         
Sbjct: 4   FKKILDVTGIAAQRFVAHDGWAIASHIALSMLTSLFPFLILLAALAGLIGSKSLADEAGT 63

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
           ++F A P  +AKPI  E+ ++L     G+ T+ AL A YFSS+GVE+LR+ LNRAY + E
Sbjct: 64  LIFDAVPREVAKPIVGEVHRLLTEQRGGVLTLGALLALYFSSSGVESLRVGLNRAYGIRE 123

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R W++TRL S GYV+  ++ ++  + + V  PL    +    P L  L L +  GRI  
Sbjct: 124 ARPWWLTRLESIGYVVCGALAMLAFALLVVLGPLIWRQLVFVAPGLEPLALTVAIGRIGV 183

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST-YSTMYA 243
           T   + + L+  H F+ A +  ++S+LPG++ T   W +  + F +Y+  FS  Y++ Y 
Sbjct: 184 TAFLIALVLVIAHKFVAAGRRPVLSVLPGIVVTLCLWFLAGLGFGYYLDRFSNAYASTYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMI 273
           GLA+ M  LVFLY L   F+ G E+N ++I
Sbjct: 244 GLATAMIFLVFLYWLAAMFLFGGEINGTVI 273


>gi|163851653|ref|YP_001639696.1| ribonuclease BN [Methylobacterium extorquens PA1]
 gi|218530460|ref|YP_002421276.1| ribonuclease BN [Methylobacterium chloromethanicum CM4]
 gi|163663258|gb|ABY30625.1| ribonuclease BN [Methylobacterium extorquens PA1]
 gi|218522763|gb|ACK83348.1| ribonuclease BN [Methylobacterium chloromethanicum CM4]
          Length = 315

 Score =  172 bits (435), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 105/270 (38%), Positives = 159/270 (58%), Gaps = 1/270 (0%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
           F  + D+   A + FV  DGWA+ASHI+LS L S+FPF++  A LAG +G+         
Sbjct: 19  FKKILDVTGIAAQRFVAHDGWAIASHIALSMLTSLFPFLILLAALAGLIGSKSLADEAGT 78

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
           ++F A P  +AKPI  E+ ++L     G+ T+ AL A YFSS+GVE+LR+ LNRAY + E
Sbjct: 79  LIFDAVPREVAKPIVGEVHRLLTEQRGGVLTLGALLALYFSSSGVESLRVGLNRAYGIRE 138

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R W++TRL S GYV+  ++ ++  + + V  PL    +    P L  L L +  GRI  
Sbjct: 139 ARPWWLTRLESIGYVVCGALAMLAFALLVVLGPLIWRQLVFVAPGLEPLALTVAIGRIGV 198

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST-YSTMYA 243
           T   + + L+  H F+ A +  ++S+LPG++ T   W +  + F +Y+  FS  Y++ Y 
Sbjct: 199 TAFLIALVLVIAHKFVAAGRRPVLSVLPGIVVTLCLWFLAGLGFGYYLDRFSNAYASTYG 258

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMI 273
           GLA+ M  LVFLY L   F+ G E+N ++I
Sbjct: 259 GLATAMIFLVFLYWLAAMFLFGGEINGTVI 288


>gi|254561424|ref|YP_003068519.1| ribonuclease RNAse BN [Methylobacterium extorquens DM4]
 gi|254268702|emb|CAX24661.1| putative ribonuclease RNAse BN [Methylobacterium extorquens DM4]
          Length = 300

 Score =  171 bits (432), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 105/270 (38%), Positives = 158/270 (58%), Gaps = 1/270 (0%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
           F  + D+   A + FV  DGWA+ASHI+LS L S+FPF++  A LAG +G+         
Sbjct: 4   FKKILDVTGIAAQRFVAHDGWAIASHIALSMLTSLFPFLILLAALAGLIGSKSLADEAGT 63

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
           ++F A P  +AKPI  E+ ++L     G+ T+ AL A YFSS+GVE+LR+ LNRAY + E
Sbjct: 64  LIFDAVPREVAKPIVGEVHRLLTEQRGGVLTLGALLALYFSSSGVESLRVGLNRAYGIRE 123

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R W++TRL S GYV+  ++ ++  + + V  PL    +    P L  L L +  GRI  
Sbjct: 124 ARPWWLTRLESIGYVVCGALAMLAFALLVVLGPLIWRQLVFVAPGLEPLALTVAIGRIGV 183

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST-YSTMYA 243
           T   + + L+  H F+ A +  ++S LPG++ T   W +  + F +Y+  FS  Y++ Y 
Sbjct: 184 TAFLIALVLVIAHKFVAAGRRPVLSALPGIVVTLCLWFLAGLGFGYYLDRFSNAYASTYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMI 273
           GLA+ M  LVFLY L   F+ G E+N ++I
Sbjct: 244 GLATAMIFLVFLYWLAAMFLFGGEINGTVI 273


>gi|296446755|ref|ZP_06888694.1| ribonuclease BN [Methylosinus trichosporium OB3b]
 gi|296255758|gb|EFH02846.1| ribonuclease BN [Methylosinus trichosporium OB3b]
          Length = 273

 Score =  161 bits (408), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 141/257 (54%), Gaps = 1/257 (0%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           DA  HF E DG+A+ASHI+L+ L+S+FPF++    LA   G+ +       ++   WP  
Sbjct: 6   DAFLHFNEGDGFAIASHIALTTLMSLFPFLIVVTALAATFGSTRLADEAGRLLLDVWPSQ 65

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
           +A PI  EI +V   P     T  AL + YF+S+G+E+LRI LNRAY   E R W++ RL
Sbjct: 66  VAAPIAGEIRRVATTPQGSALTAGALFSVYFASSGIESLRIGLNRAYEAQETRPWWLLRL 125

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGL 193
            S  YVL ++V L+I+S + V  P+      ++F  L +    +   R     L L   L
Sbjct: 126 ESIFYVLGSAVALLILSVLVVLWPIVTDVAARWFDWLPSFWTFVTLARFAIATLVLAAAL 185

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST-YSTMYAGLASIMTCL 252
             +H +LPA + +I   LPGV+ T   W++    F  Y+  F+  Y   YAGLAS M  L
Sbjct: 186 FAIHNWLPAGRRRISETLPGVVVTLALWLIAGSAFGAYLSAFAERYVLTYAGLASAMIAL 245

Query: 253 VFLYMLGVFFILGAELN 269
           VFLY   V FI G ELN
Sbjct: 246 VFLYFTAVIFIYGGELN 262


>gi|99081021|ref|YP_613175.1| ribonuclease BN, putative [Ruegeria sp. TM1040]
 gi|99037301|gb|ABF63913.1| ribonuclease BN putative [Ruegeria sp. TM1040]
          Length = 288

 Score =  152 bits (385), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 92/264 (34%), Positives = 149/264 (56%), Gaps = 4/264 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA---HQFV-PTVIDVV 66
           I   A+  F  ++ W ++SHI++S ++++FPF++F  +L+G + +   H+ V   V+++V
Sbjct: 14  IARRALGRFSRKNAWVLSSHIAMSMMMALFPFVLFTVSLSGAIASLFSHRIVVDDVVNLV 73

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
           FG+WP+ +A+PIT E+  VL     GL T+  + A YF+SNGV+A+RI++ RAY   E R
Sbjct: 74  FGSWPQSVAEPITREVYAVLETSGTGLMTLGGVLALYFASNGVDAIRIAMLRAYGQEETR 133

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            ++  RLIS G V+L    L++ +   + +PL   +V +FFP L  L             
Sbjct: 134 PFWKHRLISLGLVILGGAGLLLTAVFELFLPLGARFVGRFFPDLDFLRGWEQGANGLVVA 193

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           +     +   HL L   +  +  +LPG + T + W      F  Y+ +F++YS  YAGLA
Sbjct: 194 VIPVAAVFLYHLVLLPKRETLRHVLPGALVTLVLWWASGAGFAFYVSSFASYSATYAGLA 253

Query: 247 SIMTCLVFLYMLGVFFILGAELNA 270
             M  L+FLY+     ILGAE+N 
Sbjct: 254 GAMAALIFLYLNAAILILGAEING 277


>gi|163745909|ref|ZP_02153268.1| hypothetical protein OIHEL45_09993 [Oceanibulbus indolifex HEL-45]
 gi|161380654|gb|EDQ05064.1| hypothetical protein OIHEL45_09993 [Oceanibulbus indolifex HEL-45]
          Length = 311

 Score =  152 bits (383), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 146/259 (56%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           ++++A+     +D + MA +++  ALL++FPF++F ++L  + G       +I  +    
Sbjct: 39  VLHEAVLRLWSDDAFGMAGNVAFRALLAIFPFLIFTSSLTAYFGDRSMADDLIHFLIAIV 98

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P  + +P+  E+ +V+ VP   L ++  L   +F+  GV+ +RI LNRAY + E RS + 
Sbjct: 99  PPALIEPLVTEVEKVMTVPRGDLLSVGILLTVWFAVGGVDGVRIGLNRAYGLRETRSVFT 158

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
              +    VLLAS+ LVI+ ++ V  P A +++    P      + +   R   +   L 
Sbjct: 159 IYAVQVVMVLLASLILVIVGYLLVLAPRAGSWLHMLMPGFDPGSVTVGLIRFPVSATILL 218

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           + L   H+ LPA ++K  +I PGV+ T I+W + A+LF+ Y+ +F+TYS+ YAG+A I+ 
Sbjct: 219 VALFAAHVILPARRTKFNNIWPGVVATAIAWTLLAMLFSTYLRSFATYSSYYAGMAGIIA 278

Query: 251 CLVFLYMLGVFFILGAELN 269
            L F+Y+  +  I G ELN
Sbjct: 279 ALYFMYLAALVLIFGGELN 297


>gi|254488995|ref|ZP_05102200.1| YihY family protein [Roseobacter sp. GAI101]
 gi|214045864|gb|EEB86502.1| YihY family protein [Roseobacter sp. GAI101]
          Length = 316

 Score =  151 bits (382), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 86/249 (34%), Positives = 140/249 (56%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
            +D + +A +++   LL+VFPF++F +++  F+G+      ++  +    PE + +PI  
Sbjct: 49  SDDAFGLAGNVAFRVLLAVFPFLIFTSSMTAFVGSQSMAEDLVSFLLAIVPETLIEPIVS 108

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
           E+ QV+ V   G+ +   L   +F+  GV+ +R+ LNRAY V E RSWY+   +    V+
Sbjct: 109 EVKQVMTVQRGGVLSTGILLTIWFALGGVDGVRVGLNRAYGVRETRSWYVVYPVMVLMVI 168

Query: 141 LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFL 200
           +AS+ LV++ ++ V  P A +++   FP      + I   R  A  + L   L   H+FL
Sbjct: 169 IASLVLVLVGYLLVLAPRAGSWLHVLFPGFDPASVTIRLVRYPAAAIILVFSLFLAHVFL 228

Query: 201 PAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGV 260
           PA +++  SI PGV+FT  +W    V FT Y+  F+TY+T Y GLA I+  L FLY+  +
Sbjct: 229 PARRTRFSSIYPGVLFTVAAWTSLTVAFTFYLANFATYATYYGGLAGIVAALYFLYLAAL 288

Query: 261 FFILGAELN 269
             I G ELN
Sbjct: 289 VLIFGGELN 297


>gi|163736480|ref|ZP_02143899.1| ribonuclease BN, putative [Phaeobacter gallaeciensis BS107]
 gi|163743276|ref|ZP_02150657.1| ribonuclease BN, putative [Phaeobacter gallaeciensis 2.10]
 gi|161383464|gb|EDQ07852.1| ribonuclease BN, putative [Phaeobacter gallaeciensis 2.10]
 gi|161390350|gb|EDQ14700.1| ribonuclease BN, putative [Phaeobacter gallaeciensis BS107]
          Length = 287

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 91/268 (33%), Positives = 158/268 (58%), Gaps = 8/268 (2%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFL-GAHQF---VPTVIDVVF 67
           +Y A + F +++GW ++SHI++S +L++FPFI+F   L G + GA      +  ++++VF
Sbjct: 14  LYLAAKRFNDKNGWVLSSHIAMSLMLALFPFILFTVALTGAVAGAFSDGIDLKNLVELVF 73

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
           G+WP+ ++ PI  E+  VLA  + G+ T+  + A YF+SNGV+A+R+++ +AY   + R 
Sbjct: 74  GSWPDSVSDPIVREVYSVLATSSTGVVTLGGVIAIYFASNGVDAVRLAMVQAYHERDHRP 133

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           ++ TR +  G V+L    ++  +   + +PL   ++  FFP +   L   W   +   ++
Sbjct: 134 FWKTRGLCIGLVILGGAGIMAAAVFELILPLYARHLASFFPQVP--LARNWESGLNGILV 191

Query: 188 AL--FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           A+   I +   H+ LPA + +   +LPGV+ T + W    + F  YI +F++YS  YAGL
Sbjct: 192 AVIPLIAVCAFHMLLPAKRHRFTQVLPGVLLTVVLWWAAGLAFAIYISSFASYSATYAGL 251

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMI 273
           A  M  L+FLY+     ILGAELN  ++
Sbjct: 252 AGAMAALIFLYLNSAILILGAELNGVLL 279


>gi|259419076|ref|ZP_05742993.1| YihY family protein [Silicibacter sp. TrichCH4B]
 gi|259345298|gb|EEW57152.1| YihY family protein [Silicibacter sp. TrichCH4B]
          Length = 287

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 90/264 (34%), Positives = 147/264 (55%), Gaps = 4/264 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA---HQFVPTVIDVV- 66
           I+  A+  F  ++ W ++SHI++S ++++FPF++F   L+G + +   H+ V   +  + 
Sbjct: 13  ILRRALGRFGRKNAWVLSSHIAMSMMMALFPFVLFTVALSGAIASLFSHRVVVDDVVDLV 72

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
           FG+WP+ +A+PIT E+  VL     GL T+  + A YF+SNGV+A+RI++ RAY   E R
Sbjct: 73  FGSWPQSVAEPITREVYAVLETSGTGLMTLGGVLALYFASNGVDAIRIAMLRAYGQEETR 132

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            ++  RLIS G V++    L++ +   + +PL   +V +FFP L  L             
Sbjct: 133 PFWKHRLISLGLVIMGGAGLLLTAVFELFLPLGARFVARFFPDLDFLRGWEHGANGLVVA 192

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           +     +   HL L   +  +  ILPG + T + W     +F  Y+ +F++YS  YAGLA
Sbjct: 193 VIPVAAVFLYHLVLLPRRETVRHILPGAVVTLLLWWAAGTVFALYVSSFASYSATYAGLA 252

Query: 247 SIMTCLVFLYMLGVFFILGAELNA 270
             M  L+FLY+     ILGAE+N 
Sbjct: 253 GAMAALIFLYLNAAILILGAEING 276


>gi|126737832|ref|ZP_01753562.1| ribonuclease BN, putative [Roseobacter sp. SK209-2-6]
 gi|126721225|gb|EBA17929.1| ribonuclease BN, putative [Roseobacter sp. SK209-2-6]
          Length = 248

 Score =  142 bits (357), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 90/246 (36%), Positives = 145/246 (58%), Gaps = 6/246 (2%)

Query: 33  LSALLSVFPFIVFGANLAGFLG---AHQF-VPTVIDVVFGAWPEVIAKPITDEILQVLAV 88
           +S +L++FPF++F   LAG +    +H+  +  ++D+VFGAWP  ++ PI  E+  VL  
Sbjct: 1   MSMMLALFPFVLFTVALAGAVANLVSHELRLQQLVDLVFGAWPTEVSGPILRELYAVLET 60

Query: 89  PAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVI 148
            + GL T   + A +F+SNGV A+R ++ RAY  ++ R ++++RLI  G V+L    ++I
Sbjct: 61  SSPGLATFGGVLALFFASNGVNAIRFAMVRAYHDLDERPFWLSRLICLGLVILGGSGILI 120

Query: 149 MSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL-FIGLIFVHLFLPAAKSKI 207
            +   +AIPL +AY  + FP +  LL  +  G   A +L + F+ ++  HLFLP     I
Sbjct: 121 AAVFEIAIPLYVAYFSELFPQV-ELLNGLGKGMNRALILGMPFLAVLLCHLFLPGRIHPI 179

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAE 267
             ILPGV+ T   W +  + F  Y+ + + YS  YAGLA  +  ++FLY+     ILGAE
Sbjct: 180 REILPGVLVTAFLWWIAGIGFAFYVTSIAQYSATYAGLAGAIAAIIFLYVNAAILILGAE 239

Query: 268 LNASMI 273
            N ++I
Sbjct: 240 FNGALI 245


>gi|86138868|ref|ZP_01057440.1| ribonuclease BN, putative [Roseobacter sp. MED193]
 gi|85824515|gb|EAQ44718.1| ribonuclease BN, putative [Roseobacter sp. MED193]
          Length = 257

 Score =  139 bits (350), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 89/253 (35%), Positives = 145/253 (57%), Gaps = 8/253 (3%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGA--HQFVP--TVIDVVFGAWPEVIAKPITDEI 82
           M+SHI++S +L++FPF++F   LAG + +   Q +    ++D+VFG+WPE ++ PI  E+
Sbjct: 1   MSSHIAMSMMLALFPFVLFTVALAGTMASVFSQGIDLDHLVDLVFGSWPEPVSTPIVSEL 60

Query: 83  LQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLA 142
             VLA  + GL T+    A YF+SNGV A+RI++ +AY  V+ R ++++R++  G+V+L 
Sbjct: 61  NAVLATSSTGLITVGGFLALYFASNGVNAVRIAMVQAYHDVDRRPFWLSRILCIGFVILG 120

Query: 143 SVTLVIMSFVFVAIPLALAYVRKFFP--ALGNLLLIIWNGRIYATMLALFIGLIFVHLFL 200
              ++  +   V +PL L Y+  FFP   L   L    +G +   +L  F  +   HL L
Sbjct: 121 GAGILFAALFEVILPLYLHYLADFFPEVELSGYLTSGLHGLV--AVLLPFFAVFLCHLVL 178

Query: 201 PAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGV 260
           P    ++  +LPG + T   W    + F  Y+ + + YS  YAGLA  M  ++FLY+   
Sbjct: 179 PGHIHRLSHLLPGTVLTVALWWGAGIGFAFYVGSIAQYSATYAGLAGAMAAMIFLYVNAA 238

Query: 261 FFILGAELNASMI 273
             I GAE N ++I
Sbjct: 239 ILIFGAEFNNALI 251


>gi|260428190|ref|ZP_05782169.1| transporter [Citreicella sp. SE45]
 gi|260422682|gb|EEX15933.1| transporter [Citreicella sp. SE45]
          Length = 313

 Score =  139 bits (350), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 78/254 (30%), Positives = 141/254 (55%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
            +D + +A +++   ++++FPF++F ++L  F+G       +I  +    PE + +PI  
Sbjct: 49  SDDAFGLAGNVAFRVIMAIFPFLIFTSSLTAFIGTDGMAEDLISFLIAIVPEALIEPIVS 108

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
           E+ QV+ V   G+ ++  L   +F+  GV+ +R+ LNRAY + E R WY+   +    V+
Sbjct: 109 EVRQVMTVQRGGVLSLGVLLTIWFALGGVDGIRVGLNRAYGIRETRPWYVLYPLMALMVV 168

Query: 141 LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFL 200
           +AS+ LV++ ++ V  P A +++   FP      + +   R  +  L L   L   H+ L
Sbjct: 169 IASLVLVLVGYLLVLAPRAGSWLHILFPDFDPASVTVSLVRYPSAALILIASLFLAHVLL 228

Query: 201 PAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGV 260
           PA +++  SI PGV+FT +SW+     F+ Y+  F+ Y++ Y GLA I+  L F+Y+  +
Sbjct: 229 PARRTRFSSIYPGVLFTVVSWIALTAAFSFYLGHFAAYASYYGGLAGIIAALYFMYLAAL 288

Query: 261 FFILGAELNASMII 274
             I G ELN ++ I
Sbjct: 289 VLIFGGELNRAIRI 302


>gi|254512526|ref|ZP_05124593.1| YihY family protein [Rhodobacteraceae bacterium KLH11]
 gi|221536237|gb|EEE39225.1| YihY family protein [Rhodobacteraceae bacterium KLH11]
          Length = 286

 Score =  138 bits (348), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 89/259 (34%), Positives = 144/259 (55%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVI 74
           A+  F  ++G+ M+SH+++S ++++FPF++F   LAG L        +I+++FGAWP+ +
Sbjct: 19  AVRRFNNKNGFVMSSHVAMSLMMALFPFVLFTVALAGALSQGYVTDELIELIFGAWPQDV 78

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
           A PI  E+  VLA    G+ T+  L A YF+SNGV A+R ++ +AY   +   ++ TRL+
Sbjct: 79  ADPIVSELRAVLAGAGSGVITLGGLLAIYFASNGVAAVRQAMTQAYHDHDSWPFWKTRLL 138

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLI 194
               V++    ++ ++ V V +P+    V +      +  L +   R   T+      +I
Sbjct: 139 CIALVIIGGAAILAIAAVEVVLPVYTRLVSEKTAVDVDHWLSVDRLRWTFTVAVPAGTVI 198

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
             HL LP  + ++  ILPGV  T   W  G   F+ YI  F++YS  YAGLA  M  L+F
Sbjct: 199 LAHLVLPTRRHRLPQILPGVALTLALWAAGGWGFSVYIAQFASYSATYAGLAGAMAALIF 258

Query: 255 LYMLGVFFILGAELNASMI 273
           LY+     ILGAE N ++I
Sbjct: 259 LYLCSAMLILGAEYNGALI 277


>gi|56696732|ref|YP_167093.1| ribonuclease BN, putative [Ruegeria pomeroyi DSS-3]
 gi|56678469|gb|AAV95135.1| ribonuclease BN, putative [Ruegeria pomeroyi DSS-3]
          Length = 284

 Score =  138 bits (347), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 143/260 (55%), Gaps = 2/260 (0%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVI 74
           A+  F  + G+ M+SH+++S ++++FPFI+F   LAG L        +I ++FG WPE +
Sbjct: 19  ALMRFQAKSGFVMSSHVAMSMMMALFPFILFTVALAGSLSQDLVTDDLIQLIFGTWPEQV 78

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
           A PI  E+  VLA     + T+  + A YF+SNGV+A+R +++RAY   E R ++ TRL+
Sbjct: 79  ATPIVAELKAVLAGANSRVMTVGGVLAVYFASNGVDAVREAMSRAYHDAETRPFWKTRLL 138

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLI 194
               V+     ++ ++   V +P+    V    P      L +     +  ++A+  G +
Sbjct: 139 CIAIVVGGGAIVLAVAAFEVVMPIYTRLVTDALPGAAPDWLSV-ERLSWIFVVAMPAGAV 197

Query: 195 F-VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
              H  LPA +  +  ILPGV+ T + W      F+ YI  F++YST YAGLA  M  L+
Sbjct: 198 LACHALLPAGRHPLRRILPGVVLTLVLWAGCGWGFSLYIANFASYSTTYAGLAGAMAALI 257

Query: 254 FLYMLGVFFILGAELNASMI 273
           FLY+     ILGAE N +++
Sbjct: 258 FLYLNAAILILGAEFNGALM 277


>gi|260433769|ref|ZP_05787740.1| ribonuclease BN [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417597|gb|EEX10856.1| ribonuclease BN [Silicibacter lacuscaerulensis ITI-1157]
          Length = 288

 Score =  138 bits (347), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 90/262 (34%), Positives = 144/262 (54%), Gaps = 6/262 (2%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVI 74
           A+  F +++G+ M+SH+++S +L++FPF +F  +LAG L        +I ++FG WP  +
Sbjct: 19  AVRRFDDKNGFVMSSHVAMSLMLALFPFALFTVSLAGLLSQDYVTDEMIGLIFGVWPNEV 78

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
           A+PI  E+  VL     G  T+ A+ A YF+SNGV A+R ++N+AY   +   ++ TRL 
Sbjct: 79  AEPIVAELRAVLNGAGSGTITLGAVLAVYFASNGVVAVRAAINQAYHDTDSWPFWKTRLF 138

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALG-NLLLIIWNGRIYATMLALFIGL 193
             G V+L    ++I++ V + +P+   Y R        N+   +   R+  T       L
Sbjct: 139 CLGLVILGGAAILIVAAVELLLPI---YSRLMSEKTSVNVADWLSVERLRWTFAVAVPAL 195

Query: 194 --IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
             +  HL LP  +  +  ILPGV+ T   W+ G + F+ YI  F+ YS  YAGLA  M  
Sbjct: 196 TVLLAHLVLPVGRHSLRQILPGVLLTLGLWLAGGLAFSLYIGQFARYSATYAGLAGAMAA 255

Query: 252 LVFLYMLGVFFILGAELNASMI 273
           L+FLY+     I GAE N +++
Sbjct: 256 LIFLYLSAAIMIFGAEFNGALM 277


>gi|91205490|ref|YP_537845.1| putative ribonuclease BN [Rickettsia bellii RML369-C]
 gi|157827145|ref|YP_001496209.1| putative ribonuclease BN [Rickettsia bellii OSU 85-389]
 gi|91069034|gb|ABE04756.1| Putative ribonuclease BN [Rickettsia bellii RML369-C]
 gi|157802449|gb|ABV79172.1| Putative ribonuclease BN [Rickettsia bellii OSU 85-389]
          Length = 281

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 137/273 (50%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +F+ +Y A+   +E DG   + ++S   LLS+FPF+VF   L  FLGA +     I +  
Sbjct: 4   IFNCLYIALFKTIEHDGVEHSGYMSFMVLLSIFPFLVFLLALTSFLGASELGQNFIQIFL 63

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
            + PE   + I   I ++L+VP + L  ++ + + + +S+ VE LR  LNR Y +     
Sbjct: 64  ESMPERATESIEKRIKELLSVPPQSLMNLAVVGSVWTASSFVECLRTILNRVYEIKSPPP 123

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           +   RL+S    L+ S+ +    F+ V IP+    +      +     I+   R    ++
Sbjct: 124 YIRRRLLSILQFLVISILITFTMFLLVFIPIVFTKIPVLLETIEQYKNILNFIRYVLILV 183

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            LF+G   ++  LP  K   + + PG + T I WV+   L + YIV ++  + MY  L S
Sbjct: 184 LLFLGASSLYYILPNVKLNFIDVFPGALLTVILWVISGYLLSTYIVYYNQLNLMYGSLGS 243

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  L+F Y++ + FI GAE N  M  Y   KK
Sbjct: 244 IIVTLIFFYIINMIFIYGAEFNYLMKNYNIVKK 276


>gi|254463994|ref|ZP_05077405.1| YihY family protein [Rhodobacterales bacterium Y4I]
 gi|206684902|gb|EDZ45384.1| YihY family protein [Rhodobacterales bacterium Y4I]
          Length = 288

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 88/263 (33%), Positives = 143/263 (54%), Gaps = 6/263 (2%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAG----FLGAHQFVPTVIDVVFGAW 70
           A   F  ++GW M+SHI++S +L++FPF++F   LAG     L     +  + + VF  W
Sbjct: 17  AARRFNRKNGWVMSSHIAMSMMLALFPFVLFTVALAGTVASLLSQEVEMDLMTEQVFSVW 76

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+ +A+PI  E+  VL      L T+  L A YF+SNGV+A+R+++ +AY   + R ++ 
Sbjct: 77  PDAVARPILTELKSVLQTSNTQLVTLGGLFALYFASNGVDAVRVAMVQAYHDTDTRPFWR 136

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            R +  G V++    ++ ++F  V +PL + ++ K  P   ++      G      LAL 
Sbjct: 137 ARALCIGLVIMGGAGILAVAFFEVFLPLYVRHITKLLP-FASVPQGWEQGLSGLLALALP 195

Query: 191 IGLIFV-HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           IG +   H+ LP    +   ILPG + T + W+  A  F  Y+ +F+ YS  YAGLA  M
Sbjct: 196 IGAVLAFHILLPGRIHRFRRILPGAVLTLLLWLACASGFAVYVGSFARYSATYAGLAGAM 255

Query: 250 TCLVFLYMLGVFFILGAELNASM 272
             ++FLY+     ILGAE N ++
Sbjct: 256 AAMIFLYLNSAILILGAEFNGAL 278


>gi|90418166|ref|ZP_01226078.1| putative ribonuclease, BN-like family [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337838|gb|EAS51489.1| putative ribonuclease, BN-like family [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 317

 Score =  132 bits (331), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 78/262 (29%), Positives = 143/262 (54%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           V+ ++ +AI     +D   +A +I+  A+L++FPF++F ++L  F+G  +    ++  + 
Sbjct: 36  VWAVLREAILRLWNDDAMGLAGNIAFRAVLAIFPFLIFASSLTAFIGNREMADGLVTFLI 95

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P  +A+P+  E++ ++ +   G+ ++  L   +F+  GV+ +R+ LNRAY + E RS
Sbjct: 96  AIVPPALAEPLVSEVMNIVTIRRGGVLSVGVLLTIWFAIGGVDGVRVGLNRAYDIRETRS 155

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
             +  L+    V+L  + LV++ ++ V  P A +++ +  P      +     R  AT  
Sbjct: 156 TIVLYLLQVLTVVLTGLVLVVVGYLLVLAPRAGSFLHQLMPGFQPSSVTPSLVRYPATAA 215

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            L   L   H+FLPA +S+  ++ PG++FT  +W      F+ YI  F+ Y++ YAGLA 
Sbjct: 216 ILTTALFVAHVFLPARRSRFSNMWPGILFTLCAWSALVAAFSVYIGQFANYASYYAGLAG 275

Query: 248 IMTCLVFLYMLGVFFILGAELN 269
           I+  L FLY+  +  I G ELN
Sbjct: 276 IIAALYFLYLAALVLIFGGELN 297


>gi|157825789|ref|YP_001493509.1| ribonuclease BN, putative [Rickettsia akari str. Hartford]
 gi|157799747|gb|ABV75001.1| Ribonuclease BN, putative [Rickettsia akari str. Hartford]
          Length = 275

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/265 (29%), Positives = 136/265 (51%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +F+ +Y A+   +E+DG   + ++S   L+S+FPF+VF   L  FLGA +     I +  
Sbjct: 4   IFNCLYVALFKTIEDDGVEHSGYMSFMILVSIFPFLVFLLALTSFLGASELGQNFIQIFL 63

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
            + PE   + I   I ++L+ P + L  ++ + + + +S+ VE LR  LNR Y++    +
Sbjct: 64  ESLPEQATESIEKRIRELLSAPPQSLMNLAIVGSIWTASSFVECLRTILNRVYQIKSPPT 123

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           +   RL+S    L+ S  +    F+ V IP+    +      +    +I+   R    ++
Sbjct: 124 YVRRRLLSIIQFLIISALITFTMFLLVVIPILFTKIPIILETIEKYKIILNFTRYSLILI 183

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            LF+G   ++  LP  K   + + PG + T I WV+   L + YIV ++  + MY  L S
Sbjct: 184 LLFLGASALYYILPNVKLNFIDVFPGALLTVILWVISGYLLSTYIVYYNQLNLMYGSLGS 243

Query: 248 IMTCLVFLYMLGVFFILGAELNASM 272
           I+  L+F Y++ + FI GAE N  M
Sbjct: 244 IIVTLIFFYIINMIFIYGAEFNYLM 268


>gi|67459119|ref|YP_246743.1| ribonuclease BN, putative [Rickettsia felis URRWXCal2]
 gi|67004652|gb|AAY61578.1| Ribonuclease BN, putative [Rickettsia felis URRWXCal2]
          Length = 275

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/265 (29%), Positives = 135/265 (50%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +F+ +Y A+   +E+DG   + ++S   LLS+FPF+VF   L  FLGA +     I +  
Sbjct: 4   IFNCLYVALFRTIEDDGVEHSGYMSFMILLSIFPFLVFLLALTSFLGASELGQNFIQIFL 63

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
            + PE   + I   I ++L+ P + L  ++ + + + +S+ VE LR  LNR Y++     
Sbjct: 64  ESLPEQATESIEKRIRELLSAPPQSLMNLAIVGSIWTASSFVECLRTILNRVYQIKSPPP 123

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           +   RL+S    L+ S  +    F+ V IP+    +      +    +I+   R    ++
Sbjct: 124 YIRRRLLSIIQFLIISALITFTMFLLVVIPILFTKIPIILETIEKYKIILNFIRYSLILI 183

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            LF+G   ++  LP  K   + + PG + T I WV+   L + YIV ++  + MY  L S
Sbjct: 184 LLFLGASSLYYILPNVKLNFIDVFPGALLTVILWVISGYLLSTYIVYYNQLNLMYGSLGS 243

Query: 248 IMTCLVFLYMLGVFFILGAELNASM 272
           I+  L+F Y++ + FI GAE N  M
Sbjct: 244 IIVTLIFFYIINMIFIYGAEFNYLM 268


>gi|304391893|ref|ZP_07373835.1| ribonuclease BN [Ahrensia sp. R2A130]
 gi|303296122|gb|EFL90480.1| ribonuclease BN [Ahrensia sp. R2A130]
          Length = 326

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 88/257 (34%), Positives = 146/257 (56%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPE 72
           +++I   V++ G A+AS+++LS LLS+FPF++  A+L  F G  +    V+D+V G WP 
Sbjct: 35  WESIVKLVDDGGLAIASNVALSLLLSLFPFLMLVASLVRFYGNPELAEGVVDLVLGHWPG 94

Query: 73  VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
             A PIT  +  +L  PA   F+   + A   +SNGVE  R  LNRAY+V E RS+   R
Sbjct: 95  DAAAPITRTVETLLDQPAGEFFSFGTVIALILASNGVENARDGLNRAYKVKETRSFLWRR 154

Query: 133 LISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIG 192
           L    +V++ +V  ++ +F+ VA P+   +    F  L    L++  G+    ++ L + 
Sbjct: 155 LQGAFFVVVGAVGFILSAFILVATPIVWDFAVSKFDFLEEFGLLVTAGKYSIAIVLLGLI 214

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
           L   H +LP  + +  SI+ G++ T  + ++G+ LF  Y+   + Y+ +YAGLA +M  +
Sbjct: 215 LFAFHRYLPDTRYRRRSIIWGILLTIGAILLGSYLFGIYLQNIANYTALYAGLAGMMVAI 274

Query: 253 VFLYMLGVFFILGAELN 269
           V+LY + V  + GAE N
Sbjct: 275 VYLYCMSVLMLFGAEFN 291


>gi|157803755|ref|YP_001492304.1| hypothetical protein A1E_02895 [Rickettsia canadensis str. McKiel]
 gi|157785018|gb|ABV73519.1| hypothetical protein A1E_02895 [Rickettsia canadensis str. McKiel]
          Length = 275

 Score =  129 bits (324), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 84/273 (30%), Positives = 140/273 (51%), Gaps = 16/273 (5%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +F  +Y A+   +E+DG   + ++S   LLS+FPF+VF   L  FLGA +     I +  
Sbjct: 4   IFHCLYVALFRTIEDDGVEHSGYMSFMILLSIFPFLVFLLALTSFLGASELGQNFIQIFL 63

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
            + PE   + I   I ++L+ P + L  ++ + + + +S+ VE LR  LNR Y++     
Sbjct: 64  ESLPEQATESIKKRIQELLSAPPQSLMNLAIVGSVWTASSFVECLRTILNRVYQIKSPPP 123

Query: 128 WYITRLISFGYVLLASVT-------LVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           +   RL+S    L+ S         LV++  +F+ IP+ L  + K+         II N 
Sbjct: 124 YIRRRLLSIIQFLIISAVITFTMFLLVVIPIIFMKIPIILETIEKY--------KIILNV 175

Query: 181 RIYATML-ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
             Y+ +L  LF+G   ++  LP  K   + + PG + T I W++   L + YIV ++  +
Sbjct: 176 IRYSLILILLFLGSSSLYYILPNVKLNFVDVFPGALLTVILWIISGYLLSTYIVYYNQLN 235

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
            MY  L SI+  L+F Y++ + FI GAE N  M
Sbjct: 236 LMYGSLGSIIVTLIFFYIINMIFIYGAEFNYLM 268


>gi|157964558|ref|YP_001499382.1| putative ribonuclease BN [Rickettsia massiliae MTU5]
 gi|157844334|gb|ABV84835.1| Putative ribonuclease BN [Rickettsia massiliae MTU5]
          Length = 288

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 77/265 (29%), Positives = 135/265 (50%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +F+ +Y A+   +E+DG   + ++S   LLS+FPF+VF   L  FLGA +     I +  
Sbjct: 17  IFNCLYVALFRTIEDDGVEHSGYMSFMILLSIFPFLVFLLALTSFLGASELGQNFIQIFL 76

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
            + PE   + I   I ++L+ P + L  ++ + + + +S+ VE LR  LNR Y++     
Sbjct: 77  ESLPEQATESIAKRIRELLSAPPQSLMNLAIVGSIWTASSFVECLRTILNRVYQIKSPPP 136

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           +   RL+S    L+ S  +    F+ V IP+    +      +    +I+   R    ++
Sbjct: 137 YIRRRLLSIIQFLIISALITFTMFLLVVIPILFTKIPIILETIEKYKIILNFIRYSLILI 196

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            LF+G   ++  LP  K   + + PG + T I W++   L + YI+ ++  + MY  L S
Sbjct: 197 LLFLGASSLYYILPNVKLNFIDVFPGALLTVILWIISGYLLSTYIIYYNQLNLMYGSLGS 256

Query: 248 IMTCLVFLYMLGVFFILGAELNASM 272
           I+  L+F Y++ + FI GAE N  M
Sbjct: 257 IIVTLIFFYIINMIFIYGAEFNYLM 281


>gi|292572111|gb|ADE30026.1| Putative ribonuclease BN [Rickettsia prowazekii Rp22]
          Length = 283

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 134/265 (50%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           + + +Y A+   +++DG   + ++S   LLS+FPF+VF   L  FLGA +     I +  
Sbjct: 4   ILNCLYVALFRTIKDDGVEHSGYMSFMILLSIFPFLVFLLALTSFLGASELGQNFIQIFL 63

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
            + PE   + I   I ++L+ P + L  ++ + + + +S+ VE LR  LNR Y++     
Sbjct: 64  ESLPEQATESIEKRIRELLSAPPQSLMNLAIIGSIWTASSFVECLRTILNRVYQIKSPPP 123

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           +   RL+S    L+ S  +    F+ V IP+    +      +    +I+   R    ++
Sbjct: 124 YIRRRLLSIIQFLIISALITFTMFLLVVIPIIFTKIPIILETIEQYKIILNFIRYSLILI 183

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            LF+G   ++  LP  K   + + PG + T + W++   L + YIV ++  + MY  L S
Sbjct: 184 LLFLGASSLYYILPNVKLNFVDVFPGAVLTVVLWIISGYLLSTYIVYYNQLNLMYGSLGS 243

Query: 248 IMTCLVFLYMLGVFFILGAELNASM 272
           I+  L+F Y++ + FI GAE N  M
Sbjct: 244 IIVTLIFFYIINMIFIYGAEFNYLM 268


>gi|51473680|ref|YP_067437.1| hypothetical protein RT0483 [Rickettsia typhi str. Wilmington]
 gi|51459992|gb|AAU03955.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 281

 Score =  125 bits (314), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 134/265 (50%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           + + +Y A+   +++DG   + ++S   LLS+FPF+VF   L  FLGA +     I +  
Sbjct: 6   ILNCLYVALFRTIKDDGVEHSGYMSFMILLSIFPFLVFLLALTSFLGASELGQNFIQIFL 65

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
            + PE   + I   I ++L+ P + L  ++ + + + +S+ VE LR  LNR Y++     
Sbjct: 66  ESLPEQATESIEKRIRELLSAPPQSLMNLAIIGSIWTASSFVECLRTILNRVYQIKSPPP 125

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           +   RL+S    L+ S  +    F+ V IP+    +      +    +I+   R    ++
Sbjct: 126 YIRRRLLSIIQFLIISALITFTMFLLVVIPIIFTKIPIILETIEQYKIILNFIRYSLILI 185

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            LF+G   ++  LP  K   + + PG + T + W++   L + YIV ++  + MY  L S
Sbjct: 186 LLFLGASSLYYILPNVKLNFVDVFPGAVLTVVLWIISGYLLSTYIVYYNQLNLMYGSLGS 245

Query: 248 IMTCLVFLYMLGVFFILGAELNASM 272
           I+  L+F Y++ + FI GAE N  M
Sbjct: 246 IIVTLIFFYIINMIFIYGAEFNYLM 270


>gi|15604356|ref|NP_220872.1| hypothetical protein RP496 [Rickettsia prowazekii str. Madrid E]
 gi|3861048|emb|CAA14948.1| unknown [Rickettsia prowazekii]
          Length = 285

 Score =  125 bits (314), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 134/265 (50%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           + + +Y A+   +++DG   + ++S   LLS+FPF+VF   L  FLGA +     I +  
Sbjct: 6   ILNCLYVALFRTIKDDGVEHSGYMSFMILLSIFPFLVFLLALTSFLGASELGQNFIQIFL 65

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
            + PE   + I   I ++L+ P + L  ++ + + + +S+ VE LR  LNR Y++     
Sbjct: 66  ESLPEQATESIEKRIRELLSAPPQSLMNLAIIGSIWTASSFVECLRTILNRVYQIKSPPP 125

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           +   RL+S    L+ S  +    F+ V IP+    +      +    +I+   R    ++
Sbjct: 126 YIRRRLLSIIQFLIISALITFTMFLLVVIPIIFTKIPIILETIEQYKIILNFIRYSLILI 185

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            LF+G   ++  LP  K   + + PG + T + W++   L + YIV ++  + MY  L S
Sbjct: 186 LLFLGASSLYYILPNVKLNFVDVFPGAVLTVVLWIISGYLLSTYIVYYNQLNLMYGSLGS 245

Query: 248 IMTCLVFLYMLGVFFILGAELNASM 272
           I+  L+F Y++ + FI GAE N  M
Sbjct: 246 IIVTLIFFYIINMIFIYGAEFNYLM 270


>gi|229586760|ref|YP_002845261.1| Putative ribonuclease BN [Rickettsia africae ESF-5]
 gi|228021810|gb|ACP53518.1| Putative ribonuclease BN [Rickettsia africae ESF-5]
          Length = 275

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/265 (29%), Positives = 136/265 (51%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +F+ +Y A+   +E+DG   + ++S   LLS+FPF+VF   L  FLGA +     I +  
Sbjct: 4   IFNCLYVALFRTIEDDGIEHSGYMSFMILLSIFPFLVFLLALTSFLGASELGQNFIQIFL 63

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
            + PE   + I   I ++L+ P + L  ++ + + + +S+ VE LR  LNR Y++     
Sbjct: 64  ESLPEQATESIEKRIRELLSAPPQSLMNLAIVGSIWTASSFVECLRTILNRVYQIKSPPP 123

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           +   RL+S    L+ S  +    F+ V IP+    +      +    +I+   R +  ++
Sbjct: 124 YIRRRLLSIIQFLIISALITFTMFLLVVIPILFTKIPIILETIEKYKIILNFIRYFLILI 183

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            LF+G   ++  LP  K   + + PG + T I W++   L + YIV ++  + MY  L S
Sbjct: 184 LLFLGASSLYYILPNVKLNFIDVFPGALLTVILWIISGYLLSTYIVYYNQLNLMYGSLGS 243

Query: 248 IMTCLVFLYMLGVFFILGAELNASM 272
           I+  L+F Y++ + FI GAE N  M
Sbjct: 244 IIVTLIFFYIINMIFIYGAEFNYLM 268


>gi|15892593|ref|NP_360307.1| hypothetical protein RC0670 [Rickettsia conorii str. Malish 7]
 gi|238650246|ref|YP_002916097.1| ribonuclease BN, putative [Rickettsia peacockii str. Rustic]
 gi|15619759|gb|AAL03208.1| unknown [Rickettsia conorii str. Malish 7]
 gi|238624344|gb|ACR47050.1| ribonuclease BN, putative [Rickettsia peacockii str. Rustic]
          Length = 275

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/265 (29%), Positives = 136/265 (51%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +F+ +Y A+   +E+DG   + ++S   LLS+FPF+VF   L  FLGA +     I +  
Sbjct: 4   IFNCLYVALFRTIEDDGVEHSGYMSFMILLSIFPFLVFLLALTSFLGASELGQNFIQIFL 63

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
            + PE   + I   I ++L+ P + L  ++ + + + +S+ VE LR  LNR Y++     
Sbjct: 64  ESLPEQATESIEKRIRELLSAPPQSLMNLAIVGSIWTASSFVECLRTILNRVYQIKSPPP 123

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           +   RL+S    L+ S  +    F+ V IP+    +      +    +I+   R +  ++
Sbjct: 124 YIRRRLLSIIQFLIISALITFTMFLLVVIPILFTKIPIILETIEKYKIILNFIRYFLILI 183

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            LF+G   ++  LP  K   + + PG + T I W++   L + YIV ++  + MY  L S
Sbjct: 184 LLFLGASSLYYILPNVKLNFIDVFPGALLTVILWIISGYLLSTYIVYYNQLNLMYGSLGS 243

Query: 248 IMTCLVFLYMLGVFFILGAELNASM 272
           I+  L+F Y++ + FI GAE N  M
Sbjct: 244 IIVTLIFFYIINMIFIYGAEFNYLM 268


>gi|34580425|ref|ZP_00141905.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28261810|gb|EAA25314.1| unknown [Rickettsia sibirica 246]
          Length = 275

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/265 (29%), Positives = 136/265 (51%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +F+ +Y A+   +E+DG   + ++S   LLS+FPF+VF   L  FLGA +     I +  
Sbjct: 4   IFNCLYVALFRTIEDDGVEHSGYMSFMILLSIFPFLVFLLALTSFLGASELGQNFIQIFL 63

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
            + PE   + I   I ++L+ P + L  ++ + + + +S+ VE LR  LNR Y++     
Sbjct: 64  ESLPEQATESIEKRIRELLSAPPQSLMNLAIVGSIWTASSFVECLRTILNRVYQIKSPPP 123

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           +   RL+S    L+ S  +    F+ V IP+    +      +    +I+   R +  ++
Sbjct: 124 YIRRRLLSIIQFLIISALITFTMFLLVVIPILFTKIPIILETIEKYKIILNFIRYFLILI 183

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            LF+G   ++  LP  K   + + PG + T I W++   L + YIV ++  + MY  L S
Sbjct: 184 LLFLGASSLYYILPNVKLNFIDVFPGALLTVILWIISGYLLSTYIVYYNQLNLMYGSLGS 243

Query: 248 IMTCLVFLYMLGVFFILGAELNASM 272
           I+  L+F Y++ + FI GAE N  M
Sbjct: 244 IIVTLIFFYIINMIFIYGAEFNYLM 268


>gi|157828543|ref|YP_001494785.1| hypothetical protein A1G_03800 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933259|ref|YP_001650048.1| ribonuclease BN [Rickettsia rickettsii str. Iowa]
 gi|157801024|gb|ABV76277.1| hypothetical protein A1G_03800 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908346|gb|ABY72642.1| ribonuclease BN [Rickettsia rickettsii str. Iowa]
          Length = 275

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 77/263 (29%), Positives = 134/263 (50%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +Y A+   +E+DG   + ++S   LLS+FPF+VF   L  FLGA +     I +   +
Sbjct: 6   NCLYVALFRTIEDDGVEHSGYMSFMILLSIFPFLVFLLALTSFLGASELGQNFIQIFLES 65

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            PE   + I   I ++L+ P + L  ++ + + + +S+ VE LR  LNR Y++     + 
Sbjct: 66  LPEQAMESIEKRIRELLSAPPQSLMNLAIVGSIWTASSFVECLRTILNRVYQIKSPPPYI 125

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
             RL+S    L+ S  +    F+ V IP+    +      +    +I+   R +  ++ L
Sbjct: 126 RRRLLSIIQFLIISALITFTMFLLVVIPILFTKIPIILETIEKYKIILNFIRYFLILILL 185

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           F+G   ++  LP  K   + + PG + T I W++   L + YIV ++  + MY  L SI+
Sbjct: 186 FLGASSLYYILPNVKLNFIDVFPGALLTVILWIISGYLLSTYIVYYNQLNLMYGSLGSII 245

Query: 250 TCLVFLYMLGVFFILGAELNASM 272
             L+F Y++ + FI GAE N  M
Sbjct: 246 VTLIFFYIINMIFIYGAEFNYLM 268


>gi|300021750|ref|YP_003754361.1| ribonuclease BN [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523571|gb|ADJ22040.1| ribonuclease BN [Hyphomicrobium denitrificans ATCC 51888]
          Length = 294

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 80/270 (29%), Positives = 140/270 (51%), Gaps = 19/270 (7%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
           +++AI    E  G+AMA  ++ S ++S+FPF +F   L+G  G  +     I+ +F   P
Sbjct: 7   LFEAIYRLYEHSGFAMAGAVAFSFVVSIFPFCIFLGALSGVFGGRELAQDAINQLFAILP 66

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
           E +AK I  EI  V+      L T S   A +F+++ +E LR +LN AYRV E R + + 
Sbjct: 67  EPVAKGIAPEIEAVMGSRRIDLLTASGFLALFFATSAIETLRAALNGAYRVHEKRPYPLC 126

Query: 132 RLISFGYVLLASVTLVIMSFVF----------VAIPLALAYVRKFFP--ALGNLLLIIWN 179
            LIS  +V +++++ +++++            +A      +V++ F   ALG  +     
Sbjct: 127 LLISMLFVFVSAISTLVLTWAVVVGPSVVGPAIASQFESEWVKRLFDSTALGPGVRYGLA 186

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
           G + A  L        +HL+L A + ++  + PGV+ + + W+  A L++ Y+   + YS
Sbjct: 187 GAVIAAQLCA------LHLWLAAGRRRLADVWPGVLLSIVLWLALAGLWSRYL-AITNYS 239

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELN 269
             YAGL+ +M  L+F     +  +LGAE N
Sbjct: 240 LFYAGLSQLMIALIFFQFTAITILLGAEFN 269


>gi|68171918|ref|ZP_00545237.1| Ribonuclease BN [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658113|ref|YP_507343.1| YihY family protein [Ehrlichia chaffeensis str. Arkansas]
 gi|67998663|gb|EAM85396.1| Ribonuclease BN [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599570|gb|ABD45039.1| YihY family protein [Ehrlichia chaffeensis str. Arkansas]
          Length = 274

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/275 (29%), Positives = 138/275 (50%), Gaps = 16/275 (5%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVF----GANLAGFLGAH 56
           ++E    +   IY A+   +  DG   A ++S   LLS+FPF+VF     +N+A  L  +
Sbjct: 2   LKEKIKCLLKCIYYAMVDMIRHDGIEHAGYLSFIILLSIFPFLVFFMALVSNVAQLLNHY 61

Query: 57  QFV--PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRI 114
                  +I ++    P  +   +   I ++++ P   L T++ +   + +S+ VE +R 
Sbjct: 62  DISINDKLIILINDNIPHEVISGLMPRIQEIISGPPHSLLTLAVIGTIWTASSAVEGIRT 121

Query: 115 SLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL 174
            LN+A RV    S+   RL+S    L+ ++T++I     + +P+    + K    LG L 
Sbjct: 122 ILNKACRVSSPPSYIFRRLLSIFQFLVITLTIIIAMVCIILLPVIYEMLNK---DLGYL- 177

Query: 175 LIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVT 234
                 +   + L LFI +  ++  +P  K  +M ++PG I   + W   + +FT YI T
Sbjct: 178 ------KYTVSELVLFISITLLYFIVPNIKQSLMDVIPGAILVTLLWTCSSFVFTWYIKT 231

Query: 235 FSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
           F   + +Y  LASI+  L+F Y+L +FFI GAELN
Sbjct: 232 FHQLNIIYGSLASIIASLLFFYILSIFFIYGAELN 266


>gi|315282669|ref|ZP_07871025.1| transport protein [Listeria marthii FSL S4-120]
 gi|313613685|gb|EFR87473.1| transport protein [Listeria marthii FSL S4-120]
          Length = 289

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 78/265 (29%), Positives = 135/265 (50%), Gaps = 13/265 (4%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
             D    A+ ++   L S+FP ++  A L  +L  H    +V +++    P+ I   + D
Sbjct: 27  RNDVSGNAAQLAYYMLFSIFPMLLIAATLLAYL--HIDKDSVFNMIKEFAPDQIMDFLED 84

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS--FGY 138
            +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R++ + RL+S  F  
Sbjct: 85  NLNTLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRNYVVQRLLSMFFTL 144

Query: 139 VLLASVTLVIMSFVF-VAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLIFV 196
            +LA+V   ++  VF   I + L     F        L  WN  R   T++ +F+   F+
Sbjct: 145 AMLATVGATLLLLVFGQQIGMFLINHLNFSEDF----LSFWNNLRWTVTLVVIFVVFTFL 200

Query: 197 HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
           +   P  +S ++S+LPG +F+ I W V +V F +Y+  F  YS  Y  +  I+  +++ Y
Sbjct: 201 YWVAPNRRSTLISVLPGALFSTIGWTVASVGFAYYVNNFGNYSATYGSIGVIIILMLWFY 260

Query: 257 MLGVFFILGAELNASMIIYYWRKKP 281
           + G+  ++G ELNA++ I   RKK 
Sbjct: 261 LTGIILMIGGELNATLAI---RKKK 282


>gi|313632903|gb|EFR99846.1| transport protein [Listeria seeligeri FSL N1-067]
 gi|313637503|gb|EFS02939.1| transport protein [Listeria seeligeri FSL S4-171]
          Length = 289

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 76/264 (28%), Positives = 137/264 (51%), Gaps = 10/264 (3%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           + D    A+ ++   L S+FP ++  A L  ++  H    +V +++    PE I   + +
Sbjct: 27  QNDVSGNAAQLAYYMLFSIFPMMLIAATLLAYM--HIDKDSVFNMLKEFAPEQILDFLEE 84

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS--FGY 138
            +  +L     GL +I  +A  + +SNG+ A+  +LN+AY V   R++ + RL+S  F  
Sbjct: 85  NLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKALNKAYGVTNKRNYVVQRLLSMLFTL 144

Query: 139 VLLASVTLVIMSFVF-VAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLIFV 196
            +LA+V   ++  VF   I L L     F        L  WN  R   T++ +F+   F+
Sbjct: 145 AMLATVGATLLLIVFGQQIGLFLINHLNFSEDF----LSFWNNLRWTVTLIVIFVVFTFL 200

Query: 197 HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
           +   P  +S ++S+LPG IF+ I W V +V F +Y+  F+ YS  Y  +  I+  +++ Y
Sbjct: 201 YWVAPNRRSTLISVLPGAIFSTIGWTVASVGFAYYVNNFANYSATYGSIGVIIILMLWFY 260

Query: 257 MLGVFFILGAELNASMIIYYWRKK 280
           + G+  ++G ELNA++ I   +K+
Sbjct: 261 LTGIILMVGGELNATLAIRKKKKQ 284


>gi|289435039|ref|YP_003464911.1| hypothetical protein lse_1674 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289171283|emb|CBH27825.1| conserved hypothetical protein [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
          Length = 289

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 76/264 (28%), Positives = 137/264 (51%), Gaps = 10/264 (3%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           + D    A+ ++   L S+FP ++  A L  ++  H    +V +++    PE I   + +
Sbjct: 27  QNDVSGNAAQLAYYMLFSIFPMMLIAATLLAYM--HIDKDSVFNMLKEFAPEQILDFLEE 84

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS--FGY 138
            +  +L     GL +I  +A  + +SNG+ A+  +LN+AY V   R++ + RL+S  F  
Sbjct: 85  NLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKALNKAYGVTNKRNYVVQRLLSMFFTL 144

Query: 139 VLLASVTLVIMSFVF-VAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLIFV 196
            +LA+V   ++  VF   I L L     F        L  WN  R   T++ +F+   F+
Sbjct: 145 AMLATVGATLLLIVFGQQIGLFLINHLNFSEDF----LSFWNNLRWTVTLIVIFVVFTFL 200

Query: 197 HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
           +   P  +S ++S+LPG IF+ I W V +V F +Y+  F+ YS  Y  +  I+  +++ Y
Sbjct: 201 YWVAPNRRSTLISVLPGAIFSTIGWTVASVGFAYYVNNFANYSATYGSIGVIIILMLWFY 260

Query: 257 MLGVFFILGAELNASMIIYYWRKK 280
           + G+  ++G ELNA++ I   +K+
Sbjct: 261 LTGIILMVGGELNATLAIRKKKKQ 284


>gi|313623420|gb|EFR93635.1| transport protein [Listeria innocua FSL J1-023]
          Length = 289

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 77/265 (29%), Positives = 135/265 (50%), Gaps = 13/265 (4%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
             D    A+ ++   L S+FP ++  A L  +L  H    +V +++    P+ I   + +
Sbjct: 27  RNDVSGNAAQLAYYMLFSIFPMLLIAATLLAYL--HIDKDSVFNMIKEFAPDQIMDFLEE 84

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS--FGY 138
            +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R++ + RL+S  F  
Sbjct: 85  NLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRNYVVQRLLSMFFTL 144

Query: 139 VLLASVTLVIMSFVF-VAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLIFV 196
            +LA+V   ++  VF   I + L     F        L  WN  R   T++ +F+   F+
Sbjct: 145 AMLATVGATLLLLVFGQQIGMFLINHLNFSEDF----LSFWNNLRWTVTLIVIFVVFTFL 200

Query: 197 HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
           +   P  +S ++S+LPG +F+ I W V +V F +Y+  F  YS  Y  +  I+  +++ Y
Sbjct: 201 YWVAPNRRSTLISVLPGALFSTIGWTVASVGFAYYVNNFGNYSATYGSIGVIIILMLWFY 260

Query: 257 MLGVFFILGAELNASMIIYYWRKKP 281
           + G+  ++G ELNA++ I   RKK 
Sbjct: 261 LTGIILMIGGELNATLAI---RKKK 282


>gi|315303543|ref|ZP_07874107.1| transporter [Listeria ivanovii FSL F6-596]
 gi|313628085|gb|EFR96654.1| transporter [Listeria ivanovii FSL F6-596]
          Length = 289

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 77/265 (29%), Positives = 137/265 (51%), Gaps = 13/265 (4%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           + D    A+ ++   L S+FP ++  A L  ++  H    +V +++    PE I   + +
Sbjct: 27  QNDVSGNAAQLAYYMLFSIFPMMLIAATLLAYM--HIDKDSVFNMLKEFAPEQILDFLEE 84

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS--FGY 138
            +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R++ + RL+S  F  
Sbjct: 85  NLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRNYVMQRLLSMLFTL 144

Query: 139 VLLASVTLVIMSFVF-VAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLIFV 196
            +LA+V   ++  VF   I L L     F        L  WN  R   T++ +F+   F+
Sbjct: 145 AMLATVGATLLLIVFGQQIGLFLINHLNFSEDF----LDFWNNLRWTVTLIVIFVVFTFL 200

Query: 197 HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
           +   P  +S ++S+LPG IF+ + W + +V F +Y+  F+ YS  Y  +  I+  +++ Y
Sbjct: 201 YWVAPNRRSTLISVLPGAIFSTVGWTIASVGFAYYVNNFANYSATYGSIGVIIILMLWFY 260

Query: 257 MLGVFFILGAELNASMIIYYWRKKP 281
           + G+  ++G ELNA++ I   RKK 
Sbjct: 261 LTGIILMVGGELNATLAI---RKKK 282


>gi|16803746|ref|NP_465231.1| hypothetical protein lmo1706 [Listeria monocytogenes EGD-e]
 gi|224499572|ref|ZP_03667921.1| hypothetical protein LmonF1_07697 [Listeria monocytogenes Finland
           1988]
 gi|224503369|ref|ZP_03671676.1| hypothetical protein LmonFR_12785 [Listeria monocytogenes FSL
           R2-561]
 gi|255028332|ref|ZP_05300283.1| hypothetical protein LmonL_02181 [Listeria monocytogenes LO28]
 gi|16411160|emb|CAC99784.1| lmo1706 [Listeria monocytogenes EGD-e]
          Length = 289

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 77/265 (29%), Positives = 135/265 (50%), Gaps = 13/265 (4%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
             D    A+ ++   L S+FP ++  A L  +L  H    +V +++    P+ I   + +
Sbjct: 27  RNDVSGNAAQLAYYMLFSIFPMLLIAATLLAYL--HIDKDSVFNMIKEFAPDQIMDFLEE 84

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS--FGY 138
            +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R++ + RL+S  F  
Sbjct: 85  NLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRNYVVQRLLSMFFTL 144

Query: 139 VLLASVTLVIMSFVF-VAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLIFV 196
            +LA+V   ++  VF   I + L     F        L  WN  R   T++ +F+   F+
Sbjct: 145 AMLATVGATLLLLVFGQQIGMFLINHLNFSEDF----LSFWNNLRWTVTLIVIFVVFTFL 200

Query: 197 HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
           +   P  +S ++S+LPG +F+ I W V +V F +Y+  F  YS  Y  +  I+  +++ Y
Sbjct: 201 YWVAPNRRSTLISVLPGALFSTIGWTVASVGFAYYVNNFGNYSATYGSIGVIIILMLWFY 260

Query: 257 MLGVFFILGAELNASMIIYYWRKKP 281
           + G+  ++G ELNA++ I   RKK 
Sbjct: 261 LTGIILMIGGELNATLAI---RKKK 282


>gi|58617238|ref|YP_196437.1| hypothetical protein ERGA_CDS_05110 [Ehrlichia ruminantium str.
           Gardel]
 gi|58416850|emb|CAI27963.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Gardel]
          Length = 277

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 133/270 (49%), Gaps = 20/270 (7%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVF----GANLAGFLGAHQFVPTVI 63
           +F   Y A+   +E DG   A ++S   LLSVFPF+VF     +NLA  L  H +  +V 
Sbjct: 9   IFKCSYYAVVDMIEHDGIEHAGYLSFVILLSVFPFLVFFMALMSNLAQLL--HYYDISVS 66

Query: 64  D----VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
           D    ++    P  +   +   I ++++ P   L T++ +   + +S+ VE +R  LN+A
Sbjct: 67  DKLIILITDNIPSEVISGLMPRIQEIISGPPHSLLTLAVIGTIWTASSAVEGIRTILNKA 126

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
            RV    S+   RL+S    +  ++ + I     + +P+    + K    LG        
Sbjct: 127 CRVSSPPSYIFRRLLSIFQFISITLAMTIAMICIIVLPVIYEMLNK---NLGYF------ 177

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
            +   + L LF+ +  ++  +P  K  + +++PG +     W   +++FT Y+ TF   +
Sbjct: 178 -KYAVSELVLFVSITLLYFIIPNVKQNLANVIPGAVLVTFLWTCSSLIFTWYLKTFHQLN 236

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELN 269
            +Y  LASI+  L+F Y+L +FFI GAE N
Sbjct: 237 IIYGSLASIIASLLFFYILSIFFIYGAEFN 266


>gi|313608345|gb|EFR84318.1| transport protein [Listeria monocytogenes FSL F2-208]
          Length = 289

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 76/265 (28%), Positives = 136/265 (51%), Gaps = 13/265 (4%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           + D    A+ ++   L S+FP ++  A L  +L  H    +V +++    P+ I   + +
Sbjct: 27  KNDVSGNAAQLAYYMLFSIFPMLLIAATLLAYL--HIDKDSVFNMIKEFAPDQIMDFLEE 84

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS--FGY 138
            +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R++ + RL+S  F  
Sbjct: 85  NLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRNYVVQRLLSMFFTL 144

Query: 139 VLLASVTLVIMSFVF-VAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLIFV 196
            +LA+V   ++  VF   I + L     F        L  WN  R   T++ +F+   F+
Sbjct: 145 AMLATVGATLLLLVFGQQIGMFLINHLNFSEDF----LSFWNNLRWTVTLIVIFVVFTFL 200

Query: 197 HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
           +   P  +S ++S+LPG +F+ I W V ++ F +Y+  F  YS  Y  +  I+  +++ Y
Sbjct: 201 YWVAPNRRSTLISVLPGALFSTIGWTVASLGFAYYVNNFGNYSATYGSIGVIIILMLWFY 260

Query: 257 MLGVFFILGAELNASMIIYYWRKKP 281
           + G+  ++G ELNA++ I   RKK 
Sbjct: 261 LTGIILMIGGELNATLAI---RKKK 282


>gi|290893364|ref|ZP_06556349.1| YihY family protein [Listeria monocytogenes FSL J2-071]
 gi|290557015|gb|EFD90544.1| YihY family protein [Listeria monocytogenes FSL J2-071]
          Length = 308

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 76/265 (28%), Positives = 135/265 (50%), Gaps = 13/265 (4%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
             D    A+ ++   L S+FP ++  A L  +L  H    +V +++    P+ I   + +
Sbjct: 27  RNDVSGNAAQLAYYMLFSIFPMLLIAATLLAYL--HIDKDSVFNMIKEFAPDQIMDFLEE 84

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS--FGY 138
            +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R++ + RL+S  F  
Sbjct: 85  NLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRNYVVQRLLSMFFTL 144

Query: 139 VLLASVTLVIMSFVF-VAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLIFV 196
            +LA+V   ++  VF   I + L     F        L  WN  R   T++ +F+   F+
Sbjct: 145 AMLATVGATLLLLVFGQQIGMFLINHLNFSEDF----LSFWNNLRWTVTLIVIFVVFTFL 200

Query: 197 HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
           +   P  +S ++S+LPG +F+ I W V ++ F +Y+  F  YS  Y  +  I+  +++ Y
Sbjct: 201 YWVAPNRRSTLISVLPGALFSTIGWTVASLGFAYYVNNFGNYSATYGSIGVIIILMLWFY 260

Query: 257 MLGVFFILGAELNASMIIYYWRKKP 281
           + G+  ++G ELNA++ I   RKK 
Sbjct: 261 LTGIILMIGGELNATLAI---RKKK 282


>gi|57239224|ref|YP_180360.1| hypothetical protein Erum4970 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161303|emb|CAH58226.1| putative tRNA processing ribonuclease BN [Ehrlichia ruminantium
           str. Welgevonden]
          Length = 277

 Score =  108 bits (271), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 133/270 (49%), Gaps = 20/270 (7%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVF----GANLAGFLGAHQFVPTVI 63
           +F   Y A+   +E DG   A ++S   LLSVFPF+VF     +NLA  L  H +  +V 
Sbjct: 9   IFKCSYYAVVDMIEHDGIEHAGYLSFVILLSVFPFLVFFMALMSNLAQLL--HYYDISVS 66

Query: 64  D----VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
           D    ++    P  +   +   I ++++ P   L T++ +   + +S+ VE +R  LN+A
Sbjct: 67  DKLIILITDNIPSEVISGLMPRIQEIISGPPHSLLTLAVIGTIWTASSAVEGIRTILNKA 126

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
            RV    S+   RL+S    +  ++ + I     + +P+    + K    LG        
Sbjct: 127 CRVSSPPSYIFRRLLSIFQFISITLAMTIAMICIIVLPVIYEMLNK---NLGYF------ 177

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
            +   + L LF+ +  ++  +P  K  + +++PG +     W   +++FT Y+ TF   +
Sbjct: 178 -KYAVSELVLFVSITLLYFIIPNVKQNLANVVPGAVLVTFLWTCSSLIFTWYLKTFHQLN 236

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELN 269
            +Y  LASI+  L+F Y+L +FFI GAE N
Sbjct: 237 IIYGSLASIIASLLFFYILSIFFIYGAEFN 266


>gi|46907937|ref|YP_014326.1| ribonuclease BN [Listeria monocytogenes serotype 4b str. F2365]
 gi|47094251|ref|ZP_00231961.1| ribonuclease BN, putative [Listeria monocytogenes str. 4b H7858]
 gi|217964144|ref|YP_002349822.1| transporter [Listeria monocytogenes HCC23]
 gi|226224309|ref|YP_002758416.1| transport protein [Listeria monocytogenes Clip81459]
 gi|254826046|ref|ZP_05231047.1| YihY family protein [Listeria monocytogenes FSL J1-194]
 gi|254853622|ref|ZP_05242970.1| YihY family protein [Listeria monocytogenes FSL R2-503]
 gi|254932848|ref|ZP_05266207.1| YihY family protein [Listeria monocytogenes HPB2262]
 gi|255520201|ref|ZP_05387438.1| transport protein [Listeria monocytogenes FSL J1-175]
 gi|300764677|ref|ZP_07074668.1| ribonuclease BN [Listeria monocytogenes FSL N1-017]
 gi|46881206|gb|AAT04503.1| YihY family protein [Listeria monocytogenes serotype 4b str. F2365]
 gi|47017379|gb|EAL08202.1| ribonuclease BN, putative [Listeria monocytogenes str. 4b H7858]
 gi|217333414|gb|ACK39208.1| transporter [Listeria monocytogenes HCC23]
 gi|225876771|emb|CAS05480.1| Putative transport protein [Listeria monocytogenes serotype 4b str.
           CLIP 80459]
 gi|258606997|gb|EEW19605.1| YihY family protein [Listeria monocytogenes FSL R2-503]
 gi|293584402|gb|EFF96434.1| YihY family protein [Listeria monocytogenes HPB2262]
 gi|293595286|gb|EFG03047.1| YihY family protein [Listeria monocytogenes FSL J1-194]
 gi|300514563|gb|EFK41619.1| ribonuclease BN [Listeria monocytogenes FSL N1-017]
 gi|307571289|emb|CAR84468.1| ribonuclease BN, putative [Listeria monocytogenes L99]
 gi|328466464|gb|EGF37607.1| transport protein [Listeria monocytogenes 1816]
 gi|332312148|gb|EGJ25243.1| Transporter [Listeria monocytogenes str. Scott A]
          Length = 289

 Score =  108 bits (271), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 76/265 (28%), Positives = 135/265 (50%), Gaps = 13/265 (4%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
             D    A+ ++   L S+FP ++  A L  +L  H    +V +++    P+ I   + +
Sbjct: 27  RNDVSGNAAQLAYYMLFSIFPMLLIAATLLAYL--HIDKDSVFNMIKEFAPDQIMDFLEE 84

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS--FGY 138
            +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R++ + RL+S  F  
Sbjct: 85  NLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRNYVVQRLLSMFFTL 144

Query: 139 VLLASVTLVIMSFVF-VAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLIFV 196
            +LA+V   ++  VF   I + L     F        L  WN  R   T++ +F+   F+
Sbjct: 145 AMLATVGATLLLLVFGQQIGMFLINHLNFSEDF----LSFWNNLRWTVTLIVIFVVFTFL 200

Query: 197 HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
           +   P  +S ++S+LPG +F+ I W V ++ F +Y+  F  YS  Y  +  I+  +++ Y
Sbjct: 201 YWVAPNRRSTLISVLPGALFSTIGWTVASLGFAYYVNNFGNYSATYGSIGVIIILMLWFY 260

Query: 257 MLGVFFILGAELNASMIIYYWRKKP 281
           + G+  ++G ELNA++ I   RKK 
Sbjct: 261 LTGIILMIGGELNATLAI---RKKK 282


>gi|47097606|ref|ZP_00235132.1| ribonuclease BN, putative [Listeria monocytogenes str. 1/2a F6854]
 gi|254829230|ref|ZP_05233917.1| YihY family protein [Listeria monocytogenes FSL N3-165]
 gi|254832411|ref|ZP_05237066.1| hypothetical protein Lmon1_13734 [Listeria monocytogenes 10403S]
 gi|254900789|ref|ZP_05260713.1| hypothetical protein LmonJ_13274 [Listeria monocytogenes J0161]
 gi|254913725|ref|ZP_05263737.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254938112|ref|ZP_05269809.1| YihY family protein [Listeria monocytogenes F6900]
 gi|284802152|ref|YP_003414017.1| hypothetical protein LM5578_1907 [Listeria monocytogenes 08-5578]
 gi|284995294|ref|YP_003417062.1| hypothetical protein LM5923_1859 [Listeria monocytogenes 08-5923]
 gi|47014019|gb|EAL05026.1| ribonuclease BN, putative [Listeria monocytogenes str. 1/2a F6854]
 gi|258601641|gb|EEW14966.1| YihY family protein [Listeria monocytogenes FSL N3-165]
 gi|258610724|gb|EEW23332.1| YihY family protein [Listeria monocytogenes F6900]
 gi|284057714|gb|ADB68655.1| hypothetical protein LM5578_1907 [Listeria monocytogenes 08-5578]
 gi|284060761|gb|ADB71700.1| hypothetical protein LM5923_1859 [Listeria monocytogenes 08-5923]
 gi|293591740|gb|EFG00075.1| conserved hypothetical protein [Listeria monocytogenes J2818]
          Length = 289

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 76/265 (28%), Positives = 135/265 (50%), Gaps = 13/265 (4%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
             D    A+ ++   L S+FP ++  A L  +L  H    +V +++    P+ I   + +
Sbjct: 27  RNDVSGNAAQLAYYMLFSIFPMLLIAATLLAYL--HIDKDSVFNMIKEFAPDQIMDFLEE 84

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS--FGY 138
            +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R++ + RL+S  F  
Sbjct: 85  NLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRNYVVQRLLSMFFTL 144

Query: 139 VLLASVTLVIMSFVF-VAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLIFV 196
            +LA+V   ++  VF   I + L     F        L  WN  R   T++ +F+   F+
Sbjct: 145 AMLATVGATLLLLVFGQQIGMFLINHLNFSEDF----LSFWNNLRWTVTLIVIFVVFTFL 200

Query: 197 HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
           +   P  +S ++S+LPG +F+ I W V ++ F +Y+  F  YS  Y  +  I+  +++ Y
Sbjct: 201 YWVAPNRRSTLISVLPGALFSTIGWTVASLGFAYYVNNFGNYSATYGSIGVIIILMLWFY 260

Query: 257 MLGVFFILGAELNASMIIYYWRKKP 281
           + G+  ++G ELNA++ I   RKK 
Sbjct: 261 LTGIILMIGGELNATLAI---RKKK 282


>gi|16800885|ref|NP_471153.1| hypothetical protein lin1818 [Listeria innocua Clip11262]
 gi|16414320|emb|CAC97049.1| lin1818 [Listeria innocua Clip11262]
 gi|313618455|gb|EFR90462.1| transport protein [Listeria innocua FSL S4-378]
          Length = 289

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 76/265 (28%), Positives = 135/265 (50%), Gaps = 13/265 (4%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
             D    A+ ++   L S+FP ++  A L  +L  H    +V +++    P+ I   + +
Sbjct: 27  RNDVSGNAAQLAYYMLFSIFPMLLIAATLLAYL--HIDKDSVFNMIKEFAPDQIMDFLEE 84

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS--FGY 138
            +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R++ + RL+S  F  
Sbjct: 85  NLNTLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRNYVVQRLLSMFFTL 144

Query: 139 VLLASVTLVIMSFVF-VAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLIFV 196
            +LA+V   ++  VF   I + L     F        L  WN  R   T++ +F+   F+
Sbjct: 145 AMLATVGATLLLLVFGQQIGMFLINHLNFSEDF----LSFWNNLRWTVTLVVIFVVFTFL 200

Query: 197 HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
           +   P  +S ++S+LPG +F+ I W + +V F +Y+  F  YS  Y  +  I+  +++ Y
Sbjct: 201 YWVAPNRRSTLISVLPGALFSTIGWTIASVGFAYYVNNFGNYSATYGSIGVIIILMLWFY 260

Query: 257 MLGVFFILGAELNASMIIYYWRKKP 281
           + G+  ++G ELNA++ I   RKK 
Sbjct: 261 LTGIILMIGGELNATLAI---RKKK 282


>gi|116873142|ref|YP_849923.1| hypothetical protein lwe1726 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|116742020|emb|CAK21144.1| conserved hypothetical protein [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 289

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 75/264 (28%), Positives = 135/264 (51%), Gaps = 10/264 (3%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
             D    A+ ++   L S+FP ++  A L  +L  H    +V +++    P+ I   + +
Sbjct: 27  RNDVSGNAAQLAYYMLFSIFPMLLIAATLLAYL--HIDKDSVFNMIKEFAPDQIMDFLEE 84

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS--FGY 138
            +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R++ + RL+S  F  
Sbjct: 85  NLNTLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRNYVVQRLLSMFFTM 144

Query: 139 VLLASVTLVIMSFVF-VAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLIFV 196
            +LA+V   ++  VF   I + L     F        L  WN  R   T++ +F+   F+
Sbjct: 145 SMLATVGATLLLLVFGQQIGMFLINHLHFSEDF----LSFWNNLRWTVTLIVIFVVFTFL 200

Query: 197 HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
           +   P  +S ++S+LPG +F+ I W V +V F +Y+  F  YS  Y  +  I+  +++ Y
Sbjct: 201 YWVAPNRRSTLISVLPGALFSTIGWTVASVGFAYYVNNFGNYSATYGSIGVIIILMLWFY 260

Query: 257 MLGVFFILGAELNASMIIYYWRKK 280
           + G+  ++G ELNA++ I   +K+
Sbjct: 261 LTGIILMIGGELNATLAIRKKKKE 284


>gi|58579184|ref|YP_197396.1| hypothetical protein ERWE_CDS_05200 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417810|emb|CAI27014.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 277

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 132/270 (48%), Gaps = 20/270 (7%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVF----GANLAGFLGAHQFVPTVI 63
           +F   Y A+   +E DG   A ++S   LLSVFPF+VF     +NLA  L  H +  +V 
Sbjct: 9   IFKCSYYAVVDMIEHDGIEHAGYLSFVILLSVFPFLVFFMALMSNLAQLL--HYYDISVS 66

Query: 64  D----VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
           D    ++    P  +   +   I ++++ P   L T++ +   + +S+ VE +R  LN+A
Sbjct: 67  DKLIILITDNIPSEVISGLMPRIQEIISGPPHSLLTLAVIGTIWTASSAVEGIRTILNKA 126

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
            RV    S+   RL+S    +  ++ + I     +  P+    + K    LG        
Sbjct: 127 CRVSSPPSYIFRRLLSIFQFISITLAMTIAMICIIVFPVIYEMLNK---NLGYF------ 177

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
            +   + L LF+ +  ++  +P  K  + +++PG +     W   +++FT Y+ TF   +
Sbjct: 178 -KYAVSELVLFVSITLLYFIIPNVKQNLANVVPGAVLVTFLWTCSSLIFTWYLKTFHQLN 236

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELN 269
            +Y  LASI+  L+F Y+L +FFI GAE N
Sbjct: 237 IIYGSLASIIASLLFFYILSIFFIYGAEFN 266


>gi|73667122|ref|YP_303138.1| ribonuclease BN [Ehrlichia canis str. Jake]
 gi|72394263|gb|AAZ68540.1| Ribonuclease BN [Ehrlichia canis str. Jake]
          Length = 279

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 77/265 (29%), Positives = 130/265 (49%), Gaps = 18/265 (6%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVF----GANLAGFLGAHQFV--PTVIDV 65
           +Y A+   V+ DG   A ++S   LLS+FPF+VF     +N+A  L  +       +I +
Sbjct: 13  VYYAMVDMVKHDGIEHAGYLSFIILLSIFPFLVFLMALVSNVAQLLNYYDISISEKLILL 72

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           +    P  I   I   I ++++ P   L T++ +   + SS+ VE +R  LN+AYRV   
Sbjct: 73  INDNVPSEIISGIMPRIQEIISGPPHSLLTLAIIGTVWTSSSAVEGIRTILNKAYRVSSP 132

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA- 184
            S+   RL+S    L+ +VT+ I     + +P+    + +                 YA 
Sbjct: 133 PSYIFRRLLSIFQFLMITVTITIAMVSIILLPVIYEMLDRNLAYFK-----------YAI 181

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
           + L LF  +  ++  +P  K  +++++PG +     W   + +FT YI TF   + +Y  
Sbjct: 182 SELMLFTSITLLYFIVPNIKQNLINVVPGAMLVTFLWTCSSFVFTWYIKTFQQLNIIYGS 241

Query: 245 LASIMTCLVFLYMLGVFFILGAELN 269
           LA I+  L+F Y+L +FFI GAE N
Sbjct: 242 LAGIIASLLFFYILSIFFIYGAEFN 266


>gi|218513787|ref|ZP_03510627.1| putative ribonuclease protein [Rhizobium etli 8C-3]
          Length = 161

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 94/125 (75%)

Query: 149 MSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIM 208
           +S + VA+PLAL Y R +FP   + L I+++ RIY T++ L +GL+ +HL+LPA K ++ 
Sbjct: 3   ISILLVAVPLALDYARNWFPLFADTLDIVFSWRIYGTLVVLTVGLLVMHLWLPAGKRRVF 62

Query: 209 SILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAEL 268
            ++PGV+ T + W+ GA++F +Y+ TF+ Y+  YAGLAS+M  L+FLYM+GV FI+GAE+
Sbjct: 63  DVIPGVLLTLLLWLAGALIFAYYLATFANYTATYAGLASVMIVLIFLYMVGVIFIIGAEI 122

Query: 269 NASMI 273
           NA++I
Sbjct: 123 NAALI 127


>gi|88606794|ref|YP_505080.1| YihY family protein [Anaplasma phagocytophilum HZ]
 gi|88597857|gb|ABD43327.1| YihY family protein [Anaplasma phagocytophilum HZ]
          Length = 277

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 73/266 (27%), Positives = 130/266 (48%), Gaps = 15/266 (5%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVF----GANLAGFLGAHQFVPT-VI 63
           F  I  A+  F + DG   A ++S   LLS+FPF VF     +++   L   QF+ T + 
Sbjct: 10  FKCICKAVIDFRDHDGMEYAGYLSFIVLLSMFPFFVFFNALTSSIVSVLDKDQFLYTRLF 69

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
           DV+ G  P      +   I ++L+ P + L T++     + +S+ +E +R  LN+A RV 
Sbjct: 70  DVLSGELPHDTMDALLPRIEEILSGPPQSLLTVAIGGVIWTASSVIEGIRHVLNKALRVS 129

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
               + + R+ S    L+    +++     V +P+    V + +  L          R  
Sbjct: 130 APPPYILGRMFSILQFLIIVAVMMLSVLFAVLVPIIFEVVGRHWEFL----------RFV 179

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            + + LFI + +++  +P  +  I+ +LPG      +W + ++ F+ Y+ TF    T+Y 
Sbjct: 180 VSKVVLFIAVSWIYFMVPNVRQNILVVLPGAAVVTATWTLTSMAFSWYLSTFQVLKTIYG 239

Query: 244 GLASIMTCLVFLYMLGVFFILGAELN 269
            L  I+  ++F Y+L +FFI GAELN
Sbjct: 240 NLTGIIAAMLFFYILSIFFIYGAELN 265


>gi|251779224|ref|ZP_04822144.1| YihY family protein [Clostridium botulinum E1 str. 'BoNT E Beluga']
 gi|243083539|gb|EES49429.1| YihY family protein [Clostridium botulinum E1 str. 'BoNT E Beluga']
          Length = 282

 Score =  102 bits (254), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 75/252 (29%), Positives = 133/252 (52%), Gaps = 6/252 (2%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
            +D +A+AS ++   LLS FPFI+F   L GF         +++ +    PE +    + 
Sbjct: 24  NDDIFALASQLAYYLLLSFFPFIIFLITLIGFSNMDSI--QILNGIRAIVPEAVFDLTSS 81

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
            I++V      GL  IS L A + SS+G  A+   +N+AY   E RS+    +IS   V+
Sbjct: 82  IIIEVFDKQYTGLLGISILLALWTSSSGFRAVIKGVNKAYSFKEHRSFIKRLIISMISVI 141

Query: 141 LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIF--VHL 198
             ++T+++   + V   +   Y+ K  P   NL++I+WN   YA ++ + I  IF  ++ 
Sbjct: 142 ALALTIILALSMLVFGNVIGNYIVKVIP-FTNLVIILWNICRYAFVVIIMI-FIFASIYR 199

Query: 199 FLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYML 258
           F P+ + +   ++PG IF+ + W+V +  F+ YI  F  +S  Y  L ++   + +L+++
Sbjct: 200 FTPSKRLRWREVIPGSIFSTLGWIVTSYGFSFYIDNFRNFSRFYGSLGAVFILMTWLFLI 259

Query: 259 GVFFILGAELNA 270
            + FILG E+N 
Sbjct: 260 SILFILGVEINC 271


>gi|188588648|ref|YP_001922492.1| YihY family protein [Clostridium botulinum E3 str. Alaska E43]
 gi|188498929|gb|ACD52065.1| YihY family protein [Clostridium botulinum E3 str. Alaska E43]
          Length = 282

 Score =  101 bits (252), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 75/252 (29%), Positives = 132/252 (52%), Gaps = 6/252 (2%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
            +D +A+AS ++   LLS FPFI+F   L GF         +++ +    PE +      
Sbjct: 24  NDDIFALASQLAYYLLLSFFPFIIFLITLIGFSNMDSI--QILNGIRAIVPEAVFDLTAS 81

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
            I++V      GL  IS L A + SS+G  A+   +N+AY   E RS+    +IS   V+
Sbjct: 82  IIVEVFDKQYTGLLGISILLALWTSSSGFRAVIKGVNKAYNFKEHRSFIKRLIISMISVI 141

Query: 141 LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIF--VHL 198
             ++T+++   + V   +   Y+ K  P   NL++I+WN   YA ++ + I  IF  ++ 
Sbjct: 142 ALALTIILALSMLVFGNVIGNYIVKVIP-FTNLVIILWNICRYAFVVIIMI-FIFASIYR 199

Query: 199 FLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYML 258
           F P+ + +   ++PG IF+ + W+V +  F+ YI  F  +S  Y  L ++   + +L+++
Sbjct: 200 FTPSKRLRWREVIPGSIFSTLGWIVTSYGFSFYIDNFRNFSRFYGSLGAVFILMTWLFLI 259

Query: 259 GVFFILGAELNA 270
            + FILG E+N 
Sbjct: 260 SILFILGVEINC 271


>gi|187935176|ref|YP_001887555.1| YihY family protein [Clostridium botulinum B str. Eklund 17B]
 gi|187723329|gb|ACD24550.1| YihY family protein [Clostridium botulinum B str. Eklund 17B]
          Length = 282

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 71/252 (28%), Positives = 131/252 (51%), Gaps = 6/252 (2%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
            +D +A+AS ++   LLS FPFI+F   L GF         +++ +    PE +    + 
Sbjct: 24  NDDIFALASQLAYYLLLSFFPFIIFLITLVGFSNMDSI--QILNGIKAVVPEAVFDLTSS 81

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
            I++V      GL  IS L A + SS+G  A+   +N+AY   E RS+    +IS   V+
Sbjct: 82  TIIEVFDKQYTGLLEISILLALWTSSSGFRAVIKGVNKAYDFKENRSFIKRLIISMISVI 141

Query: 141 LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN--GRIYATMLALFIGLIFVHL 198
             ++T+++   + V   +   Y+ K  P    L++I+WN    ++  ++ +FI    ++ 
Sbjct: 142 ALALTIILALSMLVFGNVIENYIIKIIP-FTKLVVILWNICRYVFVVIIMVFI-FASIYR 199

Query: 199 FLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYML 258
           F P+ + K   ++PG IF+ + W++ +  F+ YI  F  +S  Y  L ++   + +L+++
Sbjct: 200 FTPSKRLKWRDVIPGSIFSTVGWIITSYGFSFYIDNFRNFSRFYGSLGAVFILMTWLFLV 259

Query: 259 GVFFILGAELNA 270
            + FILG E+N 
Sbjct: 260 SILFILGVEINC 271


>gi|254992437|ref|ZP_05274627.1| transport protein [Listeria monocytogenes FSL J2-064]
          Length = 239

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 65/215 (30%), Positives = 113/215 (52%), Gaps = 11/215 (5%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+ I   + + +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R++ +
Sbjct: 25  PDQIMDFLEENLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRNYVV 84

Query: 131 TRLIS--FGYVLLASVTLVIMSFVF-VAIPLALAYVRKFFPALGNLLLIIWNG-RIYATM 186
            RL+S  F   +LA+V   ++  VF   I + L     F        L  WN  R   T+
Sbjct: 85  QRLLSMFFTLAMLATVGATLLLLVFGQQIGMFLINHLNFSEDF----LSFWNNLRWTVTL 140

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           + +F+   F++   P  +S ++S+LPG +F+ I W V ++ F +Y+  F  YS  Y  + 
Sbjct: 141 IVIFVVFTFLYWVAPNRRSTLISVLPGALFSTIGWTVASLGFAYYVNNFGNYSATYGSIG 200

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
            I+  +++ Y+ G+  ++G ELNA++ I   RKK 
Sbjct: 201 VIIILMLWFYLTGIILMIGGELNATLAI---RKKK 232


>gi|311067277|ref|YP_003972200.1| YfkH protein [Bacillus atrophaeus 1942]
 gi|310867794|gb|ADP31269.1| YfkH [Bacillus atrophaeus 1942]
          Length = 279

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 132/276 (47%), Gaps = 15/276 (5%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D I +    F   +G + ++ ++   LLS+FPF++F   LA +L      P   D V G 
Sbjct: 2   DFIKELFGRFTLHEGQSKSAELAYFFLLSLFPFMIFILTLAAYL------PLTSDDVLGV 55

Query: 70  ----WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
                P+     I     Q L     GL +   +AA + +SNG+ A+  + N AY V E 
Sbjct: 56  VDQYAPDGAMSLIQSITEQTLNNRNGGLLSFGIIAALWSASNGMNAIVRAFNHAYEVEEN 115

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG-RIYA 184
           RS+ I RL S  ++ +  V  ++++ +       +  +   F    ++ L +W   R   
Sbjct: 116 RSFIIVRLTSI-FLTIGMVFTILVALLLPVFGKQIGLLTAEFVGASDMFLAVWAAVRWGI 174

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
           + L L I    ++LF P  K  +  + PG +F  I W+  + LF+ Y+ T++ YS  Y  
Sbjct: 175 SPLILLIVFSALYLFAPNKKLSLRFVFPGALFATIGWIAVSTLFSFYVGTYANYSATYGS 234

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +  I+  +++ Y+ G+  ILG E+NA   + + RKK
Sbjct: 235 IGGIIVLMIWFYLSGILIILGGEINA---LLHKRKK 267


>gi|152974229|ref|YP_001373746.1| putative ribonuclease BN [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|152022981|gb|ABS20751.1| putative ribonuclease BN [Bacillus cytotoxicus NVH 391-98]
          Length = 289

 Score = 99.4 bits (246), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 132/269 (49%), Gaps = 6/269 (2%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+        V++++    PE 
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFVITLLGFIDLQ--TENVLNLLEPYVPEE 76

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               I   + QV+     GL +   L+  +F+SNGV A+  + NRAY V E RS+ +TR 
Sbjct: 77  AMNLIEVNVDQVINNQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVKETRSFIVTRA 136

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIG 192
           +S  + L     +V    V V   +  A V K    L      +W+  R+ A+ L LF  
Sbjct: 137 LSIVFTLAMIFMIVFALIVPVFGQVIGAAVFKVL-GLSESFSFVWSIIRLVASFLVLFAL 195

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
             F++ F P  K K   ++ G +F  + W+V +  F +Y+  F+ Y+  Y GL  I+  +
Sbjct: 196 FSFLYTFAPDRKLKRREVISGALFATVGWIVVSYSFAYYVDKFANYANTYGGLGGIIILM 255

Query: 253 VFLYMLGVFFILGAELNASMIIYYWRKKP 281
           ++ Y+     +LG E+N   ++Y++R   
Sbjct: 256 LWFYLTAWVILLGGEING--LLYFYRTND 282


>gi|196034774|ref|ZP_03102182.1| YihY family protein [Bacillus cereus W]
 gi|218901611|ref|YP_002449445.1| YihY family protein [Bacillus cereus AH820]
 gi|228925661|ref|ZP_04088749.1| YihY [Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228931903|ref|ZP_04094798.1| YihY [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228944214|ref|ZP_04106592.1| YihY [Bacillus thuringiensis serovar monterrey BGSC 4AJ1]
 gi|229120067|ref|ZP_04249321.1| YihY [Bacillus cereus 95/8201]
 gi|195992817|gb|EDX56777.1| YihY family protein [Bacillus cereus W]
 gi|218539779|gb|ACK92177.1| YihY family protein [Bacillus cereus AH820]
 gi|228663386|gb|EEL18972.1| YihY [Bacillus cereus 95/8201]
 gi|228815464|gb|EEM61707.1| YihY [Bacillus thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228827757|gb|EEM73496.1| YihY [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228833997|gb|EEM79546.1| YihY [Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1]
          Length = 286

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/266 (26%), Positives = 132/266 (49%), Gaps = 9/266 (3%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V+D++    PE 
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLDLLEPYVPED 76

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR 
Sbjct: 77  AMNLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETRSFIKTRA 136

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIG 192
           +S  + L     ++ M    + +P+    +      L +     W+  R+ ++   LF  
Sbjct: 137 LSIVFTL----AIIFMIVFALLVPVFGQVIGAEIIGLSDTYSYAWSVTRLVSSFFVLFAL 192

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
             F++ F P  K K   ++ G +F  I W+V +  F +Y+  F+ Y+  Y GL  I+  +
Sbjct: 193 FSFLYTFAPDRKLKRREVVSGALFATIGWIVVSYSFAYYVDKFANYANTYGGLGGIIVLM 252

Query: 253 VFLYMLGVFFILGAELNASMIIYYWR 278
           ++ Y+ G   +LG E+N   +++++R
Sbjct: 253 LWFYLTGWVILLGGEING--LLHHYR 276


>gi|150019687|ref|YP_001311941.1| ribonuclease BN [Clostridium beijerinckii NCIMB 8052]
 gi|149906152|gb|ABR36985.1| putative ribonuclease BN [Clostridium beijerinckii NCIMB 8052]
          Length = 284

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/263 (28%), Positives = 139/263 (52%), Gaps = 8/263 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGF--LGAHQFVPTVIDVVF 67
           ++I   I     +D +A+AS ++   +LS FPF++F   LAGF  + + Q +   ++V+ 
Sbjct: 11  NLIIHLIVKIKRDDVFALASQLAYYLILSFFPFMLFLMTLAGFSSISSKQILGQ-LNVML 69

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P  + +     ++++      GL  IS L   + +S+  +A+  S+N+AY   E RS
Sbjct: 70  ---PRSVLELTQSTVVEIFDNQYTGLLGISILLTLWTASSAFKAIIKSINKAYNFKEERS 126

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           +    +IS   +L  +VT+++     V   +   Y++   P    ++LIIWN   Y  +L
Sbjct: 127 FIKLSIISMLGILALAVTIILALTALVFGNVIGDYIKSINP-FYEIILIIWNIFRYTFIL 185

Query: 188 ALFIGL-IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           A+ I + I V+ F PA K     ++ G IF+ + WV+ + +F+ YI  F+ YS  Y  L 
Sbjct: 186 AIMISIFICVYKFAPAKKLVWKEVIAGSIFSTVGWVLVSFVFSFYIDNFNNYSRFYGSLG 245

Query: 247 SIMTCLVFLYMLGVFFILGAELN 269
           ++   + +L+++ + FILG E+N
Sbjct: 246 AVFILMTWLFLISIIFILGVEIN 268


>gi|299820568|ref|ZP_07052458.1| YihY family protein [Listeria grayi DSM 20601]
 gi|299818063|gb|EFI85297.1| YihY family protein [Listeria grayi DSM 20601]
          Length = 285

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 134/271 (49%), Gaps = 24/271 (8%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           + D    A+ ++   L S+FP ++    L GFL   +   ++  +V    P+ I   I  
Sbjct: 23  KNDVTGNAAQLAYYMLFSIFPLLLVAVALLGFLNLDK--DSIFQMVEDFAPKQIIDFIQT 80

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
            + QVL+  + GL ++  LA  + +SNG+ A+  +LN+AY +++ R++ I +L+S     
Sbjct: 81  NLDQVLSNRSGGLLSVGILATLWSASNGMAAVMKALNKAYGIIDRRNFIIQKLLS----- 135

Query: 141 LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLL----------IIWNG-RIYATMLAL 189
              V   +   V VAI L L     F   +G+ LL           +WNG R   ++L +
Sbjct: 136 ---VLFTVAMLVTVAITLVLLV---FGQQIGDFLLHSLHMPSQVIDVWNGLRELLSVLVI 189

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            +   F++ F P  K  I ++LPG +F  I W + ++ F  Y+  F  Y+  Y  +  ++
Sbjct: 190 LVVFTFLYWFAPNRKGTIKTVLPGALFASIGWSLASIGFAFYVNNFGNYTATYGSIGIVI 249

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             +++ ++ G+  I+G ELN ++     +K+
Sbjct: 250 VLMLWFFLTGIILIVGGELNGTLAFIKQKKE 280


>gi|229015792|ref|ZP_04172770.1| YihY [Bacillus cereus AH1273]
 gi|229022000|ref|ZP_04178557.1| YihY [Bacillus cereus AH1272]
 gi|228739306|gb|EEL89745.1| YihY [Bacillus cereus AH1272]
 gi|228745508|gb|EEL95532.1| YihY [Bacillus cereus AH1273]
          Length = 289

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/270 (27%), Positives = 134/270 (49%), Gaps = 14/270 (5%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++    PE 
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLLEPYVPED 76

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR 
Sbjct: 77  AMNLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETRSFIKTRA 136

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALG--NLLLIIWN-GRIYATMLA 188
           +S  + L      +I   VF  I      V     F A+G  +    +W+  R+ A+   
Sbjct: 137 LSIVFTLA-----IIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASFFV 191

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LF    F++ F P  K K   ++ G +F  + W+V +  F +Y+  F+ Y+  Y GL  I
Sbjct: 192 LFALFSFLYTFAPDRKLKRREVISGALFATVGWIVVSYSFAYYVDKFANYANTYGGLGGI 251

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           +  +++ Y+ G   +LG E+N   +++++R
Sbjct: 252 IILMLWFYLTGWVILLGGEING--LLHHYR 279


>gi|229074335|ref|ZP_04207373.1| YihY [Bacillus cereus Rock4-18]
 gi|229095110|ref|ZP_04226105.1| YihY [Bacillus cereus Rock3-29]
 gi|229101212|ref|ZP_04231976.1| YihY [Bacillus cereus Rock3-28]
 gi|229114064|ref|ZP_04243489.1| YihY [Bacillus cereus Rock1-3]
 gi|228669334|gb|EEL24751.1| YihY [Bacillus cereus Rock1-3]
 gi|228682180|gb|EEL36293.1| YihY [Bacillus cereus Rock3-28]
 gi|228688295|gb|EEL42178.1| YihY [Bacillus cereus Rock3-29]
 gi|228708777|gb|EEL60912.1| YihY [Bacillus cereus Rock4-18]
          Length = 288

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 134/270 (49%), Gaps = 14/270 (5%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++    PE 
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLLEPYVPED 76

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR 
Sbjct: 77  AMYLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETRSFIKTRA 136

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALG--NLLLIIWN-GRIYATMLA 188
           +S  + L      +I   VF  I      V     F A+G  +    +W+  R+ A+   
Sbjct: 137 LSIVFTLA-----IIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASFFV 191

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LF    F++ F P  K K   ++ G IF  + W+V +  F +Y+  F+ Y+  Y GL  I
Sbjct: 192 LFALFSFLYTFAPDRKLKRREVISGAIFATVGWIVVSYSFAYYVDKFANYANTYGGLGGI 251

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           +  +++ Y+ G   +LG E+N   +++++R
Sbjct: 252 IILMLWFYLTGWVILLGGEING--LLHHYR 279


>gi|118476162|ref|YP_893313.1| ribonuclease BN [Bacillus thuringiensis str. Al Hakam]
 gi|196045195|ref|ZP_03112427.1| YihY family protein [Bacillus cereus 03BB108]
 gi|225862450|ref|YP_002747828.1| YihY family protein [Bacillus cereus 03BB102]
 gi|229182794|ref|ZP_04310033.1| YihY [Bacillus cereus BGSC 6E1]
 gi|118415387|gb|ABK83806.1| ribonuclease BN [Bacillus thuringiensis str. Al Hakam]
 gi|196023779|gb|EDX62454.1| YihY family protein [Bacillus cereus 03BB108]
 gi|225790204|gb|ACO30421.1| YihY family protein [Bacillus cereus 03BB102]
 gi|228600674|gb|EEK58255.1| YihY [Bacillus cereus BGSC 6E1]
          Length = 289

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/273 (27%), Positives = 133/273 (48%), Gaps = 14/273 (5%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++    PE 
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLLEPYVPED 76

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR 
Sbjct: 77  AMSLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETRSFIKTRA 136

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALG--NLLLIIWN-GRIYATMLA 188
           +S  + L      +I   VF  I      V     F A+G  +    +W+  R+ A+   
Sbjct: 137 LSIVFTLA-----IIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASFFV 191

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LF    F++ F P  K K   ++ G  F  + W+V +  F +Y+  F+ Y+  Y GL  I
Sbjct: 192 LFALFSFIYTFAPDRKLKRREVISGATFATVGWIVVSYSFAYYVDKFANYANTYGGLGGI 251

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
           +  +++ Y+ G   +LG E+N   +++++R   
Sbjct: 252 IILMLWFYLTGWVILLGGEING--LLHHYRTSD 282


>gi|229171254|ref|ZP_04298844.1| YihY [Bacillus cereus MM3]
 gi|228612211|gb|EEK69443.1| YihY [Bacillus cereus MM3]
          Length = 289

 Score = 97.1 bits (240), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/270 (27%), Positives = 134/270 (49%), Gaps = 14/270 (5%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++    PE 
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLLEPYVPED 76

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR 
Sbjct: 77  AMSLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETRSFIKTRA 136

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALG--NLLLIIWN-GRIYATMLA 188
           +S  + L      +I   VF  I      V     F A+G  +    +W+  R+ A+   
Sbjct: 137 LSIVFTLA-----IIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASFFV 191

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LF    F++ F P  K K   ++ G IF  + W++ +  F +Y+  F+ Y+  Y GL  I
Sbjct: 192 LFALFSFLYTFAPDRKLKRREVISGAIFATVGWIMVSYSFAYYVDKFANYANTYGGLGGI 251

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           +  +++ Y+ G   +LG E+N   +++++R
Sbjct: 252 IILMLWFYLTGWVILLGGEING--LLHHYR 279


>gi|189183815|ref|YP_001937600.1| hypothetical protein OTT_0908 [Orientia tsutsugamushi str. Ikeda]
 gi|189180586|dbj|BAG40366.1| hypothetical protein OTT_0908 [Orientia tsutsugamushi str. Ikeda]
          Length = 281

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 77/278 (27%), Positives = 132/278 (47%), Gaps = 20/278 (7%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
            AI   +E DG   A +++   LLS+FPF++F    + FLG  +     I ++    P  
Sbjct: 11  QAIFKTIEHDGIEHAGYMAFMILLSIFPFVMFFLASSSFLGVSELGKNGIAILLSNLPAN 70

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
           +A+ I   I ++L  P + L T++     + SS+ VE +R  LNR ++V     +++ RL
Sbjct: 71  VAETIVPRIHEILENPPQSLLTLAIFGTIWTSSSFVEGIRTILNRVHQVNSPPPYWLRRL 130

Query: 134 ISFGYVLLASVT--LVIMSFVFV-----AIPLALAYVRKFFPALGNLLLIIWNGRIYA-T 185
           +S    L+ S+   L I+ FVF       IP  + + +   P        IW    Y   
Sbjct: 131 LSITQFLITSIIIFLTIVLFVFTPIILRKIPTTIVFTKTLSP--------IWILLRYTFI 182

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +L LF  +  ++ F+P    K   ++PG I T + W+    + +     +S  + +Y  L
Sbjct: 183 VLTLFFTVSTIYYFVPNTNLKFREVVPGAIITVMLWIFSGTMLSKSTAYYSQLNLIYGSL 242

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMI----IYYWRK 279
            SI+  L+F +++ + FI GAE N  ++      YW K
Sbjct: 243 GSIIITLLFFHIIAIIFIYGAEFNHQLLKKNGKKYWHK 280


>gi|229154172|ref|ZP_04282296.1| YihY [Bacillus cereus ATCC 4342]
 gi|228629308|gb|EEK86011.1| YihY [Bacillus cereus ATCC 4342]
          Length = 289

 Score = 96.7 bits (239), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/270 (27%), Positives = 133/270 (49%), Gaps = 14/270 (5%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++    PE 
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLLEPYVPED 76

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR 
Sbjct: 77  AMSLIEVNVDKVVNQQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETRSFIKTRA 136

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALG--NLLLIIWN-GRIYATMLA 188
           +S  + L      +I   VF  I      V     F A+G  +    +W+  R+ A+   
Sbjct: 137 LSIVFTLA-----IIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASFFV 191

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LF    F++ F P  K K   ++ G  F  + W+V +  F +Y+  F+ Y+  Y GL  I
Sbjct: 192 LFALFSFLYTFAPDRKLKRKEVISGATFATVGWIVVSYSFAYYVDKFANYANTYGGLGGI 251

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           +  +++ Y+ G   +LG E+N   +++++R
Sbjct: 252 IILMLWFYLTGWVILLGGEING--LLHHYR 279


>gi|47567234|ref|ZP_00237948.1| ribonuclease BN, putative [Bacillus cereus G9241]
 gi|228983665|ref|ZP_04143867.1| YihY [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|47556077|gb|EAL14414.1| ribonuclease BN, putative [Bacillus cereus G9241]
 gi|228776072|gb|EEM24436.1| YihY [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1]
          Length = 289

 Score = 96.7 bits (239), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/270 (27%), Positives = 133/270 (49%), Gaps = 14/270 (5%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++    PE 
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLLEPYVPED 76

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR 
Sbjct: 77  AMSLIEVNVDKVVNQQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETRSFIKTRA 136

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALG--NLLLIIWN-GRIYATMLA 188
           +S  + L      +I   VF  I      V     F A+G  +    +W+  R+ A+   
Sbjct: 137 LSIVFTLA-----IIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASFFV 191

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LF    F++ F P  K K   ++ G  F  + W+V +  F +Y+  F+ Y+  Y GL  I
Sbjct: 192 LFALFSFLYTFAPDRKLKRREVISGATFATVGWIVVSYSFAYYVDKFANYANTYGGLGGI 251

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           +  +++ Y+ G   +LG E+N   +++++R
Sbjct: 252 IILMLWFYLTGWVILLGGEING--LLHHYR 279


>gi|30260576|ref|NP_842953.1| ribonuclease BN, putative [Bacillus anthracis str. Ames]
 gi|42779603|ref|NP_976850.1| ribonuclease BN, putative [Bacillus cereus ATCC 10987]
 gi|47525680|ref|YP_017029.1| ribonuclease BN [Bacillus anthracis str. 'Ames Ancestor']
 gi|49183423|ref|YP_026675.1| ribonuclease BN [Bacillus anthracis str. Sterne]
 gi|49480098|ref|YP_034736.1| ribonuclease BN [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|52144837|ref|YP_081992.1| ribonuclease BN [Bacillus cereus E33L]
 gi|65317837|ref|ZP_00390796.1| COG1295: Predicted membrane protein [Bacillus anthracis str. A2012]
 gi|165870787|ref|ZP_02215440.1| YihY family protein [Bacillus anthracis str. A0488]
 gi|167634706|ref|ZP_02393025.1| YihY family protein [Bacillus anthracis str. A0442]
 gi|167641273|ref|ZP_02399526.1| YihY family protein [Bacillus anthracis str. A0193]
 gi|170688965|ref|ZP_02880166.1| YihY family protein [Bacillus anthracis str. A0465]
 gi|170707108|ref|ZP_02897564.1| YihY family protein [Bacillus anthracis str. A0389]
 gi|177654535|ref|ZP_02936391.1| YihY family protein [Bacillus anthracis str. A0174]
 gi|190567539|ref|ZP_03020452.1| YihY family protein [Bacillus anthracis Tsiankovskii-I]
 gi|217958004|ref|YP_002336548.1| YihY family protein [Bacillus cereus AH187]
 gi|222094204|ref|YP_002528261.1| ribonuclease bn [Bacillus cereus Q1]
 gi|227813080|ref|YP_002813089.1| YihY family protein [Bacillus anthracis str. CDC 684]
 gi|228913156|ref|ZP_04076795.1| YihY [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|229089528|ref|ZP_04220797.1| YihY [Bacillus cereus Rock3-42]
 gi|229137270|ref|ZP_04265886.1| YihY [Bacillus cereus BDRD-ST26]
 gi|229194786|ref|ZP_04321574.1| YihY [Bacillus cereus m1293]
 gi|229604696|ref|YP_002865023.1| YihY family protein [Bacillus anthracis str. A0248]
 gi|254686797|ref|ZP_05150655.1| YihY family protein [Bacillus anthracis str. CNEVA-9066]
 gi|254724872|ref|ZP_05186655.1| YihY family protein [Bacillus anthracis str. A1055]
 gi|254738978|ref|ZP_05196680.1| YihY family protein [Bacillus anthracis str. Western North America
           USA6153]
 gi|254744565|ref|ZP_05202244.1| YihY family protein [Bacillus anthracis str. Kruger B]
 gi|254756177|ref|ZP_05208206.1| YihY family protein [Bacillus anthracis str. Vollum]
 gi|254761995|ref|ZP_05213844.1| YihY family protein [Bacillus anthracis str. Australia 94]
 gi|300119033|ref|ZP_07056744.1| YihY family protein [Bacillus cereus SJ1]
 gi|4584097|emb|CAB40586.1| yfkH [Bacillus cereus ATCC 10987]
 gi|30253944|gb|AAP24439.1| YihY family protein [Bacillus anthracis str. Ames]
 gi|42735519|gb|AAS39458.1| ribonuclease BN, putative [Bacillus cereus ATCC 10987]
 gi|47500828|gb|AAT29504.1| YihY family protein [Bacillus anthracis str. 'Ames Ancestor']
 gi|49177350|gb|AAT52726.1| ribonuclease BN, putative [Bacillus anthracis str. Sterne]
 gi|49331654|gb|AAT62300.1| probable ribonuclease BN [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|51978306|gb|AAU19856.1| probable ribonuclease BN [Bacillus cereus E33L]
 gi|164713621|gb|EDR19145.1| YihY family protein [Bacillus anthracis str. A0488]
 gi|167510781|gb|EDR86174.1| YihY family protein [Bacillus anthracis str. A0193]
 gi|167529780|gb|EDR92528.1| YihY family protein [Bacillus anthracis str. A0442]
 gi|170127886|gb|EDS96757.1| YihY family protein [Bacillus anthracis str. A0389]
 gi|170667066|gb|EDT17828.1| YihY family protein [Bacillus anthracis str. A0465]
 gi|172080647|gb|EDT65730.1| YihY family protein [Bacillus anthracis str. A0174]
 gi|190561326|gb|EDV15298.1| YihY family protein [Bacillus anthracis Tsiankovskii-I]
 gi|217067694|gb|ACJ81944.1| YihY family protein [Bacillus cereus AH187]
 gi|221238259|gb|ACM10969.1| probable ribonuclease BN [Bacillus cereus Q1]
 gi|227003880|gb|ACP13623.1| YihY family protein [Bacillus anthracis str. CDC 684]
 gi|228588697|gb|EEK46727.1| YihY [Bacillus cereus m1293]
 gi|228646173|gb|EEL02391.1| YihY [Bacillus cereus BDRD-ST26]
 gi|228693835|gb|EEL47529.1| YihY [Bacillus cereus Rock3-42]
 gi|228846561|gb|EEM91574.1| YihY [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|229269104|gb|ACQ50741.1| YihY family protein [Bacillus anthracis str. A0248]
 gi|298723649|gb|EFI64380.1| YihY family protein [Bacillus cereus SJ1]
 gi|324324508|gb|ADY19768.1| YihY family protein [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 289

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/270 (27%), Positives = 133/270 (49%), Gaps = 14/270 (5%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++    PE 
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLLEPYVPED 76

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR 
Sbjct: 77  AMSLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETRSFIKTRA 136

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALG--NLLLIIWN-GRIYATMLA 188
           +S  + L      +I   VF  I      V     F A+G  +    +W+  R+ A+   
Sbjct: 137 LSIVFTLA-----IIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASFFV 191

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LF    F++ F P  K K   ++ G  F  + W+V +  F +Y+  F+ Y+  Y GL  I
Sbjct: 192 LFALFSFLYTFAPDRKLKRREVISGATFATVGWIVVSYSFAYYVDKFANYANTYGGLGGI 251

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           +  +++ Y+ G   +LG E+N   +++++R
Sbjct: 252 IILMLWFYLTGWVILLGGEING--LLHHYR 279


>gi|110802092|ref|YP_697602.1| YihY family protein [Clostridium perfringens SM101]
 gi|110682593|gb|ABG85963.1| YihY family protein [Clostridium perfringens SM101]
          Length = 283

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 133/256 (51%), Gaps = 4/256 (1%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           I+   ++D +A+ + ++   +LS  PF++F  NL GF  +H    T+++++    P    
Sbjct: 20  IKKIGDDDIFALGAQLAYYMVLSFIPFLMFLMNLVGF--SHLNSDTILNLLSNVMPTEAF 77

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
             I   +++++     GL  IS   A + SS+G +A+   LN+AY V E RS+   +LIS
Sbjct: 78  NLIQSTVIEIVDKEQTGLLWISIALAIWVSSSGFKAVIKGLNKAYGVKETRSYIKLKLIS 137

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLI 194
             Y +L ++ ++   F+FV   +   +  K       ++  IWN  R    +L + +  +
Sbjct: 138 MIYTILLALIVIATLFLFVFGDVIGDFFIKVLEH-PEVIYYIWNMLRYVVVILIMVLFFM 196

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
           F++   P  +   + ++PG + T + W+  + +F +Y+  FS YS +Y  L ++   + +
Sbjct: 197 FLYNATPCVRLGWLEVIPGAVITTLGWISISYIFAYYVNNFSNYSRLYGSLGAVFMFMTW 256

Query: 255 LYMLGVFFILGAELNA 270
           +++  +  ILG E+NA
Sbjct: 257 MFITSMILILGGEINA 272


>gi|148284876|ref|YP_001248966.1| putative ribonuclease BN [Orientia tsutsugamushi str. Boryong]
 gi|146740315|emb|CAM80715.1| putative ribonuclease BN [Orientia tsutsugamushi str. Boryong]
          Length = 281

 Score = 95.9 bits (237), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 77/278 (27%), Positives = 132/278 (47%), Gaps = 20/278 (7%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
            AI   +E DG   A +++   LLS+FPF++F    + FLG  +     I ++    P  
Sbjct: 11  QAIFKTIEHDGIEHAGYMAFMILLSIFPFVMFFLASSSFLGVSELGKNGIAILLSNLPAN 70

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
           +A+ I   I ++L  P + L T++     + SS+ VE +R  LNR ++V     +++ RL
Sbjct: 71  VAETIVPRIHEILENPPQSLLTLAIFGTIWTSSSFVEGIRTILNRVHQVNCPPPYWLRRL 130

Query: 134 ISFGYVLLASVT--LVIMSFVFV-----AIPLALAYVRKFFPALGNLLLIIWNGRIYA-T 185
           +S    L+ S+   L I+ FVF       IP  + + +   P        IW    Y   
Sbjct: 131 LSITQFLITSIIIFLTIVLFVFTPIILRKIPTTIVFTKTLSP--------IWILLRYTFI 182

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +L LF  +  ++ F+P    K   ++PG I T + W+    + +     +S  + +Y  L
Sbjct: 183 VLTLFFTVSTIYYFVPNTNLKFREVVPGAIITVMLWIFSGTMLSKSTAYYSQLNLIYGSL 242

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMI----IYYWRK 279
            SI+  L+F +++ + FI GAE N  ++      YW K
Sbjct: 243 GSIIITLLFFHIIAIIFIYGAEFNHQLLKKNGKKYWHK 280


>gi|229028258|ref|ZP_04184396.1| YihY [Bacillus cereus AH1271]
 gi|228733064|gb|EEL83908.1| YihY [Bacillus cereus AH1271]
          Length = 289

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 75/270 (27%), Positives = 133/270 (49%), Gaps = 14/270 (5%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++    PE 
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLLEPYVPED 76

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR 
Sbjct: 77  AMSLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETRSFIKTRA 136

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALG--NLLLIIWN-GRIYATMLA 188
           +S  + L      +I   VF  I      V     F A+G  +    +W+  R+ A+   
Sbjct: 137 LSIVFTLA-----IIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSIMRLVASFFV 191

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LF    F++ F P  K K   ++ G  F  + W+V +  F +Y+  F+ Y+  Y GL  I
Sbjct: 192 LFALFSFLYTFAPDRKLKRREVISGATFATVGWIVVSYSFAYYVDKFANYANTYGGLGGI 251

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           +  +++ Y+ G   +LG E+N   +++++R
Sbjct: 252 IILMLWFYLTGWVILLGGEING--LLHHYR 279


>gi|229159554|ref|ZP_04287568.1| YihY [Bacillus cereus R309803]
 gi|228623856|gb|EEK80668.1| YihY [Bacillus cereus R309803]
          Length = 287

 Score = 95.5 bits (236), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 75/270 (27%), Positives = 133/270 (49%), Gaps = 14/270 (5%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++    PE 
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLLEPYVPED 76

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR 
Sbjct: 77  AMYLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETRSFIKTRA 136

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALG--NLLLIIWN-GRIYATMLA 188
           +S  + L      +I   VF  I      V     F A+G  +    +W+  R+ A+   
Sbjct: 137 LSIVFTLA-----IIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASFFV 191

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LF    F++ F P  K K   ++ G  F  + W+V +  F +Y+  F+ Y+  Y GL  I
Sbjct: 192 LFALFSFLYTFAPDRKLKRREVISGATFATVGWIVVSYSFAYYVDKFANYANTYGGLGGI 251

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           +  +++ Y+ G   +LG E+N   +++++R
Sbjct: 252 IILMLWFYLTGWVILLGGEING--LLHHYR 279


>gi|239825980|ref|YP_002948604.1| ribonuclease BN [Geobacillus sp. WCH70]
 gi|239806273|gb|ACS23338.1| ribonuclease BN [Geobacillus sp. WCH70]
          Length = 277

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 70/264 (26%), Positives = 137/264 (51%), Gaps = 12/264 (4%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG-AHQFVPTVIDVVFGAW 70
           I + +  F +++   +++ ++   LLS+FPF++F   L  +L   H+    ++ ++    
Sbjct: 8   IREMVRRFQKDEIPRLSAELAYYFLLSLFPFLIFLFTLLAYLPIPHE---DILSIIRQYA 64

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+     +   I +V+      L + S +AA + +SNG+ A+  + NRAY V E R ++I
Sbjct: 65  PKEALHLVEANIRRVMDDQNWKLLSFSIIAAIWSASNGMNAIVRAFNRAYDVEENRPFFI 124

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKF-FPALG--NLLLIIWNG-RIYATM 186
            R    G  +L ++ ++ +  V + +P+    +  F F A G     L IWN  R   + 
Sbjct: 125 AR----GMSVLLTIGMIFVIIVALFLPVFGKTIGLFLFSAFGFSETFLTIWNALRWVISS 180

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             LF+    ++ F P  K +  +I+ G IF  + W++ ++ F++Y+  F+ Y+ MY  L 
Sbjct: 181 FILFVVFTALYYFAPNKKLRCANIVRGAIFATVGWIMTSLAFSYYVNNFANYTAMYGSLG 240

Query: 247 SIMTCLVFLYMLGVFFILGAELNA 270
            ++  +V+ Y+ G+  +LG E+NA
Sbjct: 241 GMIILMVWFYLSGMIIVLGGEMNA 264


>gi|73662219|ref|YP_301000.1| hypothetical protein SSP0910 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|72494734|dbj|BAE18055.1| conserved hypothetical protein [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 390

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 73/263 (27%), Positives = 143/263 (54%), Gaps = 13/263 (4%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           ++D   +++ +S   +LS+FP ++F  ++   +G  Q   T+ D++    P   A  ++ 
Sbjct: 84  KDDASGLSAQLSYYFMLSLFPMLLFLLSIVPVVGVKQ--STIRDLIKDHVPSDYAPQVSG 141

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
            I  ++   + GL +I  +AA + +SNG+ AL  + N AY V + R++ + +L    Y +
Sbjct: 142 IIGDIMENASGGLLSIGLIAALWSASNGMTALMNAFNVAYDVEDSRNFVVAKL----YSV 197

Query: 141 LASVTLVIMSFVFVAIPLALAYVRK--FFP-ALGNLLLIIWNG-RIYATMLALFIGLIFV 196
           L ++ ++I+  V + +P     +    F P  LG+ +  +++  R    ++ + I  + +
Sbjct: 198 LFTLAMIIVMPVALVLPTFGQQIGDLLFGPLGLGDQVKWLFDTIRFVLPVIVVLIAFMVL 257

Query: 197 HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
           +   P  K K++S++PG IF  I ++ G+ LF  YI  F+ YS  Y  +A I+  +++LY
Sbjct: 258 YTLAPNVKIKLLSVIPGAIFATIVFLGGSYLFGIYISNFANYSKTYGSIAGIIILMLWLY 317

Query: 257 MLGVFFILGAELNASMIIYYWRK 279
           + G   I+GAE+NA   I++ RK
Sbjct: 318 ITGFIIIIGAEINA---IFHQRK 337


>gi|228906214|ref|ZP_04070101.1| YihY [Bacillus thuringiensis IBL 200]
 gi|228919337|ref|ZP_04082707.1| YihY [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228956886|ref|ZP_04118667.1| YihY [Bacillus thuringiensis serovar pakistani str. T13001]
 gi|228963518|ref|ZP_04124675.1| YihY [Bacillus thuringiensis serovar sotto str. T04001]
 gi|228796212|gb|EEM43663.1| YihY [Bacillus thuringiensis serovar sotto str. T04001]
 gi|228802729|gb|EEM49565.1| YihY [Bacillus thuringiensis serovar pakistani str. T13001]
 gi|228840444|gb|EEM85715.1| YihY [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228853370|gb|EEM98140.1| YihY [Bacillus thuringiensis IBL 200]
          Length = 289

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 135/271 (49%), Gaps = 16/271 (5%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH-QFVPTVIDVVFGAWPE 72
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+    + V ++++V     P+
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIPIQTEDVLSLLEVYV---PD 75

Query: 73  VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
                I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR
Sbjct: 76  DAMNLIEVNVDKVVNQQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVKETRSFITTR 135

Query: 133 LISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALG--NLLLIIWN-GRIYATML 187
            +S  + L      +I   VF  I      V     F ALG  +    +W+  R+ A+  
Sbjct: 136 ALSIVFTLA-----IIFMIVFALIVPVFGQVIGAAVFKALGLSDSFSFVWSITRLVASFF 190

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            LF    F++ F P  K K   ++ G +F  + W+V +  F +Y+  F+ Y+  Y GL  
Sbjct: 191 VLFALFSFLYTFAPDRKLKRREVISGALFATVGWIVVSYSFAYYVDKFANYANTYGGLGG 250

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           I+  +++ Y+ G   +LG E+N   +++++R
Sbjct: 251 IIILMLWFYLTGWVILLGGEING--LLHHYR 279


>gi|329770330|ref|ZP_08261713.1| hypothetical protein HMPREF0433_01477 [Gemella sanguinis M325]
 gi|328836688|gb|EGF86344.1| hypothetical protein HMPREF0433_01477 [Gemella sanguinis M325]
          Length = 301

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/274 (29%), Positives = 140/274 (51%), Gaps = 23/274 (8%)

Query: 5   FC--IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV 62
           FC  + + I+YD I          +++++S   +LS+FP ++    L  +    Q    +
Sbjct: 24  FCKEMYYRIMYDEIS--------LLSANLSYYFILSLFPMLIVAMALTPYFNIDQ--KFL 73

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKG-LFTISALAAAYFSSNGVEALRISLNRAYR 121
           +D +    P  +   I   I +VL   +   L T+  +   + +SNG+  + I+ N A+R
Sbjct: 74  LDKIQSFAPGELGDFIFGMISEVLNSKSNNTLITLGIVFTLWSASNGIYGIIIAFNNAFR 133

Query: 122 VVEMRSWYITRLISFGYVLLASVTL-VIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           V + R W +T+L+S  + +L  V + ++++ V     L      KF     NL    +NG
Sbjct: 134 VRDGRIWIVTKLMSILFTVLFLVGMFLVLALVVFGKQLTYLLFHKF-----NLDEGFYNG 188

Query: 181 RIYAT----MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFS 236
             Y +    +L  FI  +F+++F P  + K +SILPG +F+ ISW + + LF +YI  FS
Sbjct: 189 WSYLSYSFPILFTFIVFVFLYIFGPNLRLKAISILPGAVFSTISWTLVSRLFGYYIDHFS 248

Query: 237 TYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           +Y   Y  + + M  +++LY+ G   ILGAE+NA
Sbjct: 249 SYIKTYGTIGAFMAFIMWLYITGFILILGAEINA 282


>gi|154685267|ref|YP_001420428.1| YfkH [Bacillus amyloliquefaciens FZB42]
 gi|154351118|gb|ABS73197.1| YfkH [Bacillus amyloliquefaciens FZB42]
          Length = 279

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 135/277 (48%), Gaps = 21/277 (7%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
           I +    F   +G + ++ ++   LLS+FP ++F   L  +L      P   + V GA  
Sbjct: 4   IKELFARFSLHEGQSKSAELAYFFLLSLFPLMIFMLTLTAYL------PISAEDVLGAVD 57

Query: 72  E-------VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
           +        + K IT+   Q L   + GL +   +A  + +SNG+ A+  + N AY V E
Sbjct: 58  QYAPDSAMSMVKSITE---QTLNKRSGGLLSFGIIAVIWSASNGMNAIVRAFNHAYEVEE 114

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG-RIY 183
            RS+ I RL S  ++ +A V  ++++ +       +  +   F     L L +W+  R  
Sbjct: 115 NRSFIIIRLTSI-FLTIAMVVTILIALLLPVFGREIGMLAADFIGASGLFLQVWSVVRWG 173

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            + L L I    +++F P  +  +  +LPG +F    W++ ++LF+ Y+ TF+ YS  Y 
Sbjct: 174 ISPLILLIVFTALYIFAPNKRLSLRFVLPGAVFAAAGWIIVSMLFSFYVGTFANYSATYG 233

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            +  I+  +++ Y+ G   ILG E+NA   + + RKK
Sbjct: 234 SIGGIIVLMIWFYLTGTLLILGGEINA---LLHKRKK 267


>gi|30018660|ref|NP_830291.1| ribonuclease BN [Bacillus cereus ATCC 14579]
 gi|75762510|ref|ZP_00742370.1| Ribonuclease BN [Bacillus thuringiensis serovar israelensis ATCC
           35646]
 gi|206967706|ref|ZP_03228662.1| YihY family protein [Bacillus cereus AH1134]
 gi|218234197|ref|YP_002365252.1| YihY family protein [Bacillus cereus B4264]
 gi|218895526|ref|YP_002443937.1| YihY family protein [Bacillus cereus G9842]
 gi|228899127|ref|ZP_04063399.1| YihY [Bacillus thuringiensis IBL 4222]
 gi|228937697|ref|ZP_04100333.1| YihY [Bacillus thuringiensis serovar berliner ATCC 10792]
 gi|228950960|ref|ZP_04113081.1| YihY [Bacillus thuringiensis serovar kurstaki str. T03a001]
 gi|228970585|ref|ZP_04131235.1| YihY [Bacillus thuringiensis serovar thuringiensis str. T01001]
 gi|228977155|ref|ZP_04137556.1| YihY [Bacillus thuringiensis Bt407]
 gi|229042309|ref|ZP_04190060.1| YihY [Bacillus cereus AH676]
 gi|229068157|ref|ZP_04201464.1| YihY [Bacillus cereus F65185]
 gi|229077762|ref|ZP_04210390.1| YihY [Bacillus cereus Rock4-2]
 gi|229108075|ref|ZP_04237700.1| YihY [Bacillus cereus Rock1-15]
 gi|229125902|ref|ZP_04254927.1| YihY [Bacillus cereus BDRD-Cer4]
 gi|229143195|ref|ZP_04271627.1| YihY [Bacillus cereus BDRD-ST24]
 gi|229148807|ref|ZP_04277055.1| YihY [Bacillus cereus m1550]
 gi|229176994|ref|ZP_04304389.1| YihY [Bacillus cereus 172560W]
 gi|229188674|ref|ZP_04315713.1| YihY [Bacillus cereus ATCC 10876]
 gi|296501234|ref|YP_003662934.1| ribonuclease BN [Bacillus thuringiensis BMB171]
 gi|29894201|gb|AAP07492.1| Ribonuclease BN [Bacillus cereus ATCC 14579]
 gi|74490006|gb|EAO53362.1| Ribonuclease BN [Bacillus thuringiensis serovar israelensis ATCC
           35646]
 gi|206736626|gb|EDZ53773.1| YihY family protein [Bacillus cereus AH1134]
 gi|218162154|gb|ACK62146.1| YihY family protein [Bacillus cereus B4264]
 gi|218544049|gb|ACK96443.1| YihY family protein [Bacillus cereus G9842]
 gi|228594863|gb|EEK52643.1| YihY [Bacillus cereus ATCC 10876]
 gi|228606469|gb|EEK63895.1| YihY [Bacillus cereus 172560W]
 gi|228634601|gb|EEK91182.1| YihY [Bacillus cereus m1550]
 gi|228640276|gb|EEK96674.1| YihY [Bacillus cereus BDRD-ST24]
 gi|228657560|gb|EEL13373.1| YihY [Bacillus cereus BDRD-Cer4]
 gi|228675350|gb|EEL30569.1| YihY [Bacillus cereus Rock1-15]
 gi|228705553|gb|EEL57911.1| YihY [Bacillus cereus Rock4-2]
 gi|228714971|gb|EEL66839.1| YihY [Bacillus cereus F65185]
 gi|228727029|gb|EEL78235.1| YihY [Bacillus cereus AH676]
 gi|228782603|gb|EEM30780.1| YihY [Bacillus thuringiensis Bt407]
 gi|228789172|gb|EEM37101.1| YihY [Bacillus thuringiensis serovar thuringiensis str. T01001]
 gi|228808687|gb|EEM55185.1| YihY [Bacillus thuringiensis serovar kurstaki str. T03a001]
 gi|228821984|gb|EEM67976.1| YihY [Bacillus thuringiensis serovar berliner ATCC 10792]
 gi|228860568|gb|EEN04956.1| YihY [Bacillus thuringiensis IBL 4222]
 gi|296322286|gb|ADH05214.1| ribonuclease BN [Bacillus thuringiensis BMB171]
 gi|326938192|gb|AEA14088.1| ribonuclease BN [Bacillus thuringiensis serovar chinensis CT-43]
          Length = 288

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 135/271 (49%), Gaps = 16/271 (5%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH-QFVPTVIDVVFGAWPE 72
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+    + V ++++V     P+
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIPIQTEDVLSLLEVYV---PD 75

Query: 73  VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
                I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR
Sbjct: 76  DAMNLIEVNVDKVVNQQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVKETRSFITTR 135

Query: 133 LISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALG--NLLLIIWN-GRIYATML 187
            +S  + L      +I   VF  I      V     F ALG  +    +W+  R+ A+  
Sbjct: 136 ALSIVFTLA-----IIFMIVFALIVPVFGQVIGAAVFKALGLSDSFSFVWSITRLVASFF 190

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            LF    F++ F P  K K   ++ G +F  + W+V +  F +Y+  F+ Y+  Y GL  
Sbjct: 191 VLFALFSFLYTFAPDRKLKRREVISGALFATVGWIVVSYSFAYYVDKFANYANTYGGLGG 250

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           I+  +++ Y+ G   +LG E+N   +++++R
Sbjct: 251 IIILMLWFYLTGWVILLGGEING--LLHHYR 279


>gi|312112319|ref|YP_003990635.1| ribonuclease BN [Geobacillus sp. Y4.1MC1]
 gi|311217420|gb|ADP76024.1| ribonuclease BN [Geobacillus sp. Y4.1MC1]
          Length = 275

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/264 (26%), Positives = 137/264 (51%), Gaps = 12/264 (4%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG-AHQFVPTVIDVVFGAW 70
           I +    F E++   +++ ++   LLS+FPF++F   L  +L   H+    ++ V+    
Sbjct: 8   IREMARRFQEDEIPRLSAELAYYFLLSLFPFLIFLITLLAYLPIPHE---DLLSVIRQYA 64

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+     +   + +V+      L ++S + A + +SNG+ A+  + NRAY VVE R + +
Sbjct: 65  PKEAIHLVEANVHRVMDEQNGRLLSLSIIGAIWSASNGMNAIVRAFNRAYDVVENRPFLV 124

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKF-FPALG--NLLLIIWNG-RIYATM 186
            R    G  +L ++ ++++  V + +P+    +  F F A G     L IWN  R   + 
Sbjct: 125 AR----GMSVLLTIGMIVVIIVALVLPVFGKMIGLFLFSAFGFSATFLTIWNAMRWVISS 180

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           L LF     ++ F P  K +  +++ G IF  I W++ ++ F++Y+  F+ Y+ MY  L 
Sbjct: 181 LILFAVFTALYYFAPNKKLRCANVVRGAIFATIGWIITSLAFSYYVNHFAHYAAMYGSLG 240

Query: 247 SIMTCLVFLYMLGVFFILGAELNA 270
            ++  +V+ Y+ G+  +LG E+NA
Sbjct: 241 GMIILMVWFYLSGMIIVLGGEMNA 264


>gi|301052124|ref|YP_003790335.1| putative ribonuclease BN [Bacillus anthracis CI]
 gi|300374293|gb|ADK03197.1| probable ribonuclease BN [Bacillus cereus biovar anthracis str. CI]
          Length = 289

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/266 (27%), Positives = 132/266 (49%), Gaps = 6/266 (2%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++    PE 
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLLEPYVPED 76

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR 
Sbjct: 77  AMSLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVKETRSFIKTRA 136

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIG 192
           +S  + L     +V    V V   +  A V K    L +    +W+  R+ A+   LF  
Sbjct: 137 LSIVFTLAIIFMIVFALIVPVFGQVIGAAVFKVI-GLSDSFSYVWSITRLVASFFVLFAL 195

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
             F++ F P  K K   ++ G  F  + W+V +  F +Y+  F+ Y+  Y GL  I+  +
Sbjct: 196 FSFLYTFAPDRKLKRREVISGATFATVGWIVVSYSFAYYVDKFANYANTYGGLGGIIILM 255

Query: 253 VFLYMLGVFFILGAELNASMIIYYWR 278
           ++ Y+ G   +LG E+N   +++++R
Sbjct: 256 LWFYLTGWVILLGGEING--LLHHYR 279


>gi|228995781|ref|ZP_04155441.1| YihY [Bacillus mycoides Rock3-17]
 gi|229003401|ref|ZP_04161222.1| YihY [Bacillus mycoides Rock1-4]
 gi|228757849|gb|EEM07073.1| YihY [Bacillus mycoides Rock1-4]
 gi|228763942|gb|EEM12829.1| YihY [Bacillus mycoides Rock3-17]
          Length = 289

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 131/271 (48%), Gaps = 10/271 (3%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+        V+ ++    PE 
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIPIQ--TEDVLSLLEAYVPED 76

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR 
Sbjct: 77  AMNLIEVNVDKVVNEQNGGLLSFGLLSTLWFASNGVNAVMNAFNRAYDVKETRSFIATRA 136

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALG--NLLLIIWNG-RIYATMLALF 190
           +S   ++L    + ++ F  +            F ALG       +W+  R+ A+ L LF
Sbjct: 137 LS---IVLTLAMIFMIVFALIVPVFGQVIGAAVFKALGLSESFSFVWSIIRLVASFLVLF 193

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
               F++ F P  K K   ++ G +F  + W+V +  F +Y+  F+ Y+  Y GL  I+ 
Sbjct: 194 ALFSFLYTFAPDRKLKRREVISGALFATVGWIVVSYSFAYYVDKFANYANTYGGLGGIII 253

Query: 251 CLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
            +++ Y+     +LG E+N   +++++R   
Sbjct: 254 LMLWFYLTAWVILLGGEING--LLHFYRTSD 282


>gi|229165407|ref|ZP_04293191.1| YihY [Bacillus cereus AH621]
 gi|228618005|gb|EEK75046.1| YihY [Bacillus cereus AH621]
          Length = 288

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/274 (27%), Positives = 135/274 (49%), Gaps = 16/274 (5%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH-QFVPTVIDVVFGAWPE 72
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+    + V ++++V     P+
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIPIQTEDVLSLLEVYV---PD 75

Query: 73  VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
                I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR
Sbjct: 76  DAMNLIEVNVDKVVNQQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVKETRSFIKTR 135

Query: 133 LISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALG--NLLLIIWN-GRIYATML 187
            +S  + L      +I   VF  I      V     F ALG  +    +W+  R+ A+  
Sbjct: 136 ALSIVFTLA-----IIFMIVFALIVPVFGQVIGAAVFKALGLSDSFSYVWSITRLVASFF 190

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            LF    F++ F P  K K   ++ G +F  + W+V +  F +Y+  F+ Y+  Y GL  
Sbjct: 191 VLFALFSFLYTFAPDRKLKRREVISGALFATVGWIVVSYSFAYYVDKFANYANTYGGLGG 250

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
           I+  +++ Y+ G   +LG E+N   +++++R   
Sbjct: 251 IIILMLWFYLTGWVILLGGEING--LLHHYRTDD 282


>gi|228989594|ref|ZP_04149578.1| YihY [Bacillus pseudomycoides DSM 12442]
 gi|228770131|gb|EEM18711.1| YihY [Bacillus pseudomycoides DSM 12442]
          Length = 289

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 131/271 (48%), Gaps = 10/271 (3%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+        V+ ++    PE 
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIPIQ--TEDVLSLLEAYVPED 76

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR 
Sbjct: 77  AMNLIEVNVDKVVNEQNGGLLSFGLLSTLWFASNGVNAVMNAFNRAYDVKETRSFIATRA 136

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALG--NLLLIIWNG-RIYATMLALF 190
           +S   ++L    + ++ F  +            F ALG       +W+  R+ A+ L LF
Sbjct: 137 LS---IVLTLAMIFMIVFALIVPVFGQVIGAAVFKALGLSESFSFVWSIIRLVASFLVLF 193

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
               F++ F P  K K   ++ G +F  + W+V +  F +Y+  F+ Y+  Y GL  I+ 
Sbjct: 194 ALFSFLYTFAPDRKLKRREVISGALFATVGWIVVSYSFAYYVDKFANYANTYGGLGGIII 253

Query: 251 CLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
            +++ Y+     +LG E+N   +++++R   
Sbjct: 254 LMLWFYLTAWVILLGGEING--LLHFYRTSD 282


>gi|125974669|ref|YP_001038579.1| putative ribonuclease BN [Clostridium thermocellum ATCC 27405]
 gi|256004132|ref|ZP_05429116.1| ribonuclease BN [Clostridium thermocellum DSM 2360]
 gi|281418859|ref|ZP_06249878.1| ribonuclease BN [Clostridium thermocellum JW20]
 gi|125714894|gb|ABN53386.1| putative ribonuclease BN [Clostridium thermocellum ATCC 27405]
 gi|255991880|gb|EEU01978.1| ribonuclease BN [Clostridium thermocellum DSM 2360]
 gi|281407943|gb|EFB38202.1| ribonuclease BN [Clostridium thermocellum JW20]
 gi|316941794|gb|ADU75828.1| ribonuclease BN [Clostridium thermocellum DSM 1313]
          Length = 276

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 137/277 (49%), Gaps = 30/277 (10%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFL-----GAHQFVPTVID 64
           +II D      ++D  A+A+ ++   +L++FPF++F   L  +       A  F   ++ 
Sbjct: 11  EIIKDIYTRSRDDDVPALAAQLTYYFILALFPFLIFLITLLSYTPITGEEAMNFFARIL- 69

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
                 P +    + D + ++ A P +   +   +AA + SSNG++A+   +N+AY   E
Sbjct: 70  ------PPLAFNAVLDVVNEITASPRETFLSFGMIAALWASSNGMKAVIRGINKAYDQKE 123

Query: 125 MRSWYITRLISFGYVLLASVT----LVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
            R +++ RLIS   V++ + T    L ++ F   A      + R  FP        I+ G
Sbjct: 124 TRPFWMVRLISLVAVIILAFTVIFSLALLLFGETAEKELFYHFR--FPN-------IYRG 174

Query: 181 -----RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF 235
                R    ++ +F   I +++  P+ +  +  +LPG  F+ +SW++   LF+ YI  F
Sbjct: 175 VCTTVRFLLPVILMFCVFILLYMLTPSRRLSLKEVLPGSAFSALSWILVTTLFSLYINNF 234

Query: 236 STYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           + +S MY  +  I+  LV+LY + +  +LG ELNAS+
Sbjct: 235 ADFSKMYGSIGGIIALLVWLYWISIIIMLGGELNASL 271


>gi|295400591|ref|ZP_06810569.1| ribonuclease BN [Geobacillus thermoglucosidasius C56-YS93]
 gi|294977494|gb|EFG53094.1| ribonuclease BN [Geobacillus thermoglucosidasius C56-YS93]
          Length = 275

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/264 (26%), Positives = 137/264 (51%), Gaps = 12/264 (4%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG-AHQFVPTVIDVVFGAW 70
           I +    F E++   +++ ++   LLS+FPF++F   L  +L   H+    ++ V+    
Sbjct: 8   IREMARRFQEDEIPRLSAELAYYFLLSLFPFLIFLITLLAYLPIPHE---DLLSVIRQYA 64

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+     +   + +V+      L ++S + A + +SNG+ A+  + NRAY VVE R + +
Sbjct: 65  PKEAIHLVEANVHRVMDEQNGRLLSLSIIGAIWSASNGMNAIVRAFNRAYDVVENRPFLV 124

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKF-FPALG--NLLLIIWNG-RIYATM 186
            R    G  +L ++ ++++  V + +P+    +  F F A G     L IWN  R   + 
Sbjct: 125 AR----GMSVLLTLGMIVVIIVALVLPVFGKMIGLFLFSAFGFSATFLTIWNAMRWVISS 180

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           L LF     ++ F P  K +  +++ G IF  I W++ ++ F++Y+  F+ Y+ MY  L 
Sbjct: 181 LILFAVFTALYYFAPNKKLRCANVVRGAIFATIGWIITSLAFSYYVNHFAHYAAMYGSLG 240

Query: 247 SIMTCLVFLYMLGVFFILGAELNA 270
            ++  +V+ Y+ G+  +LG E+NA
Sbjct: 241 GMIILMVWFYLSGMIIVLGGEMNA 264


>gi|328552413|gb|AEB22905.1| integral inner membrane protein with ribonuclease fold [Bacillus
           amyloliquefaciens TA208]
 gi|328910764|gb|AEB62360.1| putative integral inner membrane protein with ribonuclease fold
           [Bacillus amyloliquefaciens LL3]
          Length = 279

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 133/271 (49%), Gaps = 21/271 (7%)

Query: 18  HFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPE----- 72
            F   +G + ++ ++   LLS+FP I+F   L  +L      P   + V GA  +     
Sbjct: 10  RFSLHEGQSKSAELAYFFLLSLFPLIIFILTLTAYL------PISAEDVLGAVDQYAPDS 63

Query: 73  --VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
              + K IT+   Q L   + GL +   +A  + +SNG+ A+  + N AY V E RS+ I
Sbjct: 64  AMSMVKSITE---QTLNKRSGGLLSFGIIAVIWSASNGMNAIVRAFNHAYEVEENRSFII 120

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLAL 189
            RL S  ++ +A V  ++++ +       +  +   F     L L +W+  R   + L L
Sbjct: 121 IRLTSI-FLTIAMVVTILIALLLPVFGREIGLLAADFIGAPGLFLQVWSVVRWGISPLIL 179

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            I    +++F P  +  +  +LPG +F    W++ ++LF+ Y+ TF+ YS  Y  +  I+
Sbjct: 180 LIVFTALYIFAPNKRLSLRFVLPGAVFAAAGWIIVSMLFSFYVGTFANYSATYGSIGGII 239

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             +++ Y+ G   ILG E+NA   + + RKK
Sbjct: 240 VLMIWFYLTGTLLILGGEINA---LLHKRKK 267


>gi|308172652|ref|YP_003919357.1| integral inner membrane protein [Bacillus amyloliquefaciens DSM 7]
 gi|307605516|emb|CBI41887.1| putative integral inner membrane protein with ribonuclease fold
           [Bacillus amyloliquefaciens DSM 7]
          Length = 279

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 133/271 (49%), Gaps = 21/271 (7%)

Query: 18  HFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPE----- 72
            F   +G + ++ ++   LLS+FP I+F   L  +L      P   + V GA  +     
Sbjct: 10  RFSLHEGQSKSAELAYFFLLSLFPLIIFILTLTAYL------PISAEDVLGAVDQYAPDS 63

Query: 73  --VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
              + K IT+   Q L   + GL +   +A  + +SNG+ A+  + N AY V E RS+ I
Sbjct: 64  AMSMVKSITE---QTLNKRSGGLLSFGIIAVIWSASNGMNAIVRAFNHAYEVEENRSFII 120

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLAL 189
            RL S  ++ +A V  ++++ +       +  +   F     L L +W+  R   + L L
Sbjct: 121 LRLTSI-FLTIAMVVTILIALLLPVFGREIGLLAADFIGAPGLFLKVWSVVRWGISPLIL 179

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            I    +++F P  +  +  +LPG +F    W++ ++LF+ Y+ TF+ YS  Y  +  I+
Sbjct: 180 LIVFTALYIFAPNKRLSLRFVLPGAVFAAAGWIIVSMLFSFYVGTFANYSATYGSIGGII 239

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             +++ Y+ G   ILG E+NA   + + RKK
Sbjct: 240 VLMIWFYLTGTLLILGGEINA---LLHKRKK 267


>gi|196040219|ref|ZP_03107521.1| YihY family protein [Bacillus cereus NVH0597-99]
 gi|196029074|gb|EDX67679.1| YihY family protein [Bacillus cereus NVH0597-99]
          Length = 289

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 132/270 (48%), Gaps = 14/270 (5%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++    PE 
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLLEPYVPED 76

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR 
Sbjct: 77  AMSLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVKETRSFIKTRA 136

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALG--NLLLIIWN-GRIYATMLA 188
           +S  + L      +I   VF  I      V     F  +G  +    +W+  R+ A+   
Sbjct: 137 LSIVFTLA-----IIFMIVFALIVPVFGQVIGAAVFKEIGLSDSFSYVWSITRLVASFFV 191

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LF    F++ F P  K K   ++ G  F  + W+V +  F +Y+  F+ Y+  Y GL  I
Sbjct: 192 LFALFSFLYTFAPDRKLKRREVISGATFATVGWIVVSYSFAYYVDKFANYANTYGGLGGI 251

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           +  +++ Y+ G   +LG E+N   +++++R
Sbjct: 252 IILMLWFYLTGWVILLGGEING--LLHHYR 279


>gi|168212796|ref|ZP_02638421.1| YihY family protein [Clostridium perfringens CPE str. F4969]
 gi|170715733|gb|EDT27915.1| YihY family protein [Clostridium perfringens CPE str. F4969]
          Length = 283

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 131/256 (51%), Gaps = 4/256 (1%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           I+   ++D +A+ + ++   +LS  PF++F   L GF  +H     V++++    P    
Sbjct: 20  IKKIGDDDIFALGAQLAYYMVLSFIPFLMFLMTLVGF--SHLNSDAVLNLLSNVMPTEAF 77

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
             I   +++++     GL  IS   A + SS+G +A+   LN+AY V E RS+   +LIS
Sbjct: 78  NLIQSTVIEIVDREQTGLLWISIALAIWVSSSGFKAVIKGLNKAYGVKETRSYIKLKLIS 137

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGLI 194
             Y +L ++ ++   F+FV   +   +  K       L+  IWN  R    +L + +  +
Sbjct: 138 MIYTILLALIVIATLFLFVFGDVIGDFFMKVLEH-PELIYYIWNILRYVVVILIMILFFM 196

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
           F++   P  +   + ++PG + T + W+  + +F +Y+  FS YS +Y  L ++   + +
Sbjct: 197 FLYNATPCVRLGWLEVIPGAVITTLGWISISYIFAYYVNNFSNYSRLYGSLGAVFMFMTW 256

Query: 255 LYMLGVFFILGAELNA 270
           +++  +  ILG E+NA
Sbjct: 257 MFITSMILILGGEINA 272


>gi|170755009|ref|YP_001783041.1| YihY family protein [Clostridium botulinum B1 str. Okra]
 gi|169120221|gb|ACA44057.1| YihY family protein [Clostridium botulinum B1 str. Okra]
          Length = 285

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/264 (26%), Positives = 134/264 (50%), Gaps = 16/264 (6%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA---WPEV 73
             F+E++  A++S ++ + ++SVFPF++F   L G+L  H       D++ G     P  
Sbjct: 18  NRFLEDEVLALSSQLAYALIISVFPFLMFVITLIGYLPIHSE-----DLLLGLKEIMPSN 72

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               + + I +++      L + S +   + +S G  A+   LNRAY V E RS+   ++
Sbjct: 73  TYLLLKNTIEEIIYTQNGNLLSFSIIFTIWTASAGFRAVVRGLNRAYDVKERRSFIKVQI 132

Query: 134 ISFGYVLLASVTLVIMSFVFV---AIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
           ++    L  +  LV+  F+ V    I   L Y   F          IWN   Y  M+ + 
Sbjct: 133 MTIFCTLGMAFVLVMSIFLLVFGKTIGRTLVYKLGFSLEFNR----IWNLIRYIIMIGVT 188

Query: 191 IGLIF-VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           I ++  ++ + P+ + + M +LPG IF  I+W++ ++ F+ Y+  F+ YS +Y  + +++
Sbjct: 189 IFILAALYYYTPSKRLRWMDVLPGAIFATIAWIIASMGFSFYVDNFNNYSRLYGSIGAVI 248

Query: 250 TCLVFLYMLGVFFILGAELNASMI 273
             LV+LY+  +  I G E+NA ++
Sbjct: 249 VFLVWLYLTSIIVITGGEINALLV 272


>gi|52079254|ref|YP_078045.1| RNase YfkH [Bacillus licheniformis ATCC 14580]
 gi|52784619|ref|YP_090448.1| YfkH [Bacillus licheniformis ATCC 14580]
 gi|319646964|ref|ZP_08001192.1| YfkH protein [Bacillus sp. BT1B_CT2]
 gi|52002465|gb|AAU22407.1| Possible RNase YfkH [Bacillus licheniformis ATCC 14580]
 gi|52347121|gb|AAU39755.1| YfkH [Bacillus licheniformis ATCC 14580]
 gi|317391023|gb|EFV71822.1| YfkH protein [Bacillus sp. BT1B_CT2]
          Length = 271

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 76/264 (28%), Positives = 123/264 (46%), Gaps = 22/264 (8%)

Query: 19  FVEEDGWAMASHISLSA--------LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           F++E GW    H   S         LLS+FPF++F   L G+L      P     V G  
Sbjct: 3   FLKELGWRFFLHEGPSKSAELAYFFLLSLFPFMIFLLTLIGYL------PVKTGDVIGLI 56

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
            +   +     I + L    +GL +   +AA + +SNG+ A+  + N AY V E RS+ +
Sbjct: 57  EQYAPEDTMSVIEETLNTGNRGLLSFGIIAALWSASNGLNAIVRAFNHAYEVEENRSFIM 116

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALG---NLLLIIWNG-RIYATM 186
            RL S    LL +  +V    V + +P+    +  F   L     + L  W+  R   + 
Sbjct: 117 VRLTS----LLLTAAMVFTILVALLLPVFGRAIGHFIANLDGTPEMFLTAWSALRWGISP 172

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           L L I    ++ F P  +     +LPG +     W++ +VLF++Y+  F+ YS  Y  L 
Sbjct: 173 LVLLIVFTALYFFAPNKRLSFKFVLPGAVAATAGWILVSVLFSYYVSEFANYSATYGSLG 232

Query: 247 SIMTCLVFLYMLGVFFILGAELNA 270
            I+  +++ Y+ G+  ILG E+NA
Sbjct: 233 GIIVLMIWFYLSGMMIILGGEINA 256


>gi|163938399|ref|YP_001643283.1| putative ribonuclease BN [Bacillus weihenstephanensis KBAB4]
 gi|229056246|ref|ZP_04195667.1| YihY [Bacillus cereus AH603]
 gi|163860596|gb|ABY41655.1| putative ribonuclease BN [Bacillus weihenstephanensis KBAB4]
 gi|228721051|gb|EEL72589.1| YihY [Bacillus cereus AH603]
          Length = 289

 Score = 93.2 bits (230), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 132/270 (48%), Gaps = 14/270 (5%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++    PE 
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLLEPYVPED 76

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR 
Sbjct: 77  AMNLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETRSFIKTRA 136

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALG--NLLLIIWN-GRIYATMLA 188
           +S  + L      +I   VF  I      V     F A+G  +    +W+  R+ A+   
Sbjct: 137 LSIVFTLA-----IIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASFFV 191

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           L     F++ F P  K K   ++ G IF  + W+V +  F +Y+  F+ Y+  Y GL  I
Sbjct: 192 LIALFSFLYTFAPDRKLKRREVISGAIFATVGWIVVSYSFAYYVDKFANYANTYGGLGGI 251

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           +  +++ Y+     +LG E+N   +++++R
Sbjct: 252 IILMLWFYLTAWVILLGGEING--LLHHYR 279


>gi|229131406|ref|ZP_04260303.1| YihY [Bacillus cereus BDRD-ST196]
 gi|228652052|gb|EEL07992.1| YihY [Bacillus cereus BDRD-ST196]
          Length = 289

 Score = 93.2 bits (230), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 132/270 (48%), Gaps = 14/270 (5%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++    PE 
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLLEPYVPED 76

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR 
Sbjct: 77  AMNLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETRSFIKTRA 136

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALG--NLLLIIWN-GRIYATMLA 188
           +S  + L      +I   VF  I      V     F A+G  +    +W+  R+ A+   
Sbjct: 137 LSIVFTLA-----IIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASFFV 191

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           L     F++ F P  K K   ++ G IF  + W+V +  F +Y+  F+ Y+  Y GL  I
Sbjct: 192 LIALFSFLYTFAPDRKLKRREVISGAIFATVGWIVVSYSFAYYVDKFANYANTYGGLGGI 251

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           +  +++ Y+     +LG E+N   +++++R
Sbjct: 252 IILMLWFYLTAWVILLGGEING--LLHHYR 279


>gi|187776658|ref|ZP_02993131.1| hypothetical protein CLOSPO_00173 [Clostridium sporogenes ATCC
           15579]
 gi|187775317|gb|EDU39119.1| hypothetical protein CLOSPO_00173 [Clostridium sporogenes ATCC
           15579]
          Length = 285

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 141/280 (50%), Gaps = 18/280 (6%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +  F I+   I +    F+E++  A++S ++ + ++SVFPF++F   L G+L  H     
Sbjct: 3   KNLFKIIPKGIKELTNRFLEDEVLALSSQLAYALIISVFPFLMFVITLIGYLPIHSE--- 59

Query: 62  VIDVVFGAWPEVIAKP----ITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLN 117
             D++ G   E+I       + + I +++      L + S +   + +S G  A+   LN
Sbjct: 60  --DLLLGL-KEIIPSNAYLLLKNTIEEIIYTQNGNLLSFSIIFTIWTASAGFRAVVRGLN 116

Query: 118 RAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFV---AIPLALAYVRKFFPALGNLL 174
           +AY V E RS+   ++++    L  +  LV+  F+ V    I   L Y   F        
Sbjct: 117 KAYDVKERRSFVKVQIMTIFCTLGMAFVLVMSIFLLVFGRTIGRTLVYKLGFSWEFNR-- 174

Query: 175 LIIWNGRIYATMLALFIGLIF-VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIV 233
             IWN   Y  M+ + I ++  ++ + P+ + +   +LPG IF  I+W++ ++ F+ Y+ 
Sbjct: 175 --IWNLIRYTIMIGVTIFILAALYYYTPSKRLRWRDVLPGSIFATIAWIIASMGFSFYVD 232

Query: 234 TFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
            F+ YS +Y  + +++  LV+LY+  +  I G E+NA ++
Sbjct: 233 NFNNYSRLYGSIGAVIVFLVWLYLTSIIVITGGEINALLV 272


>gi|18309267|ref|NP_561201.1| YihY family protein [Clostridium perfringens str. 13]
 gi|110799841|ref|YP_694741.1| YihY family protein [Clostridium perfringens ATCC 13124]
 gi|168207453|ref|ZP_02633458.1| YihY family protein [Clostridium perfringens E str. JGS1987]
 gi|168210398|ref|ZP_02636023.1| YihY family protein [Clostridium perfringens B str. ATCC 3626]
 gi|18143943|dbj|BAB79991.1| conserved hypothetical protein [Clostridium perfringens str. 13]
 gi|110674488|gb|ABG83475.1| YihY family protein [Clostridium perfringens ATCC 13124]
 gi|170661202|gb|EDT13885.1| YihY family protein [Clostridium perfringens E str. JGS1987]
 gi|170711461|gb|EDT23643.1| YihY family protein [Clostridium perfringens B str. ATCC 3626]
          Length = 283

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 130/256 (50%), Gaps = 4/256 (1%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           I+   ++D +A+ + ++   +LS  PF++F   L GF  +H     V++++    P    
Sbjct: 20  IKKIGDDDIFALGAQLAYYMVLSFIPFLMFLMTLVGF--SHLNSDAVLNLLSNVMPTEAF 77

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
             I   +++++     GL  IS   A + SS+G +A+   LN+AY V E RS+   +LIS
Sbjct: 78  NLIQSTVIEIVDREQTGLLWISIALAIWVSSSGFKAVIKGLNKAYGVKETRSYIKLKLIS 137

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLI 194
             Y +L ++ ++   F+FV   +   +  K        +  IWN  R    +L + +  +
Sbjct: 138 MIYTILLALIVIATLFLFVFGDVIGDFFMKVLEH-PEFIYYIWNMLRYVVVILIMILFFM 196

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
           F++   P  +   + ++PG + T + W+  + +F +Y+  FS YS +Y  L ++   + +
Sbjct: 197 FLYNATPCVRLGWLEVIPGAVITTLGWISISYIFAYYVNNFSNYSRLYGSLGAVFMFMTW 256

Query: 255 LYMLGVFFILGAELNA 270
           +++  +  ILG E+NA
Sbjct: 257 MFITSMILILGGEINA 272


>gi|56416749|ref|YP_153823.1| hypothetical protein AM555 [Anaplasma marginale str. St. Maries]
 gi|222475113|ref|YP_002563529.1| hypothetical protein AMF_412 [Anaplasma marginale str. Florida]
 gi|56387981|gb|AAV86568.1| hypothetical protein AM555 [Anaplasma marginale str. St. Maries]
 gi|222419250|gb|ACM49273.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 295

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 126/260 (48%), Gaps = 12/260 (4%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVF----GANLAGFLGAHQ-FVPTVIDVVFGA 69
           AI  F   DG   + +++   LL+ FPF+VF     +     L  H+ F+  ++  +   
Sbjct: 36  AIADFRRHDGLVYSGYLAFIFLLATFPFLVFFTAMTSTALNVLDKHEDFLQGLVTSLLSE 95

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P      +   I ++L+ P + L T++ +   + +S+ +E +R  LN+A+RV     + 
Sbjct: 96  LPHETIAALLPRINEILSGPPQSLLTVAVVGIVWTASSAIEGMRTVLNKAFRVSAPPPYI 155

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + R++S    L+  + ++      V +P+ L  + + +  LG +        +   +L L
Sbjct: 156 LGRMLSILQFLVIVLVMMFSVLFIVFVPIVLDVLDQKWGYLGYI-----KYTLSEVILCL 210

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + L++    +P  + +I  ILPG +   I W   +  F+ Y+  F    TMY  L+ I+
Sbjct: 211 SVALLY--FMVPNTRQRIGVILPGAVVVTILWTASSFTFSWYLSNFRVLHTMYGNLSGII 268

Query: 250 TCLVFLYMLGVFFILGAELN 269
             ++F Y+L +FFI GAEL+
Sbjct: 269 ASMLFFYILSIFFIYGAELS 288


>gi|255004219|ref|ZP_05279020.1| hypothetical protein AmarV_02438 [Anaplasma marginale str.
           Virginia]
          Length = 281

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 126/260 (48%), Gaps = 12/260 (4%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLA----GFLGAHQ-FVPTVIDVVFGA 69
           AI  F   DG   + +++   LL+ FPF+VF   +       L  H+ F+  ++  +   
Sbjct: 22  AIADFRRHDGLVYSGYLAFIFLLATFPFLVFFTAMTSTALNVLDKHEDFLQGLVTSLLSE 81

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P      +   I ++L+ P + L T++ +   + +S+ +E +R  LN+A+RV     + 
Sbjct: 82  LPHETIAALLPRINEILSGPPQSLLTVAVVGIVWTASSAIEGMRTVLNKAFRVSAPPPYI 141

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + R++S    L+  + ++      V +P+ L  + + +  LG +        +   +L L
Sbjct: 142 LGRMLSILQFLVIVLVMMFSVLFIVFVPIVLDVLDQKWGYLGYI-----KYTLSEVILCL 196

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + L++    +P  + +I  ILPG +   I W   +  F+ Y+  F    TMY  L+ I+
Sbjct: 197 SVALLY--FMVPNTRQRIGVILPGAVVVTILWTASSFTFSWYLSNFRVLHTMYGNLSGII 254

Query: 250 TCLVFLYMLGVFFILGAELN 269
             ++F Y+L +FFI GAEL+
Sbjct: 255 ASMLFFYILSIFFIYGAELS 274


>gi|169344091|ref|ZP_02865077.1| YihY family protein [Clostridium perfringens C str. JGS1495]
 gi|169297826|gb|EDS79923.1| YihY family protein [Clostridium perfringens C str. JGS1495]
          Length = 283

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 130/256 (50%), Gaps = 4/256 (1%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           I+   ++D +A+ + ++   +LS  PF++F   L GF  +H     V++++    P    
Sbjct: 20  IKKIGDDDIFALGAQLAYYMVLSFIPFLMFLMTLVGF--SHLNSDAVLNLLSNVMPTEAF 77

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
             I   +++++     GL  IS   A + SS+G +A+   LN+AY V E RS+   +LIS
Sbjct: 78  NLIQSTVIEIVDREQTGLLWISIALAIWVSSSGFKAVIKGLNKAYGVKENRSYIKLKLIS 137

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLI 194
             Y +L ++ ++   F+FV   +   +  K        +  IWN  R    +L + +  +
Sbjct: 138 MIYTILLALIVIATLFLFVFGDVIGDFFMKVLEH-PEFIYYIWNMLRYVVVILIMILFFM 196

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
           F++   P  +   + ++PG + T + W+  + +F +Y+  FS YS +Y  L ++   + +
Sbjct: 197 FLYNATPCVRLGWLEVIPGAVITTLGWISISYIFAYYVNNFSNYSRLYGSLGAVFMFMTW 256

Query: 255 LYMLGVFFILGAELNA 270
           +++  +  ILG E+NA
Sbjct: 257 MFITSMILILGGEINA 272


>gi|226950854|ref|YP_002805945.1| YihY family protein [Clostridium botulinum A2 str. Kyoto]
 gi|226843946|gb|ACO86612.1| YihY family protein [Clostridium botulinum A2 str. Kyoto]
 gi|322807727|emb|CBZ05302.1| ribonuclease BN [Clostridium botulinum H04402 065]
          Length = 285

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 138/279 (49%), Gaps = 16/279 (5%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +  F I+   I      F+E++  A++S ++ + ++SVFPF++F   L G+L  H     
Sbjct: 3   KNLFKIIPKSIKKLANRFLEDEVLALSSQLAYALIISVFPFLMFVITLIGYLPIHSE--- 59

Query: 62  VIDVVFGA---WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNR 118
             D++ G     P      + + I +++      L + S +   + +S G  A+   LNR
Sbjct: 60  --DLLLGLKEIMPSNTYLLLKNTIEEIIYTQNGNLLSFSIIFTIWTASAGFRAVVRGLNR 117

Query: 119 AYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFV---AIPLALAYVRKFFPALGNLLL 175
           AY V E RS+   ++++    L  +  LV+  F+ V    I   L Y   F         
Sbjct: 118 AYDVKERRSFVKVQIMTIFCTLGMAFVLVMSIFLLVFGKTIGRTLVYKLGFSLEFNR--- 174

Query: 176 IIWNGRIYATMLALFIGLIF-VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVT 234
            IWN   Y  M+ + I ++  ++ + P+ + +   +LPG IF  I+W++ ++ F+ Y+  
Sbjct: 175 -IWNLIRYIIMIGVTIFILAALYYYTPSKRLRWRDVLPGAIFATIAWIIASMGFSFYVDN 233

Query: 235 FSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
           F+ YS +Y  + +++  LV+LY+  +  I G E+NA ++
Sbjct: 234 FNNYSRLYGSIGAVIVFLVWLYLTSIIVITGGEINALLV 272


>gi|168216626|ref|ZP_02642251.1| YihY family protein [Clostridium perfringens NCTC 8239]
 gi|182626819|ref|ZP_02954556.1| YihY family protein [Clostridium perfringens D str. JGS1721]
 gi|177907828|gb|EDT70428.1| YihY family protein [Clostridium perfringens D str. JGS1721]
 gi|182381516|gb|EDT78995.1| YihY family protein [Clostridium perfringens NCTC 8239]
          Length = 283

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 130/256 (50%), Gaps = 4/256 (1%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           I+   ++D +A+ + ++   +LS  PF++F   L GF  +H     V++++    P    
Sbjct: 20  IKKIGDDDIFALGAQLAYYMVLSFIPFLMFLMTLVGF--SHLNSDAVLNLLSNVMPTEAF 77

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
             I   +++++     GL  IS   A + SS+G +A+   LN+AY V E RS+   +LIS
Sbjct: 78  NLIQSTVIEIVDREQTGLLWISIALAIWVSSSGFKAVIKGLNKAYGVKETRSYIKLKLIS 137

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGLI 194
             Y +L ++ ++   F+FV   +   +  K        +  IWN  R    +L + +  +
Sbjct: 138 MIYTILLALIVIATLFLFVFGDVIGDFFMKVLEH-PEFIYYIWNILRYVVVILIMILFFM 196

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
           F++   P  +   + ++PG + T + W+  + +F +Y+  FS YS +Y  L ++   + +
Sbjct: 197 FLYNATPCVRLGWLEVIPGAVITTLGWISISYIFAYYVNNFSNYSRLYGSLGAVFMFMTW 256

Query: 255 LYMLGVFFILGAELNA 270
           +++  +  ILG E+NA
Sbjct: 257 MFITSMILILGGEINA 272


>gi|170760762|ref|YP_001788733.1| YihY family protein [Clostridium botulinum A3 str. Loch Maree]
 gi|169407751|gb|ACA56162.1| YihY family protein [Clostridium botulinum A3 str. Loch Maree]
          Length = 285

 Score = 92.0 bits (227), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 70/264 (26%), Positives = 134/264 (50%), Gaps = 16/264 (6%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA---WPEV 73
             F+E++  A++S ++ + ++SVFPF++F   L G+L  H       D++ G     P  
Sbjct: 18  NRFLEDEVLALSSQLAYALIISVFPFLMFVITLIGYLPIHSE-----DLLLGLKEIMPSN 72

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               + + I +++      L + S +   + +S G  A+   LNRAY V E RS+   ++
Sbjct: 73  TYLLLKNTIEEIIYTQNGNLLSFSIIFTIWTASAGFRAVVRGLNRAYDVKERRSFVKVQI 132

Query: 134 ISFGYVLLASVTLVIMSFVFV---AIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
           ++    L  +  LV+  F+ V    I   L Y   F          IWN   Y  M+ + 
Sbjct: 133 MTIFCTLGMAFVLVMSIFLLVFGKTIGRTLVYKLGFSLEFNR----IWNLIRYIIMIGVT 188

Query: 191 IGLIF-VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           I ++  ++ + P+ + +   +LPG IF+ I+W++ ++ F+ Y+  F+ YS +Y  + +++
Sbjct: 189 IFILAALYYYTPSKRLRWRDVLPGAIFSTIAWIIASMGFSFYVDNFNNYSRLYGSIGAVI 248

Query: 250 TCLVFLYMLGVFFILGAELNASMI 273
             LV+LY+  +  I G E+NA ++
Sbjct: 249 VFLVWLYLTSIIVITGGEINALLV 272


>gi|163790741|ref|ZP_02185168.1| ribonuclease BN, putative [Carnobacterium sp. AT7]
 gi|159874042|gb|EDP68119.1| ribonuclease BN, putative [Carnobacterium sp. AT7]
          Length = 313

 Score = 92.0 bits (227), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 130/262 (49%), Gaps = 6/262 (2%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGF--LGAHQFVPTVIDVVFGAWPEV 73
           ++ + E + W   + IS   LLS+FP IV   N+  +  L A + +P + + V    P  
Sbjct: 29  VQKYREAEVWNSGAIISYYFLLSIFPVIVVIGNVLPYFRLDAAELLPYIENAV----PNY 84

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               + D +       + G+ +I+ + A + +S G+ A+++S+N+AY V   R+  I RL
Sbjct: 85  FFDQVEDVLTSWFTRSSGGILSIAVIGALWSASRGMTAMQVSMNKAYGVEPRRNIVIIRL 144

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGL 193
            S     L  V+++++  VF    L L Y+         +     + R   TM+ LFI  
Sbjct: 145 FSLILTTLLIVSIMLLVIVFGFGQLILEYITPIIDIPLTISETFQSLRWPVTMIVLFIIF 204

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++ F+P AK    S+LPG  F+ I W++ + +F  Y+  F+  +  Y  + + M  L+
Sbjct: 205 CLLYYFVPHAKIAFKSVLPGAAFSTIGWMLVSQVFAVYVEYFAIGTKSYGTIGTFMIMLI 264

Query: 254 FLYMLGVFFILGAELNASMIIY 275
           +L ++G     GA +NA++ +Y
Sbjct: 265 WLQVIGALMTAGAVINAAIDVY 286


>gi|162456942|ref|YP_001619309.1| hypothetical protein sce8659 [Sorangium cellulosum 'So ce 56']
 gi|161167524|emb|CAN98829.1| hypothetical protein sce8659 [Sorangium cellulosum 'So ce 56']
          Length = 337

 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 67/261 (25%), Positives = 131/261 (50%), Gaps = 7/261 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D + D  +  +++    +A+ ++   +L++FPF++F   LAG +        ++  ++  
Sbjct: 12  DFLNDIKQECIKDKIDTIAASLAFFGVLAIFPFLLFAVALAGLVIDPAESAQLMSELYQV 71

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P  +A  + + +  +    +  L T+ AL A + +S GV AL  +LN AY V + RS+ 
Sbjct: 72  APPAVANILGERLQALTGGQSPALLTVGALGAVWAASGGVTALMDALNSAYGVEDKRSYL 131

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
             R I+    L  +V L I S + VA P   A++  F        L++W  R+  + L +
Sbjct: 132 KRRGIALLVTLGGAVLLTIASALAVATPALAAHLGPFA------TLVLWL-RMPVSALIV 184

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + L  ++  LP  + +   I PG +   + WV+ ++ F+ Y+  F +Y   Y  L  ++
Sbjct: 185 MVVLATLYYLLPDVEQQFKFITPGSVVAVVIWVLASLGFSFYVSRFGSYEVSYGALGGVI 244

Query: 250 TCLVFLYMLGVFFILGAELNA 270
             L+++++  +  +LGAE+NA
Sbjct: 245 ILLLWMWISSLAVLLGAEINA 265


>gi|229009893|ref|ZP_04167112.1| YihY [Bacillus mycoides DSM 2048]
 gi|228751324|gb|EEM01131.1| YihY [Bacillus mycoides DSM 2048]
          Length = 289

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 134/271 (49%), Gaps = 16/271 (5%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH-QFVPTVIDVVFGAWPE 72
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+    + V ++++V     P+
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIPIQTEDVLSLLEVYV---PD 75

Query: 73  VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
                I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR
Sbjct: 76  DAMNLIEVNVDKVVNQQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETRSFIKTR 135

Query: 133 LISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALG--NLLLIIWN-GRIYATML 187
            +S  + L      +I   VF  I      V     F A+G  +    +W+  R+ A+  
Sbjct: 136 ALSIVFTLA-----IIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASFF 190

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            L     F++ F P  K K   ++ G +F  I W+V +  F +Y+  F+ Y+  Y GL  
Sbjct: 191 VLIALFSFLYTFAPDRKLKRREVVSGALFATIGWIVVSYSFAYYVDKFANYANTYGGLGG 250

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           I+  +++ Y+ G   +LG E+N   +++++R
Sbjct: 251 IIILMLWFYLTGWVILLGGEING--LLHHYR 279


>gi|153939153|ref|YP_001392760.1| YihY family protein [Clostridium botulinum F str. Langeland]
 gi|152935049|gb|ABS40547.1| YihY family protein [Clostridium botulinum F str. Langeland]
 gi|295320739|gb|ADG01117.1| YihY family protein [Clostridium botulinum F str. 230613]
          Length = 285

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/264 (26%), Positives = 133/264 (50%), Gaps = 16/264 (6%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA---WPEV 73
             F+E++  A++S ++ + ++SVFPF++F   L G+L  H       D++ G     P  
Sbjct: 18  NRFLEDEVLALSSQLAYALIISVFPFLMFVITLIGYLPIHSE-----DLLLGLKEIMPSN 72

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               + + I +++      L + S +   + +S G  A+   LNRAY V E RS+   ++
Sbjct: 73  TYLLLKNTIEEIIYTQNGNLLSFSIIFTIWTASAGFRAVVRGLNRAYDVKERRSFVKVQI 132

Query: 134 ISFGYVLLASVTLVIMSFVFV---AIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
           ++    L  +  LV+  F+ V    I   L Y   F          IWN   Y  M+ + 
Sbjct: 133 MTIFCTLGMAFVLVMSIFLLVFGKTIGRTLVYKLGFSLEFNR----IWNLIRYIIMIGVT 188

Query: 191 IGLIF-VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           I ++  ++ + P+ + +   +LPG IF  I+W++ ++ F+ Y+  F+ YS +Y  + +++
Sbjct: 189 IFILAALYYYTPSKRLRWRDVLPGAIFATIAWIIASMGFSFYVDNFNNYSRLYGSIGAVI 248

Query: 250 TCLVFLYMLGVFFILGAELNASMI 273
             LV+LY+  +  I G E+NA ++
Sbjct: 249 VFLVWLYLTSIIVITGGEINALLV 272


>gi|168178914|ref|ZP_02613578.1| YihY family protein [Clostridium botulinum NCTC 2916]
 gi|182670173|gb|EDT82149.1| YihY family protein [Clostridium botulinum NCTC 2916]
          Length = 285

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/264 (26%), Positives = 133/264 (50%), Gaps = 16/264 (6%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA---WPEV 73
             F+E++  A++S ++ + ++SVFPF++F   L G+L  H       D++ G     P  
Sbjct: 18  NRFLEDEVLALSSQLAYALIISVFPFLMFVITLIGYLPIHSE-----DLLLGLKEIMPSN 72

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               + + I +++      L + S +   + +S G  A+   LNRAY V E RS+   ++
Sbjct: 73  TYLLLKNTIEEIIYTQNGNLLSFSIIFTIWTASAGFRAVVRGLNRAYDVKERRSFVKVQI 132

Query: 134 ISFGYVLLASVTLVIMSFVFV---AIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
           ++    L  +  LV+  F+ V    I   L Y   F          IWN   Y  M+ + 
Sbjct: 133 MTIFCTLGMAFVLVMSIFLLVFGKTIGRTLVYKLGFSLEFNR----IWNLIRYIIMIGVT 188

Query: 191 IGLIF-VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           I ++  ++ + P+ + +   +LPG IF  I+W++ ++ F+ Y+  F+ YS +Y  + +++
Sbjct: 189 IFILAALYYYTPSKRLRWRDVLPGAIFATIAWIIASMGFSFYVDNFNNYSRLYGSIGAVI 248

Query: 250 TCLVFLYMLGVFFILGAELNASMI 273
             LV+LY+  +  I G E+NA ++
Sbjct: 249 VFLVWLYLTSIIVITGGEINALLV 272


>gi|168181945|ref|ZP_02616609.1| YihY family protein [Clostridium botulinum Bf]
 gi|237796863|ref|YP_002864415.1| YihY family protein [Clostridium botulinum Ba4 str. 657]
 gi|182674758|gb|EDT86719.1| YihY family protein [Clostridium botulinum Bf]
 gi|229263986|gb|ACQ55019.1| YihY family protein [Clostridium botulinum Ba4 str. 657]
          Length = 285

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/264 (26%), Positives = 133/264 (50%), Gaps = 16/264 (6%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA---WPEV 73
             F+E++  A++S ++ + ++SVFPF++F   L G+L  H       D++ G     P  
Sbjct: 18  NRFLEDEVLALSSQLAYALIISVFPFLMFVITLIGYLPIHSE-----DLLLGLKEIMPSN 72

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               + + I +++      L + S +   + +S G  A+   LNRAY V E RS+   ++
Sbjct: 73  TYLLLKNTIEEIIYTQNGNLLSFSIIFTIWTASAGFRAVVRGLNRAYDVKERRSFVKVQI 132

Query: 134 ISFGYVLLASVTLVIMSFVFV---AIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
           ++    L  +  LV+  F+ V    I   L Y   F          IWN   Y  M+ + 
Sbjct: 133 MTIFCTLGMAFVLVMSIFLLVFGKTIGRTLVYKLGFSLEFNR----IWNLIRYIIMIGVT 188

Query: 191 IGLIF-VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           I ++  ++ + P+ + +   +LPG IF  I+W++ ++ F+ Y+  F+ YS +Y  + +++
Sbjct: 189 IFILAALYYYTPSKRLRWRDVLPGAIFATIAWIIASMGFSFYVDNFNNYSRLYGSIGAVI 248

Query: 250 TCLVFLYMLGVFFILGAELNASMI 273
             LV+LY+  +  I G E+NA ++
Sbjct: 249 VFLVWLYLTSIIVITGGEINALLV 272


>gi|296331881|ref|ZP_06874346.1| putative integral inner membrane protein with ribonuclease fold
           [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305673493|ref|YP_003865165.1| hypothetical protein BSUW23_04000 [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296150959|gb|EFG91843.1| putative integral inner membrane protein with ribonuclease fold
           [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305411737|gb|ADM36856.1| putative integral inner membrane protein with ribonuclease fold
           [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 275

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 103/198 (52%), Gaps = 5/198 (2%)

Query: 84  QVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLAS 143
           Q L     GL +   +AA + +SNG+ A+  SLN AY V E RS+ I RL S  ++ +A 
Sbjct: 74  QTLNNRNGGLLSFGIIAALWSASNGMNAIVRSLNHAYEVEENRSFIIVRLTSI-FLTIAM 132

Query: 144 VTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLIFVHLFLPA 202
           V  ++++ +       +  +   F    +L L IW   R   + L L I    +++  P 
Sbjct: 133 VFTILVALLLPVFGREIGRLASDFVGASDLFLSIWAAIRWGVSPLVLLIVFSALYVIAPN 192

Query: 203 AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFF 262
            K  +  ++PG +F  I W+V + LF+ Y+ TF+ YS  Y  +  I+  +++ Y+ G+  
Sbjct: 193 KKLSLRFVMPGAVFATIGWIVVSTLFSFYVSTFANYSATYGSIGGIIVLMIWFYLSGILI 252

Query: 263 ILGAELNASMIIYYWRKK 280
           ILG E+NA   + + RKK
Sbjct: 253 ILGGEINA---LLHKRKK 267


>gi|310659169|ref|YP_003936890.1| integral inner membrane protein with ribonuclease fold [Clostridium
           sticklandii DSM 519]
 gi|308825947|emb|CBH21985.1| putative integral inner membrane protein with ribonuclease fold
           [Clostridium sticklandii]
          Length = 319

 Score = 90.5 bits (223), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 133/272 (48%), Gaps = 4/272 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           ++I +  + F  ++       ++   LLSVFPF++F   L GFL     V ++I  +   
Sbjct: 19  NLILELPKRFARDNISQTGGQLAYFFLLSVFPFLIFLNALLGFLNIS--VESIIREISAI 76

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            PE I   +   +  V+      L +I  LA+ + +S  V++L I+LN AY V   R++ 
Sbjct: 77  APEEIVVLLRGYLESVVETRNTSLLSIGLLASLFSASKAVDSLIIALNTAYDVENKRNFI 136

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIW-NGRIYATMLA 188
             + +S  + L+    +VI S +  A+   +A++   F  + N+++ +W   R       
Sbjct: 137 TKKAVSIFFTLILGFAIVI-SLLLPALGKNVAFLIADFFRISNIIVFVWVYIRWVIVFFI 195

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LFI +  ++  +P       + LPG  F   SW++ +  F  Y+  F+ YS +Y  + ++
Sbjct: 196 LFITIALLYHIVPYVNQPFKNSLPGTFFAVTSWLLVSYGFGIYVNNFANYSAVYGSIGAV 255

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +  + +LY+ G+  +LG E+N  +  YY   K
Sbjct: 256 IALMFWLYLTGIILVLGGEINDILYRYYEATK 287


>gi|291483230|dbj|BAI84305.1| hypothetical protein BSNT_01322 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 275

 Score = 90.5 bits (223), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 114/228 (50%), Gaps = 9/228 (3%)

Query: 58  FVPTVIDVVFG---AWPEVIAKPITDEIL-QVLAVPAKGLFTISALAAAYFSSNGVEALR 113
           ++P   D V G    +    A  + + I  Q L     GL +   +AA + +SNG+ A+ 
Sbjct: 44  YLPLSTDDVLGVIEQYAPASAMSLVESITHQTLNNRNGGLLSFGIIAALWSASNGMNAIV 103

Query: 114 ISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNL 173
            SLN AY V E RS+ I RL S  ++ +A V  ++++ +       +  +   F    +L
Sbjct: 104 RSLNHAYDVEENRSFIIVRLTSI-FLTIAMVFTILVALLLPVFGREIGRLASDFVGASDL 162

Query: 174 LLIIWNG-RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYI 232
            L +W   R   + L L I    +++  P  K  +  ++PG +F  I W+V + LF+ Y+
Sbjct: 163 FLSVWAAIRWGVSPLVLLIVFSALYVIAPNKKLSLRFVMPGAVFATIGWIVVSTLFSFYV 222

Query: 233 VTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            TF+ YS  Y  +  I+  +++ Y+ G+  ILG E+NA   + + RKK
Sbjct: 223 STFANYSATYGSIGGIIVLMIWFYLSGILIILGGEINA---LLHKRKK 267


>gi|148381344|ref|YP_001255885.1| YihY family protein [Clostridium botulinum A str. ATCC 3502]
 gi|153933068|ref|YP_001385721.1| YihY family protein [Clostridium botulinum A str. ATCC 19397]
 gi|153935062|ref|YP_001389128.1| YihY family protein [Clostridium botulinum A str. Hall]
 gi|148290828|emb|CAL84963.1| putative membrane-associated ribonuclease [Clostridium botulinum A
           str. ATCC 3502]
 gi|152929112|gb|ABS34612.1| YihY family protein [Clostridium botulinum A str. ATCC 19397]
 gi|152930976|gb|ABS36475.1| YihY family protein [Clostridium botulinum A str. Hall]
          Length = 285

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 70/264 (26%), Positives = 132/264 (50%), Gaps = 16/264 (6%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG---AWPEV 73
             F+E++  A++S ++ + ++SVFPF++F   L G+L  H       D++ G     P  
Sbjct: 18  NRFLEDEVLALSSQLAYALIISVFPFLMFVITLIGYLPIHSE-----DLLLGLKEIMPSN 72

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               + + I +++      L + S +   + +S G  A+   LNRAY V E RS+   + 
Sbjct: 73  TYLLLKNTIEEIIYTQNGNLLSFSIIFTIWTASAGFRAVVRGLNRAYDVKERRSFVKVQT 132

Query: 134 ISFGYVLLASVTLVIMSFVFV---AIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
           ++    L  +  LV+  F+ V    I   L Y   F          IWN   Y  M+ + 
Sbjct: 133 MTIFCTLGMAFVLVMSIFLLVFGKTIGRTLVYKLGFSLEFNR----IWNLIRYIIMIGVT 188

Query: 191 IGLIF-VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           I ++  ++ + P+ + +   +LPG IF  I+W++ ++ F+ Y+  F+ YS +Y  + +++
Sbjct: 189 IFILAALYYYTPSKRLRWRDVLPGAIFATIAWIIASMGFSFYVDNFNNYSRLYGSIGAVI 248

Query: 250 TCLVFLYMLGVFFILGAELNASMI 273
             LV+LY+  +  I G E+NA ++
Sbjct: 249 VFLVWLYLTSIIVITGGEINALLV 272


>gi|317495128|ref|ZP_07953498.1| ribonuclease BN family protein [Gemella moribillum M424]
 gi|316914550|gb|EFV36026.1| ribonuclease BN family protein [Gemella moribillum M424]
          Length = 301

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 76/274 (27%), Positives = 135/274 (49%), Gaps = 33/274 (12%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ---------FV 59
           + I+YD I          +++++S   +LSVFP ++    L  +    Q         F 
Sbjct: 30  YRIMYDEIS--------LLSANLSYYFILSVFPMLIVALALTPYFKIDQQFLLAKIQTFA 81

Query: 60  PTVI-DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNR 118
           P  + D +F    EV+     + I+           TI  +   + +SNG+  + I+ N 
Sbjct: 82  PGALGDYLFNMISEVLNSKNNNTII-----------TIGVVFTLWSASNGIYGIIIAFNN 130

Query: 119 AYRVVEMRSWYITRLISFGYVLLASVTL-VIMSFVFVAIPLALAYVRKFFPALGNLLLII 177
           A+RV + R W +T++IS  + +L  + + ++++ V     L      KF   L      +
Sbjct: 131 AFRVRDGRIWIVTKIISIIFTVLFLIGMFLVLALVVFGKQLTYLLFHKF--NLDEGFYTM 188

Query: 178 WNGRIYA-TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFS 236
           W+   Y+  +L  FI  +F+++  P  K K +SILPG +F+ ISW + + LF +YI  FS
Sbjct: 189 WSYLSYSFPILFTFIVFVFLYILGPNLKLKSISILPGAVFSTISWTLVSRLFGYYIDHFS 248

Query: 237 TYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           +Y   Y  + ++M  +++LY+ G   I+GAE+NA
Sbjct: 249 SYIKTYGTIGALMAFIIWLYITGYILIIGAEINA 282


>gi|182418163|ref|ZP_02949463.1| YihY family protein [Clostridium butyricum 5521]
 gi|237666283|ref|ZP_04526270.1| YihY family protein [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182377981|gb|EDT75521.1| YihY family protein [Clostridium butyricum 5521]
 gi|237658373|gb|EEP55926.1| YihY family protein [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 285

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 132/256 (51%), Gaps = 10/256 (3%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           ++D +A++S ++   +LS FPF++F   L GF  +H     V+D +    P  I      
Sbjct: 24  KDDVFALSSQLAYYLILSFFPFMIFLITLIGF--SHLSSVEVLDNLNAILPTSIVDLTKS 81

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
            I +V+     GL  +S L   + SS+   A+   +N+AY   E RS+    +IS   ++
Sbjct: 82  IIAEVVDNQHTGLLGVSVLLMIWTSSSAFRAVIKGVNKAYGFKENRSFIKRSIISMIGII 141

Query: 141 LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFV---- 196
           L +V +++   + V   +  AY+    P    +++ +WN   YA    +FI +IF+    
Sbjct: 142 LLAVIILLALAMLVFGNVIGAYIISRIP-FYKIIIFLWNMFRYAF---VFIVMIFIFALM 197

Query: 197 HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
           ++F PA + K+  ++PG +F+ + W+  +  F+ YI  F  YS  Y  L ++   + +L+
Sbjct: 198 YMFAPAKRLKLKEVVPGSVFSTMGWIAVSFGFSFYINNFGNYSRFYGSLGAVFILMTWLF 257

Query: 257 MLGVFFILGAELNASM 272
           ++ + FILG E+N  M
Sbjct: 258 LISMIFILGVEINCVM 273


>gi|16077857|ref|NP_388671.1| integral inner membrane protein [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221308625|ref|ZP_03590472.1| hypothetical protein Bsubs1_04393 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221312949|ref|ZP_03594754.1| hypothetical protein BsubsN3_04344 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221317874|ref|ZP_03599168.1| hypothetical protein BsubsJ_04293 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221322147|ref|ZP_03603441.1| hypothetical protein BsubsS_04389 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321314517|ref|YP_004206804.1| putative integral inner membrane protein [Bacillus subtilis BSn5]
 gi|81342316|sp|O34437|YFKH_BACSU RecName: Full=Putative ribonuclease-like protein yfkH
 gi|2626820|dbj|BAA23398.1| YfkH [Bacillus subtilis]
 gi|2633114|emb|CAB12619.1| putative integral inner membrane protein with ribonuclease fold
           [Bacillus subtilis subsp. subtilis str. 168]
 gi|320020791|gb|ADV95777.1| putative integral inner membrane protein with ribonuclease fold
           [Bacillus subtilis BSn5]
          Length = 275

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 114/228 (50%), Gaps = 9/228 (3%)

Query: 58  FVPTVIDVVFG---AWPEVIAKPITDEIL-QVLAVPAKGLFTISALAAAYFSSNGVEALR 113
           ++P   D V G    +    A  + + I  Q L     GL +   +AA + +SNG+ A+ 
Sbjct: 44  YLPLSTDDVLGVIEQYAPASAMSLVESITHQTLNNRNGGLLSFGIIAALWSASNGMNAIV 103

Query: 114 ISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNL 173
            SLN AY V E RS+ I RL S  ++ +A V  ++++ +       +  +   F    +L
Sbjct: 104 RSLNHAYDVEENRSFIIVRLTSI-FLTIAMVFTILVALLLPVFGREIGRLASDFVGASDL 162

Query: 174 LLIIWNG-RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYI 232
            L +W   R   + L L I    +++  P  K  +  ++PG +F  I W++ + LF+ Y+
Sbjct: 163 FLSVWAAIRWGVSPLVLLIVFSALYVIAPNKKLSLRFVMPGAVFATIGWIIVSTLFSFYV 222

Query: 233 VTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            TF+ YS  Y  +  I+  +++ Y+ G+  ILG E+NA   + + RKK
Sbjct: 223 STFANYSATYGSIGGIIVLMIWFYLSGILIILGGEINA---LLHKRKK 267


>gi|304439597|ref|ZP_07399501.1| possible ribonuclease BN [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304371909|gb|EFM25511.1| possible ribonuclease BN [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 308

 Score = 89.7 bits (221), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 78/265 (29%), Positives = 135/265 (50%), Gaps = 27/265 (10%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFL---GAHQFVPTVIDVVFGAWPEVIAKP 77
           +++  AMA  ++   +LS+FPFI+   N+  F+      +FV      +    PE I   
Sbjct: 29  DKNLPAMAGSLTFFTILSIFPFIIAFLNIISFVEVFNQSEFVN-----LMTMLPEEIYSI 83

Query: 78  ITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFG 137
           I + I Q+    + GL ++S +   + +S+GV+ L I++N AY + + R++++ RLI+  
Sbjct: 84  IAEFISQMNKASSTGLLSVSLILGIFSASSGVKQLIININYAYGIKDNRNYFLRRLIAAV 143

Query: 138 YVLLASVTLVIMSFVFV----AIPLALAYVR-------KFFPALGNLLLIIWNGRIYATM 186
           + LL  V ++++S   V    AI  A+ +++         F AL NL+ I       A M
Sbjct: 144 FTLLLMVMIILISITSVVGEMAITKAILFLQIDASNFYNVFKALRNLVPI-------AYM 196

Query: 187 LALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           L +FI + +  L     ++ KI  +LPG IFT I   + + LF  Y+  F+ YS  Y  L
Sbjct: 197 LIIFIVMYYFTLNKNIRRNIKITEVLPGAIFTTIGQNLFSALFGVYLQNFAKYSVTYGSL 256

Query: 246 ASIMTCLVFLYMLGVFFILGAELNA 270
            SI   L + Y +    ++G+E+N 
Sbjct: 257 GSIFAFLTWSYFMSYTMLIGSEING 281


>gi|331268878|ref|YP_004395370.1| ribonuclease BN [Clostridium botulinum BKT015925]
 gi|329125428|gb|AEB75373.1| ribonuclease BN, putative [Clostridium botulinum BKT015925]
          Length = 271

 Score = 89.7 bits (221), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 141/270 (52%), Gaps = 24/270 (8%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGF--LGAHQFVPTVIDVVFGA 69
           I+  + +  +++ +A+AS ++ S LLS FPF++F   +  +  + + + + T+ +++   
Sbjct: 10  IFQLLYNLKKDEIFALASQLAYSLLLSFFPFLIFLFTITSYSTIQSDRVLFTLKNII--- 66

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            PE     +   I +VL      L + S +   + +SNG +A+  +LN+AY   E RS+ 
Sbjct: 67  -PESAYTLVYSIINEVLESKNVNLLSFSFIITIWIASNGFKAVIRALNKAYGEKEERSFI 125

Query: 130 ITRLISFGYVLLASVTLVIMSF--VFVAIPLALA-----YVRKFFPALGNLLLIIWNGRI 182
             +L       +A +T +I++F  +F    L L       + KFF    NL  + WN   
Sbjct: 126 KLQL-------MAIITTIILTFLIIFSLFLLVLGNIIGYKIMKFFSLPDNLFFV-WNVFR 177

Query: 183 YATMLALFIGLIF--VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           Y  ML +F+ LIF  ++   P  K     +LPG IF  I W++ ++ F+ Y+  F+ YS 
Sbjct: 178 YFLML-IFMILIFAVIYKLTPCRKLTFGEVLPGSIFATIGWIIVSLGFSFYVDNFANYSR 236

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           +Y  + +++  +V+L++  +  ++G E+NA
Sbjct: 237 LYGSIGAVIILMVWLFLTSIIILIGGEINA 266


>gi|157691522|ref|YP_001485984.1| hypothetical protein BPUM_0738 [Bacillus pumilus SAFR-032]
 gi|157680280|gb|ABV61424.1| hypothetical protein BPUM_0738 [Bacillus pumilus SAFR-032]
          Length = 272

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 80/256 (31%), Positives = 127/256 (49%), Gaps = 4/256 (1%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           IE F+  +G A ++ ++   LLS+FPF++F   L G+L        V+ V+ G  PE   
Sbjct: 8   IERFLLHEGPAKSAELAYFFLLSLFPFLIFVLTLVGYLPLTS--KDVLSVISGYAPEGAL 65

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
             I     Q L     GL +   +AA + +SNG+ A+  + N AY V E RS+ + RL S
Sbjct: 66  SMIESIAEQTLNNRNGGLLSFGIIAALWSASNGINAVVRAFNHAYEVEENRSFILVRLTS 125

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLI 194
              + +A V  +I + +       L           +  L IW   R   + L L I   
Sbjct: 126 I-ILTIAMVLTIIFALMLPVFGKELGLFVAKLVGQSDAFLTIWTAMRWIISPLILLIVFT 184

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++ F P  + K+  +LPG IF  I W++ ++LF+ Y+  F+ YS MY  +  I+  +++
Sbjct: 185 SLYYFAPNMRLKLKFVLPGAIFASIGWILVSMLFSFYVGEFANYSAMYGSIGGIIILMIW 244

Query: 255 LYMLGVFFILGAELNA 270
            Y+ G+  ILG ELNA
Sbjct: 245 FYLTGIMIILGGELNA 260


>gi|319892923|ref|YP_004149798.1| Ribonuclease BN [Staphylococcus pseudintermedius HKU10-03]
 gi|317162619|gb|ADV06162.1| Ribonuclease BN [Staphylococcus pseudintermedius HKU10-03]
          Length = 445

 Score = 89.0 bits (219), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 133/270 (49%), Gaps = 27/270 (10%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           ++D   +A+ ++   +LS+FP ++F  +L           T+   +    P   +  IT 
Sbjct: 96  KDDASGLAAQLAYYFMLSLFPMLIFILSLVPLFNIDS--DTITAQISKNAPAETSSIITG 153

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
            I  V+   + GL +I  + A + +SNG+ A+  + N AY V + R++ +++L++  + L
Sbjct: 154 IIDDVMGNASGGLLSIGLILALWTASNGMTAMMNAFNVAYDVEDSRNFVVSKLLAIFFTL 213

Query: 141 LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLL--------IIWNGRIYAT---MLAL 189
           L  +TL +   +F            F   +GNLL         + W   +  T   +LA+
Sbjct: 214 LIGITLPLTLVLFT-----------FGEQIGNLLFGPLGLDEQVRWVFSLLRTALPVLAV 262

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            I    ++   P  K +  S++PG +F+ I W++G++ F  Y+  F+ YS  Y  +  ++
Sbjct: 263 LIVFTIIYTLAPNVKIRFKSVIPGALFSTIVWILGSLAFGFYVSNFANYSKTYGSIGGVI 322

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             +++LY+ G   I+GAE+NA   I + RK
Sbjct: 323 VLMLWLYITGFILIIGAEINA---IVHQRK 349


>gi|323464029|gb|ADX76182.1| ribonuclease BN-like family protein [Staphylococcus
           pseudintermedius ED99]
          Length = 445

 Score = 88.6 bits (218), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 133/270 (49%), Gaps = 27/270 (10%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           ++D   +A+ ++   +LS+FP ++F  +L           T+   +    P   +  IT 
Sbjct: 96  KDDASGLAAQLAYYFMLSLFPMLIFILSLVPLFNIDS--DTITAQISKNAPAETSSIITG 153

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
            I  V+   + GL +I  + A + +SNG+ A+  + N AY V + R++ +++L++  + L
Sbjct: 154 IIDDVMGNASGGLLSIGLILALWTASNGMTAMMNAFNVAYDVEDSRNFVVSKLLAIFFTL 213

Query: 141 LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLL--------IIWNGRIYAT---MLAL 189
           L  +TL +   +F            F   +GNLL         + W   +  T   +LA+
Sbjct: 214 LIGITLPLTLVLFT-----------FGEQIGNLLFGPLGLDEQVRWVFSLLRTALPVLAV 262

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            I    ++   P  K +  S++PG +F+ I W++G++ F  Y+  F+ YS  Y  +  ++
Sbjct: 263 LIVFTIIYTLAPNVKIRFKSVIPGALFSTIVWILGSLAFGFYVSNFANYSKTYGSIGGVI 322

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             +++LY+ G   I+GAE+NA   I + RK
Sbjct: 323 VLMLWLYITGFILIIGAEINA---IVHQRK 349


>gi|255003094|ref|ZP_05278058.1| hypothetical protein AmarPR_02223 [Anaplasma marginale str. Puerto
           Rico]
          Length = 291

 Score = 88.6 bits (218), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 126/262 (48%), Gaps = 13/262 (4%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVF----GANLAGFLGAHQ-FVPTVIDVVFGA 69
           AI  F   DG   + +++   LL+ FPF+VF     +     L  H+ F+  ++  +   
Sbjct: 36  AIADFRRHDGLVYSGYLAFIFLLATFPFLVFFTAMTSTALNVLDKHEDFLQGLVTSLLSE 95

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P      +   I ++L+ P + L T++ +   + +S+ +E +R  LN+A+RV     + 
Sbjct: 96  LPHETIAALLPRINEILSGPPQSLLTVAVVGIVWTASSAIEGMRTVLNKAFRVSAPPPYI 155

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + R++S    L+  + ++      V +P+ L  + + +  LG +        +   +L L
Sbjct: 156 LGRMLSILQFLVIVLVMMFSVLFIVFVPIVLDVLDQKWGYLGYI-----KYTLSEVILCL 210

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + L++    +P  + +I  ILPG +   I W   +  F+ Y+  F    TMY  L+ I+
Sbjct: 211 SVALLY--FMVPNTRQRIGVILPGAVVVTILWTASSFTFSWYLSNFRVLHTMYGNLSGII 268

Query: 250 TCLVFLYMLGVFFILGA-ELNA 270
             ++F Y+L +FFI GA EL A
Sbjct: 269 ASMLFFYILSIFFIYGAVELPA 290


>gi|329767146|ref|ZP_08258674.1| hypothetical protein HMPREF0428_00371 [Gemella haemolysans M341]
 gi|328837871|gb|EGF87496.1| hypothetical protein HMPREF0428_00371 [Gemella haemolysans M341]
          Length = 300

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 126/246 (51%), Gaps = 6/246 (2%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVL 86
           +++++S   +LS+FP ++    L  +    Q    +++ +    P  +   + D I +VL
Sbjct: 40  LSANLSYYFILSLFPMLIVALALTPYFKIDQ--QFLLERIQNFAPGDLGNYLFDMISEVL 97

Query: 87  AVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTL 146
                 + T+  +   + +S+G+  + I+ N A+RV + R W +T+LIS     L  V +
Sbjct: 98  NNKNNTIITVGIVFTLWSASSGIYGIIIAFNNAFRVRDGRIWIVTKLISVVITALFLVGM 157

Query: 147 -VIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA-TMLALFIGLIFVHLFLPAAK 204
            V+++ V     L      KF   L      +W+   Y+  +L  FI  +F+++  P  K
Sbjct: 158 FVVLALVVFGKQLTYLLFHKF--NLDEGFYNLWSVLNYSFPILFTFIVFVFLYIMGPNLK 215

Query: 205 SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFIL 264
            K +SILPG IF  +SW + + LF +YI  FS+Y   Y  + + M  +++LY+ G   I+
Sbjct: 216 LKAISILPGSIFATVSWTLISRLFGYYIDHFSSYIKTYGTIGAFMAFIIWLYITGYILII 275

Query: 265 GAELNA 270
           GAE+NA
Sbjct: 276 GAEINA 281


>gi|81429127|ref|YP_396128.1| putative ribonuclease [Lactobacillus sakei subsp. sakei 23K]
 gi|78610770|emb|CAI55821.1| Putative ribonuclease [Lactobacillus sakei subsp. sakei 23K]
          Length = 312

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/245 (29%), Positives = 123/245 (50%), Gaps = 2/245 (0%)

Query: 28  ASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLA 87
           A  I+  ALLS FP ++   N+  +      V +V D V  A P  I   I   +  +L 
Sbjct: 42  AKIIAYYALLSFFPLLIVIGNILPYFQLD--VLSVADYVKSAVPPTIFNRIMPILQSLLN 99

Query: 88  VPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLV 147
               GL ++  L   + +S G+ AL+IS+NRAYRV ++ ++ + RLIS G  L+  + LV
Sbjct: 100 KRNSGLLSVGILGTLWAASKGINALKISINRAYRVDKIHNFILKRLISLGTTLVLLLLLV 159

Query: 148 IMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKI 207
            +  VF      L ++   F    + + +    +   T + LF+ LIFV+ F+P  K ++
Sbjct: 160 SLIVVFTFGQQFLEFITPIFKIPEDYINVFGQLKWPITSIVLFVILIFVYFFVPNVKMQL 219

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAE 267
            S+LPG   T + W++ A  F+ Y+  F T    Y  + + +  L++L    +  + GA 
Sbjct: 220 RSVLPGAFLTTVGWLILAQAFSLYMRYFGTSWNSYGTIGAFIILLLWLNYSAMVLMFGAV 279

Query: 268 LNASM 272
           +N ++
Sbjct: 280 VNVAI 284


>gi|57867339|ref|YP_188990.1| ribonuclease BN [Staphylococcus epidermidis RP62A]
 gi|251809911|ref|ZP_04824384.1| ribonuclease BN [Staphylococcus epidermidis BCM-HMP0060]
 gi|282874567|ref|ZP_06283452.1| YihY family protein [Staphylococcus epidermidis SK135]
 gi|293367803|ref|ZP_06614452.1| YihY family protein [Staphylococcus epidermidis M23864:W2(grey)]
 gi|57637997|gb|AAW54785.1| ribonuclease BN, putative [Staphylococcus epidermidis RP62A]
 gi|251806576|gb|EES59233.1| ribonuclease BN [Staphylococcus epidermidis BCM-HMP0060]
 gi|281296706|gb|EFA89215.1| YihY family protein [Staphylococcus epidermidis SK135]
 gi|291318142|gb|EFE58539.1| YihY family protein [Staphylococcus epidermidis M23864:W2(grey)]
 gi|329726921|gb|EGG63379.1| YihY family protein [Staphylococcus epidermidis VCU144]
 gi|329734775|gb|EGG71081.1| YihY family protein [Staphylococcus epidermidis VCU045]
 gi|329734799|gb|EGG71104.1| YihY family protein [Staphylococcus epidermidis VCU028]
          Length = 392

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 80/267 (29%), Positives = 138/267 (51%), Gaps = 19/267 (7%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAG---FLGAHQFVPTVIDVVFGAWPEVIAKP 77
           ++D   +A+ ++   +L++FP ++F   L G    + A+Q    V   V    P+     
Sbjct: 77  KDDAAGLAAQMTYHFVLALFPMLIFLLTLLGQFITIDANQINQKVSQYV----PDQETAS 132

Query: 78  ITDEILQVLAVPAKG-LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISF 136
           I   I++ ++  A G + ++  + A + +SNG+ A+  S N AY V + R+  + +L+S 
Sbjct: 133 IVGGIVKDISDTASGGILSVGLILAIWSASNGMSAIINSFNVAYDVEDSRNGVVVKLLSI 192

Query: 137 GYVLLASVTLVIMSFVFVAIPLALAYVRKF-FPALG--NLLLIIWN-GRIYATMLALFIG 192
            Y L+     V+   +    P+    + KF F  LG  N +  I+N  RI   ++ +FI 
Sbjct: 193 LYTLVLGAVFVVAVVLITLGPV----INKFLFGPLGIDNQIEWIFNLVRIVIPLIIIFII 248

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
              ++   P  K+K+ S++PG IFT I W++G+  F +YI  FS YS  Y  LA I+   
Sbjct: 249 FTVLYSVAPNVKTKLRSVIPGAIFTSIIWLLGSFAFGYYISNFSNYSKTYGSLAGIIILF 308

Query: 253 VFLYMLGVFFILGAELNASMIIYYWRK 279
           ++LY+     I+GAE+NA   I + RK
Sbjct: 309 LWLYITSFIIIIGAEINA---IIHQRK 332


>gi|27468486|ref|NP_765123.1| transporter [Staphylococcus epidermidis ATCC 12228]
 gi|27316033|gb|AAO05167.1|AE016749_113 transporter [Staphylococcus epidermidis ATCC 12228]
          Length = 392

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 80/267 (29%), Positives = 138/267 (51%), Gaps = 19/267 (7%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAG---FLGAHQFVPTVIDVVFGAWPEVIAKP 77
           ++D   +A+ ++   +L++FP ++F   L G    + A+Q    V   V    P+     
Sbjct: 77  KDDAAGLAAQMTYHFVLALFPMLIFLLTLLGQFITIDANQINQKVSQYV----PDQETAS 132

Query: 78  ITDEILQVLAVPAKG-LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISF 136
           I   I++ ++  A G + ++  + A + +SNG+ A+  S N AY V + R+  + +L+S 
Sbjct: 133 IVGGIVKDISDTASGGILSVGLILAIWSASNGMSAIINSFNVAYDVEDSRNGVVVKLLSI 192

Query: 137 GYVLLASVTLVIMSFVFVAIPLALAYVRKF-FPALG--NLLLIIWN-GRIYATMLALFIG 192
            Y L+     V+   +    P+    + KF F  LG  N +  I+N  RI   ++ +FI 
Sbjct: 193 LYTLVLGAVFVVAVVLITLGPV----INKFLFGPLGIDNQIEWIFNLVRIVIPLIIIFII 248

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
              ++   P  K+K+ S++PG IFT I W++G+  F +YI  FS YS  Y  LA I+   
Sbjct: 249 FTVLYSVAPNVKTKLRSVIPGAIFTSIIWLLGSFAFGYYISNFSNYSKTYGSLAGIIILF 308

Query: 253 VFLYMLGVFFILGAELNASMIIYYWRK 279
           ++LY+     I+GAE+NA   I + RK
Sbjct: 309 LWLYITSFIIIIGAEINA---IIHQRK 332


>gi|328957860|ref|YP_004375246.1| putative ribonuclease [Carnobacterium sp. 17-4]
 gi|328674184|gb|AEB30230.1| putative ribonuclease [Carnobacterium sp. 17-4]
          Length = 319

 Score = 87.0 bits (214), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/264 (28%), Positives = 133/264 (50%), Gaps = 10/264 (3%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFL--GAHQFVPTVIDVVFGAWPEV 73
           I+ + E + W   + IS   LLS+FP +V  +N+  +L   A + +P + + V    P  
Sbjct: 29  IQKYREAEVWNSGAIISYYLLLSIFPVMVVVSNVLPYLRLDAAELLPYIENAV----PTY 84

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               + + ++   +  + G+ +I+ + A + SS G+ A+++S+N+AY V   R+  I RL
Sbjct: 85  FFHQLENLLMNWFSKSSGGILSIAVIGALWSSSRGMNAMQVSMNKAYGVEPRRNIVIIRL 144

Query: 134 ISFGYVLLASVTLVIMSFV--FVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
             F  +L  S+ L IM  V  F    L L Y+   F     +     + R   T+  LFI
Sbjct: 145 --FSLILTTSLILCIMVLVIIFGFGQLILEYITPVFELPLMISETFQSLRWPVTVSVLFI 202

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
               ++ F+P AK  + S+LPG   + I W++ + +F  Y+  F+  +  Y  + + M  
Sbjct: 203 IFCVLYYFVPHAKVTLKSVLPGAAISTIGWMLVSQVFAIYVEYFAFGAKTYGTIGTFMIM 262

Query: 252 LVFLYMLGVFFILGAELNASMIIY 275
           L++L ++G     GA +NAS+ +Y
Sbjct: 263 LIWLQVIGSLMTAGAVINASIEVY 286


>gi|325571347|ref|ZP_08146847.1| YihY family protein [Enterococcus casseliflavus ATCC 12755]
 gi|325155823|gb|EGC68019.1| YihY family protein [Enterococcus casseliflavus ATCC 12755]
          Length = 307

 Score = 87.0 bits (214), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 121/235 (51%), Gaps = 2/235 (0%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           LLS+FP ++   NL  +L       TV+  V    P  I   I   I  +L   + GL +
Sbjct: 41  LLSLFPLMIALGNLLPYLSIDP--NTVLSYVQELIPNQIYDFIGPAIENLLTTSSGGLLS 98

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
           ISALAA + +S  + AL+I++N+A+ V +  ++ + R +SF  +LL  + +V ++ VF  
Sbjct: 99  ISALAALWSASQSINALQIAMNKAFGVDQRSNFIVVRAVSFVIILLFMIAIVGVTMVFGL 158

Query: 156 IPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVI 215
             + L +++  F    NL+      +   T++AL   ++ ++  +P AK K+ S LPG I
Sbjct: 159 GKIILDFLQPIFKFQDNLIDTFQTVKWPVTIVALLFIMMLIYWLVPNAKVKLRSTLPGAI 218

Query: 216 FTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           F  I W++ + +F  Y   F+     Y  + S +  +++L +     ILG  +NA
Sbjct: 219 FATIGWMLLSQVFGLYARYFAAKIIGYQIIGSFIVLMIWLNLAATIIILGGIINA 273


>gi|319399849|gb|EFV88096.1| YihY family protein [Staphylococcus epidermidis FRI909]
          Length = 392

 Score = 87.0 bits (214), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 80/267 (29%), Positives = 138/267 (51%), Gaps = 19/267 (7%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAG---FLGAHQFVPTVIDVVFGAWPEVIAKP 77
           ++D   +A+ ++   +L++FP ++F   L G    + A+Q    V   V    P+     
Sbjct: 77  KDDAAGLAAQMTYHFVLALFPMLIFLLTLLGQFITIDANQINQKVSQYV----PDQETAS 132

Query: 78  ITDEILQVLAVPAKG-LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISF 136
           I   I++ ++  A G + ++  + A + +SNG+ A+  S N AY V + R+  + +L+S 
Sbjct: 133 IVGGIVKDISDTASGGILSVGLILAIWSASNGMSAIINSFNVAYDVEDSRNGIVVKLLSI 192

Query: 137 GYVLLASVTLVIMSFVFVAIPLALAYVRKF-FPALG--NLLLIIWN-GRIYATMLALFIG 192
            Y L+     V+   +    P+    + KF F  LG  N +  I+N  RI   ++ +FI 
Sbjct: 193 LYTLVLGAVFVVAVVLITLGPV----INKFLFGPLGIDNQIEWIFNLVRIVIPLIIIFII 248

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
              ++   P  K+K+ S++PG IFT I W++G+  F +YI  FS YS  Y  LA I+   
Sbjct: 249 FTVLYSVAPNVKTKLRSVIPGAIFTSIIWLLGSFAFGYYISNFSNYSKTYGSLAGIIILF 308

Query: 253 VFLYMLGVFFILGAELNASMIIYYWRK 279
           ++LY+     I+GAE+NA   I + RK
Sbjct: 309 LWLYITSFIIIIGAEINA---IIHQRK 332


>gi|212638170|ref|YP_002314690.1| ribonuclease BN-like family enzyme [Anoxybacillus flavithermus WK1]
 gi|212559650|gb|ACJ32705.1| Ribonuclease BN-like family enzyme [Anoxybacillus flavithermus WK1]
          Length = 277

 Score = 87.0 bits (214), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 107/204 (52%), Gaps = 8/204 (3%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P   A  I   + Q++   +    + S LA  + +SNG+ A+  +LNRAY V E RS+++
Sbjct: 65  PSETAHLIETNVKQLMESQSGKWLSFSVLATVWAASNGMSAIIRALNRAYDVKETRSFFV 124

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKF-FPALG--NLLLIIWNG-RIYATM 186
            R +S   +  A + ++I++ +F   P+    +  F F A G  ++ L +W   R + + 
Sbjct: 125 ARGVSI-LLTFAMIFVIIVALIF---PVFGKMIGTFLFSAFGLSDVFLHVWETIRWFVSF 180

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           + LF     +++F P+   +   +  G +F  + W++ ++ F+ Y+  F  YS MY  L 
Sbjct: 181 VILFFVFSVLYVFAPSKYVRFRDVWSGALFATVGWMIVSLAFSSYVNQFGNYSAMYGSLG 240

Query: 247 SIMTCLVFLYMLGVFFILGAELNA 270
            I+  +V+ Y+ G+  +LG ELNA
Sbjct: 241 GIIALMVWFYLSGMMIVLGGELNA 264


>gi|242241721|ref|ZP_04796166.1| ribonuclease BN [Staphylococcus epidermidis W23144]
 gi|242234811|gb|EES37122.1| ribonuclease BN [Staphylococcus epidermidis W23144]
          Length = 392

 Score = 87.0 bits (214), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 80/267 (29%), Positives = 138/267 (51%), Gaps = 19/267 (7%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAG---FLGAHQFVPTVIDVVFGAWPEVIAKP 77
           ++D   +A+ ++   +L++FP ++F   L G    + A+Q    V   V    P+     
Sbjct: 77  KDDAAGLAAQMTYHFVLALFPMLIFLLTLLGQFITIDANQINQKVSQYV----PDQETAS 132

Query: 78  ITDEILQVLAVPAKG-LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISF 136
           I   I++ ++  A G + ++  + A + +SNG+ A+  S N AY V + R+  + +L+S 
Sbjct: 133 IVGGIVKDISDTASGGILSVGLILAIWSASNGMSAIINSFNVAYDVEDSRNGIVVKLLSI 192

Query: 137 GYVLLASVTLVIMSFVFVAIPLALAYVRKF-FPALG--NLLLIIWN-GRIYATMLALFIG 192
            Y L+     V+   +    P+    + KF F  LG  N +  I+N  RI   ++ +FI 
Sbjct: 193 LYTLVLGAVFVVAVVLITLGPV----INKFLFGPLGIDNQIEWIFNLVRIVIPLIIIFII 248

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
              ++   P  K+K+ S++PG IFT I W++G+  F +YI  FS YS  Y  LA I+   
Sbjct: 249 FTVLYSVAPNVKTKLRSVIPGAIFTSIIWLLGSFAFGYYISNFSNYSKTYGSLAGIIILF 308

Query: 253 VFLYMLGVFFILGAELNASMIIYYWRK 279
           ++LY+     I+GAE+NA   I + RK
Sbjct: 309 LWLYITSFIIIIGAEINA---IIHQRK 332


>gi|257867525|ref|ZP_05647178.1| ribonuclease BN [Enterococcus casseliflavus EC30]
 gi|257873854|ref|ZP_05653507.1| ribonuclease BN [Enterococcus casseliflavus EC10]
 gi|257877604|ref|ZP_05657257.1| ribonuclease BN [Enterococcus casseliflavus EC20]
 gi|257801581|gb|EEV30511.1| ribonuclease BN [Enterococcus casseliflavus EC30]
 gi|257808018|gb|EEV36840.1| ribonuclease BN [Enterococcus casseliflavus EC10]
 gi|257811770|gb|EEV40590.1| ribonuclease BN [Enterococcus casseliflavus EC20]
          Length = 307

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 121/235 (51%), Gaps = 2/235 (0%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           LLS+FP ++   NL  +L       TV+  V    P  I   I   I  +L   + GL +
Sbjct: 41  LLSLFPLMIALGNLLPYLSIDP--NTVLSYVQELIPSQIYDFIGPAIENLLTTSSGGLLS 98

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
           ISALAA + +S  + AL+I++N+A+ V +  ++ + R +SF  +LL  + +V ++ VF  
Sbjct: 99  ISALAALWSASQSINALQIAMNKAFGVDQRSNFIVVRAVSFVIILLFMIAIVGVTMVFGL 158

Query: 156 IPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVI 215
             + L +++  F    NL+      +   T++AL   ++ ++  +P AK K+ S LPG I
Sbjct: 159 GKIILDFLQPIFKFQDNLIDTFQTVKWPVTIVALLFIMMLIYWLVPNAKVKLRSTLPGAI 218

Query: 216 FTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           F  I W++ + +F  Y   F+     Y  + S +  +++L +     ILG  +NA
Sbjct: 219 FATIGWMLLSQVFGLYARYFAAKIIGYQIIGSFIVLMIWLNLAATIIILGGIINA 273


>gi|323486654|ref|ZP_08091975.1| YihY family protein [Clostridium symbiosum WAL-14163]
 gi|323692200|ref|ZP_08106443.1| ribonuclease BN [Clostridium symbiosum WAL-14673]
 gi|323400035|gb|EGA92412.1| YihY family protein [Clostridium symbiosum WAL-14163]
 gi|323503774|gb|EGB19593.1| ribonuclease BN [Clostridium symbiosum WAL-14673]
          Length = 273

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 82/288 (28%), Positives = 142/288 (49%), Gaps = 27/288 (9%)

Query: 4   YFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI 63
           YF +    IYD    FV+++    A+  S   +LS FPFI+        L   Q VPT+ 
Sbjct: 3   YFILQCKKIYD---EFVKDEITVYAAQASFFIVLSFFPFIMI------LLTVIQLVPTIS 53

Query: 64  D-----VVFGAWPEVIAKPITDEILQVLAVPAKG-LFTISALAAAYFSSNGVEALRISLN 117
                 V+   +PE +  P+ + I+  L   A   + +++ +   + +S G+  +   LN
Sbjct: 54  QADLLLVISRLFPEKVY-PLVESIVTDLYTTAPAAILSVTTIVTIWSASRGMMGIERGLN 112

Query: 118 RAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVR-KFFPALGNL--- 173
           R     + R++ I+RLI+ GY ++  + + IMS V +    +L  +  ++ P L ++   
Sbjct: 113 RIINCSKRRNYVISRLINSGYTVVF-ILVCIMSLVLMVFGTSLQRLLLRYLPILEHIAPY 171

Query: 174 LLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIV 233
           LL I      A ++  F+GL   + FLP  K ++   LPG +F+   W+V +  F+ Y  
Sbjct: 172 LLSIRALIALAILIVFFMGL---YTFLPFEKLELRKQLPGALFSTAGWIVCSYGFSIYFN 228

Query: 234 TFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
            F  +S MY  LA+I+  +++LY       LGAE+N  M   ++ +KP
Sbjct: 229 HFKRFSYMYGSLAAIVILMLWLYFCICILFLGAEVNQHM---HFGRKP 273


>gi|23097645|ref|NP_691111.1| hypothetical protein OB0190 [Oceanobacillus iheyensis HTE831]
 gi|22775868|dbj|BAC12146.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831]
          Length = 282

 Score = 86.7 bits (213), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 134/275 (48%), Gaps = 27/275 (9%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG-----AHQFVPTVIDVVFGAW 70
           I  F  +D   +A+ ++   LLSVFP +V    +  +       A QF+ +++       
Sbjct: 11  ITKFKNDDVPLLAASLAYYFLLSVFPLLVVAFAIIPYFNISPQDAIQFISSIL------- 63

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           PE +A    + I+ ++  P  GL TI  L   + +SNG+ A     N +Y V E RS+  
Sbjct: 64  PEQLASTFQENIVSIVETPRGGLLTIGILGTLWSASNGINAFIKVSNESYEVEETRSFIK 123

Query: 131 TRLISFG------YVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
           TR I+FG      + ++ ++ L +   V + + +++  + +      +   I+   R   
Sbjct: 124 TRAIAFGLTIAMIFAVITAIILPVFGDVILTMAMSIVGINE------STEWILQISRFAI 177

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
           ++  + + L+ ++ F P AK  +  I+PG +   I W++ +  F+ Y+  F  YS MY  
Sbjct: 178 SIAVITLLLLTLYRFAPNAKLPVKHIIPGTLTASILWLIISFGFSIYVSNFGNYSNMYGS 237

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           L  ++  +++ ++ G+  ++G  +N   ++Y+ +K
Sbjct: 238 LGGVIILMIWFFLTGMILLIGGIIN---VMYHQKK 269


>gi|15597947|ref|NP_251441.1| hypothetical protein PA2751 [Pseudomonas aeruginosa PAO1]
 gi|107102287|ref|ZP_01366205.1| hypothetical protein PaerPA_01003345 [Pseudomonas aeruginosa PACS2]
 gi|116050744|ref|YP_790435.1| hypothetical protein PA14_28530 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218891066|ref|YP_002439932.1| hypothetical protein PLES_23291 [Pseudomonas aeruginosa LESB58]
 gi|254241206|ref|ZP_04934528.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|296388780|ref|ZP_06878255.1| hypothetical protein PaerPAb_11543 [Pseudomonas aeruginosa PAb1]
 gi|313107873|ref|ZP_07794045.1| putative membrane protein [Pseudomonas aeruginosa 39016]
 gi|9948830|gb|AAG06139.1|AE004703_5 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115585965|gb|ABJ11980.1| putative membrane protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126194584|gb|EAZ58647.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218771291|emb|CAW27056.1| putative membrane protein [Pseudomonas aeruginosa LESB58]
 gi|310880547|gb|EFQ39141.1| putative membrane protein [Pseudomonas aeruginosa 39016]
          Length = 299

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 133/278 (47%), Gaps = 31/278 (11%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV-------- 59
           +F ++   +  F+E+D    AS ++   L S+FPF++    L G+L   +F         
Sbjct: 11  LFGLVKRTVNEFLEDDMPTYASALAYQMLFSLFPFLLVLITLVGYLHLPEFFAWLREQAA 70

Query: 60  ----PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRIS 115
               P  +D V          P+ D++ Q       GL +I    A + SS G+ ++ I+
Sbjct: 71  LLLPPEAMDQV---------NPVIDQLQQ----QKGGLLSIGIAVALWTSSAGIRSMMIA 117

Query: 116 LNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLL 175
           LN AY V E R  +    +S  Y L  ++ L++ + + V  P  +A++      L   L+
Sbjct: 118 LNAAYDVKESRPVWKRFSLSILYTLGIALLLLVAAGLMVTGPQVIAWIAGLV-GLEQYLV 176

Query: 176 IIWNGRIYATMLALFIGLIFVHLF---LPAAKSKIMSILPGVIFTWISWVVGAVLFTHYI 232
            +W    +   LA+F+ ++ V LF   +P  + +   I PG + + I+W+  ++ +  Y+
Sbjct: 177 TLWTWLRWP--LAVFLLMLAVALFYYLVPDVEQRFRFITPGSVLSVIAWIAASLAYGFYV 234

Query: 233 VTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
             F+ Y+ MY  + +I+  L++ Y+     + GAELNA
Sbjct: 235 KNFANYNAMYGSIGAIIILLLYFYLSAAVVLFGAELNA 272


>gi|118444295|ref|YP_877597.1| ribonuclease BN [Clostridium novyi NT]
 gi|118134751|gb|ABK61795.1| ribonuclease BN, putative [Clostridium novyi NT]
          Length = 271

 Score = 86.3 bits (212), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 139/282 (49%), Gaps = 44/282 (15%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGF--LGAHQFVPTVIDVVF 67
           ++I+  +    +++ +A+AS ++ S LLS FPF++F   +A F  L +   + T+  V+ 
Sbjct: 8   NLIFKLLYKLKKDEIFALASQLAYSLLLSFFPFLIFLFTVASFSSLKSEGIIITLKSVI- 66

Query: 68  GAWPE---VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
              PE    +   I +E  +   V    L + S +   + +SNG +A+  +LN+AY   E
Sbjct: 67  ---PESAYTLVHSILNETFEASNV---NLLSFSFIITIWIASNGFKAVIRALNKAYGQEE 120

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNL----------- 173
            RS+       F    +  ++ +I++F+ +           F   LGN+           
Sbjct: 121 ERSF-------FKIQFMGIISTIILTFLII--------FSLFILVLGNIIGLKIITMLSL 165

Query: 174 ---LLIIWNGRIYATMLALFIGLIF--VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLF 228
              L  IWN   Y  ML +F+ +IF  V+   P  K K   ++PG IF  I W+V ++ F
Sbjct: 166 SINLYFIWNVLRYFVML-IFMIVIFAIVYKITPCRKLKFKDVIPGAIFATIGWIVVSLGF 224

Query: 229 THYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           + Y+  F+ YS +Y  + +++  LV+L++  +  ++G E+NA
Sbjct: 225 SFYVDNFANYSRLYGSIGAVIVILVWLFLSSIIILIGGEINA 266


>gi|15893776|ref|NP_347125.1| tRNA-processing ribonuclease BN [Clostridium acetobutylicum ATCC
           824]
 gi|15023345|gb|AAK78465.1|AE007563_5 TRNA-processing ribonuclease BN [Clostridium acetobutylicum ATCC
           824]
 gi|325507899|gb|ADZ19535.1| TRNA-processing ribonuclease BN [Clostridium acetobutylicum EA
           2018]
          Length = 283

 Score = 85.9 bits (211), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 136/276 (49%), Gaps = 24/276 (8%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           I+  +++   A++S ++ S + + FPF++F   L GF         V++ +    P  + 
Sbjct: 16  IKRLIDDGIIALSSQLAYSLIFAFFPFLIFLMTLVGFSSIKS--SDVLEAMRKVVPYQVY 73

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
             + + + +V+      L ++S + + +   +G  A+   LN +Y+  E RS+   +LIS
Sbjct: 74  GLVKNIVKEVVDTKNGKLLSVSLITSIWSCVSGFNAVIRGLNNSYKDNERRSFLKVQLIS 133

Query: 136 --FGYVLLASVTLVIMSFVFVAIPLALAYVRKF----FPALGNLLLIIWNGRIYATMLAL 189
             F + L+ ++   ++  VF  I   L  ++KF    F   G     +W+   Y     L
Sbjct: 134 IIFTFGLIITIFFAMLLIVFGDINEELI-IKKFGINEFFGYG-----VWDLIKYGI---L 184

Query: 190 FIGLIF----VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
            IG+IF    ++ + PA K K   + PG + + + WV+ ++ FT+Y+  F  YS +Y  +
Sbjct: 185 TIGMIFSFAALYRYTPANKHKWKMVFPGAVISALGWVISSICFTYYVNNFGNYSKVYGSI 244

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
            +++  + +L+++    I G E+NA   +Y+  K P
Sbjct: 245 GAVIVLMTWLFIISFIIICGGEINA---VYFEIKNP 277


>gi|152983785|ref|YP_001347855.1| hypothetical protein PSPA7_2488 [Pseudomonas aeruginosa PA7]
 gi|150958943|gb|ABR80968.1| membrane protein, putative [Pseudomonas aeruginosa PA7]
          Length = 299

 Score = 85.9 bits (211), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 133/278 (47%), Gaps = 31/278 (11%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV-------- 59
           +F ++   +  F+E+D    AS ++   L S+FPF++    L G+L   +F         
Sbjct: 11  LFGLVKRTVNEFLEDDMPTYASALAYQMLFSLFPFLLVLITLVGYLHLPEFFAWLREQAA 70

Query: 60  ----PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRIS 115
               P  +D V          P+ D++ Q       GL +I    A + SS G+ ++ I+
Sbjct: 71  LLLPPEAMDQV---------NPVIDQLQQ----QKGGLLSIGIAVALWTSSAGIRSMMIA 117

Query: 116 LNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLL 175
           LN AY V E R  +    +S  Y L  ++ L++ + + V  P  +A++      L   L+
Sbjct: 118 LNAAYDVKESRPVWKRFSLSILYTLGIALLLLVAAGLMVTGPQVIAWIASLV-GLEQYLV 176

Query: 176 IIWNGRIYATMLALFIGLIFVHLF---LPAAKSKIMSILPGVIFTWISWVVGAVLFTHYI 232
            +W    +   LA+F+ ++ V LF   +P  + +   I PG + + I+W+  ++ +  Y+
Sbjct: 177 TLWTWLRWP--LAVFLLMLAVALFYYLVPDVEQRFRFITPGSVLSVIAWIGASLAYGFYV 234

Query: 233 VTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
             F+ Y+ MY  + +I+  L++ Y+     + GAELNA
Sbjct: 235 KNFANYNAMYGSIGAIIILLLYFYLSAAVVLFGAELNA 272


>gi|87198076|ref|YP_495333.1| ribonuclease BN [Novosphingobium aromaticivorans DSM 12444]
 gi|87133757|gb|ABD24499.1| ribonuclease BN [Novosphingobium aromaticivorans DSM 12444]
          Length = 344

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 74/253 (29%), Positives = 121/253 (47%), Gaps = 3/253 (1%)

Query: 22  EDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDE 81
            DG   A +++   ++++FPF + GA L  F G        ID V  A P V+A  I   
Sbjct: 61  NDGSIHAGNLAYMIIIALFPFFITGAALFSFFGEASQRAAAIDTVLIAMPPVVAATIEPA 120

Query: 82  ILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLL 141
              V+      L  +  +   +   + VE +R  L RAY      + +  RL+S G + L
Sbjct: 121 ARSVIEARTGWLLWVGGIFGLWTVGSLVETIRDILRRAYGTRWEHALWRYRLMSTG-ITL 179

Query: 142 ASVTLVIMS-FVFVAIPLALAYVRKFFPALGNLLLIIWNGR-IYATMLALFIGLIFVHLF 199
           ASV L++++ F  V I  A   +  F P  G+L+  +   R + A +L   + L+F+ L 
Sbjct: 180 ASVVLILLAIFAQVLIGAAQEVIEAFLPQFGDLVASLSLSRFVPAFVLYAALWLLFISLT 239

Query: 200 LPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLG 259
             A + +     PG +F  I W+    +    + TF +Y   Y  LA IM  L F +++G
Sbjct: 240 PGAYRGRDYPKWPGALFVTIWWIAVTTVLPGMLRTFFSYDLTYGSLAGIMIALFFFWLVG 299

Query: 260 VFFILGAELNASM 272
           +  ++GAELNA++
Sbjct: 300 LGMVVGAELNAAL 312


>gi|225677100|ref|ZP_03788102.1| ribonuclease, BN family [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225590859|gb|EEH12084.1| ribonuclease, BN family [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 271

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 131/280 (46%), Gaps = 31/280 (11%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIV----FGANLAGFLGAH 56
           +++++ IV+  +Y A+   +  DG   A ++S   LLS+FPF++      +  A FL  +
Sbjct: 2   LQKFYSIVY-CLYRALIDTIHNDGVEHAGYLSFLILLSIFPFLIVLMAVASTFANFLDQY 60

Query: 57  QFVPTVIDVVF--GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRI 114
                 I  VF     P+ I   +   I ++++ P + L T++ + A + +S+ +E LR 
Sbjct: 61  N-----IGWVFIIDNMPQDILSSLMPRIREIISGPPQSLLTLAIVGAVWTASSTIEGLRT 115

Query: 115 SLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL 174
            LN+AY+V     + + R++S            I+ F+ + + + L  V  F   +  L+
Sbjct: 116 ILNKAYKVPVSPPYILRRVLS------------ILQFLVITLIITLTIV--FSTLVPMLI 161

Query: 175 LIIWNGRIYATML----ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTH 230
              + G  Y   L     LF  + +++  LP  K  +  + PG     I W + A  F  
Sbjct: 162 DFSYQGLSYTRYLLIEFVLFTVVSWLYFMLPNIKQNLSDVFPGSCVAVILWTISASAFKQ 221

Query: 231 YI-VTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
           Y+  +F     +Y  L  ++  L+F YML + FI GA+ N
Sbjct: 222 YLKASFDQLDLIYGSLGGVVVSLLFFYMLSLIFIYGAKFN 261


>gi|206974201|ref|ZP_03235118.1| YihY family protein [Bacillus cereus H3081.97]
 gi|206747441|gb|EDZ58831.1| YihY family protein [Bacillus cereus H3081.97]
          Length = 289

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 75/270 (27%), Positives = 134/270 (49%), Gaps = 14/270 (5%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++    PE 
Sbjct: 19  DLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLLEPYVPED 76

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR 
Sbjct: 77  AMSLIEVNVDKVVNQQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETRSFIKTRA 136

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALG--NLLLIIWN-GRIYATMLA 188
           +S  + L      +I   VF  I      V     F A+G  +    +W+  R+ A+   
Sbjct: 137 LSIVFTLA-----IIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASFFV 191

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LF    F++ F P  K K   ++ G  F  + W+V +  F +Y+  F+ Y+ +Y GL  I
Sbjct: 192 LFALFSFLYTFAPDRKLKRREVISGATFATVGWIVVSYSFAYYVDKFANYANIYGGLGGI 251

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           +  +++ Y+ G   +LG E+N   +++++R
Sbjct: 252 IILMLWFYLTGWVILLGGEING--LLHHYR 279


>gi|15893462|ref|NP_346811.1| T-RNA-processing ribonuclease BN [Clostridium acetobutylicum ATCC
           824]
 gi|15022998|gb|AAK78151.1|AE007530_2 T-RNA-processing ribonuclease BN [Clostridium acetobutylicum ATCC
           824]
 gi|325507577|gb|ADZ19213.1| T-RNA-processing ribonuclease BN [Clostridium acetobutylicum EA
           2018]
          Length = 273

 Score = 85.5 bits (210), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 132/262 (50%), Gaps = 6/262 (2%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           ++ D I  F E+D  A+ S ++   +LS FPFI+F   L G+   +     ++ V+    
Sbjct: 4   LLLDLISRFNEDDVPALGSQLAYYLVLSFFPFIIFIMTLIGYTSLNN--KEILMVLSRIM 61

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           PE     I   + +V++     L ++S +   + +S G  A+   LN+AY V E R++  
Sbjct: 62  PESAFNLIHAAVAEVISTKHSQLMSLSLVLTIWSASAGFTAVIKGLNKAYGVQEARNFIK 121

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            R +S    +  +  ++ M F+ +   + L Y+  +     + ++ +W    Y   ++  
Sbjct: 122 VRFVSILCTIGVAFIILTMMFLLILGRIILNYL-AYKLGFSHKVIAVWEAVRYLIFVSTA 180

Query: 191 IGLIFVHLFLPAAKSKIM--SILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           I  IF  L+  A   K+M   +LPG +F+ ++ ++ +  F +Y+  F+ YS +Y  + +I
Sbjct: 181 I-FIFTALYRYAPCKKLMWIEVLPGSLFSTLNLILASFGFAYYVNNFANYSVIYGSIGAI 239

Query: 249 MTCLVFLYMLGVFFILGAELNA 270
           +  L +L+++ V  ILG E+NA
Sbjct: 240 IILLTWLFLVAVIVILGGEINA 261


>gi|28212101|ref|NP_783045.1| ribonuclease BN [Clostridium tetani E88]
 gi|28204544|gb|AAO36982.1| ribonuclease BN [Clostridium tetani E88]
          Length = 282

 Score = 85.5 bits (210), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 73/264 (27%), Positives = 142/264 (53%), Gaps = 16/264 (6%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG-AHQFVPTVIDVVFGAWPE 72
           + I   +E++  A+AS +S S LLS FPF++F   L GF    +++V   +  +    P+
Sbjct: 14  NIINKIIEDEVPALASQLSYSLLLSFFPFLIFLMTLLGFSSIDNEYVLLELKTML---PD 70

Query: 73  VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
              + + + ++++L      L + S +   + SS G  A+   +N+AY   E RS     
Sbjct: 71  SAYELVYNTVIEILGTRDSNLLSFSIIFTVWTSSTGFRAVIKGINKAYDEKEKRSLPKVF 130

Query: 133 LISFGYVLLASVTL---VIMSFVFVAIP--LALAYVRKFFPALGNLLLIIWNGRIYATML 187
           LIS    +L++++L   +I++ +F+     + L  V+K    +G+L  + WN   Y  +L
Sbjct: 131 LIS----ILSTLSLGFLIILTVLFLVFGQLIGLYLVQKL--KMGSLFYLTWNIIRYIIIL 184

Query: 188 A-LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           + L +    ++ F+P+ K +   ++PG IF  + W+  + +F++Y+  F+ YS +Y  + 
Sbjct: 185 SSLVVIFALMYKFIPSRKLRWREVMPGAIFATVGWLFSSFIFSYYVNNFANYSRIYGSIG 244

Query: 247 SIMTCLVFLYMLGVFFILGAELNA 270
           +++  +V+LY+  +  ILG ELNA
Sbjct: 245 AVIILMVWLYLTSIIIILGGELNA 268


>gi|257880157|ref|ZP_05659810.1| ribonuclease BN [Enterococcus faecium 1,230,933]
 gi|257814385|gb|EEV43143.1| ribonuclease BN [Enterococcus faecium 1,230,933]
          Length = 313

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 122/235 (51%), Gaps = 2/235 (0%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           LLS+FP I+   N+  FL   Q   TV+  +    PE + + I   I  +L   + GL +
Sbjct: 28  LLSLFPLIIAFGNILPFLHIDQ--ETVLTYLREVIPETVYQFIGPAIKDLLTQSSGGLLS 85

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
           +SALAA + +S  + AL+I++N+AY V   +++ I R  S   ++L  + +  ++ V   
Sbjct: 86  VSALAALWSASQSINALQIAMNKAYGVENRKNFLIVRFFSLIVIVLFMIAISGVTIVLGL 145

Query: 156 IPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVI 215
             L L  ++       N +      +   T++ALF+ +  ++L +P A+ K+ +I+PG I
Sbjct: 146 GQLILDAIQPIVQIPVNFIDQFQTLKWPITLVALFVIMFLIYLIVPNAQLKLKTIIPGTI 205

Query: 216 FTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           F  + W++ + +F+ Y   F+T  + Y  + S +  +++L       ILG  +NA
Sbjct: 206 FATVGWMLLSQVFSIYARYFATRISGYQIIGSFIVLMLWLNFAATIIILGGIINA 260


>gi|257893552|ref|ZP_05673205.1| ribonuclease BN [Enterococcus faecium 1,231,408]
 gi|314940015|ref|ZP_07847208.1| YihY family protein [Enterococcus faecium TX0133a04]
 gi|314941893|ref|ZP_07848757.1| YihY family protein [Enterococcus faecium TX0133C]
 gi|314952420|ref|ZP_07855426.1| YihY family protein [Enterococcus faecium TX0133A]
 gi|314993211|ref|ZP_07858591.1| YihY family protein [Enterococcus faecium TX0133B]
 gi|314997801|ref|ZP_07862713.1| YihY family protein [Enterococcus faecium TX0133a01]
 gi|257829931|gb|EEV56538.1| ribonuclease BN [Enterococcus faecium 1,231,408]
 gi|313588173|gb|EFR67018.1| YihY family protein [Enterococcus faecium TX0133a01]
 gi|313592292|gb|EFR71137.1| YihY family protein [Enterococcus faecium TX0133B]
 gi|313595463|gb|EFR74308.1| YihY family protein [Enterococcus faecium TX0133A]
 gi|313599318|gb|EFR78163.1| YihY family protein [Enterococcus faecium TX0133C]
 gi|313640748|gb|EFS05328.1| YihY family protein [Enterococcus faecium TX0133a04]
          Length = 326

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 122/235 (51%), Gaps = 2/235 (0%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           LLS+FP I+   N+  FL   Q   TV+  +    PE + + I   I  +L   + GL +
Sbjct: 41  LLSLFPLIIAFGNILPFLHIDQ--ETVLTYLREVIPETVYQFIGPAIKDLLTQSSGGLLS 98

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
           +SALAA + +S  + AL+I++N+AY V   +++ I R  S   ++L  + +  ++ V   
Sbjct: 99  VSALAALWSASQSINALQIAMNKAYGVENRKNFLIVRFFSLIVIVLFMIAISGVTIVLGL 158

Query: 156 IPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVI 215
             L L  ++       N +      +   T++ALF+ +  ++L +P A+ K+ +I+PG I
Sbjct: 159 GQLILDAIQPIVQIPVNFIDQFQTLKWPITLVALFVIMFLIYLIVPNAQLKLKTIIPGTI 218

Query: 216 FTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           F  + W++ + +F+ Y   F+T  + Y  + S +  +++L       ILG  +NA
Sbjct: 219 FATVGWMLLSQVFSIYARYFATRISGYQIIGSFIVLMLWLNFAATIIILGGIINA 273


>gi|77460571|ref|YP_350078.1| ribonuclease BN [Pseudomonas fluorescens Pf0-1]
 gi|77384574|gb|ABA76087.1| putative ribonuclease [Pseudomonas fluorescens Pf0-1]
          Length = 316

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 128/264 (48%), Gaps = 9/264 (3%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQF---VPTVIDVVF 67
           ++   I  FV+++    AS ++   L S+FPFI+F   L GFL    F   +    ++V 
Sbjct: 14  VMVRTITEFVDDEMSTYASALAYQMLFSLFPFILFLIALIGFLHLPDFFSWLRLQSELVL 73

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
                    P+ D++ Q       GL ++  + A Y +S GV  +  ++N AY VVE R 
Sbjct: 74  PPQALEQVNPVIDQLQQ----SKGGLLSVGIVIALYTASAGVRLMMSAMNAAYDVVEGRP 129

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATM 186
            +    +S  Y +  +  L++ + + V  P  + ++      L  +++ +W   R    +
Sbjct: 130 LWKRFPLSVIYTVGIAGMLLVAAALMVLGPQVMGWIAAQV-GLEEVIVTLWTIARWPVIV 188

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           + + + +  ++  +P  K +   I PG +   + W++ ++ F  Y+ TF+ Y+ MY  + 
Sbjct: 189 ILMMVAVALIYYVMPDVKQEFRFITPGSVLAVVVWIIASLGFAFYVKTFANYNAMYGSIG 248

Query: 247 SIMTCLVFLYMLGVFFILGAELNA 270
           +I+  L++ Y+     +LGAE+NA
Sbjct: 249 AIIVLLLYFYISSAVLLLGAEMNA 272


>gi|149185317|ref|ZP_01863634.1| hypothetical protein ED21_19727 [Erythrobacter sp. SD-21]
 gi|148831428|gb|EDL49862.1| hypothetical protein ED21_19727 [Erythrobacter sp. SD-21]
          Length = 297

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 76/255 (29%), Positives = 124/255 (48%), Gaps = 7/255 (2%)

Query: 22  EDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDE 81
            DG+  A +++  A+L++FPF + GA +   +G        I+ V  A P V+   I   
Sbjct: 11  NDGFIHAGNLAYLAMLAIFPFFILGAAVFSAIGEESERAATINAVLYALPPVVGNVIEPV 70

Query: 82  ILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLL 141
              V+   +  L    A  A +   + VE +R  L RAY     ++++  RL S G V+L
Sbjct: 71  ARDVVQARSGWLLWAGAFVALWTVGSLVETIRDILRRAYGTEATKAFWKYRLFSTG-VIL 129

Query: 142 ASVTLVIMSFV--FVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF--IGLIFVH 197
            +V L+++S +  FV I  A   +  +FP L + LL +   RI      LF  + LIF  
Sbjct: 130 GAVFLLMLSLMAQFV-IGTAQQVIEAYFPQLVDRLLELQLSRIVPA-FGLFGSLYLIFYT 187

Query: 198 LFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
           L     +       PGV+ T + W+    +    + +F TY   Y GLA +M  L F ++
Sbjct: 188 LTPSKYRRHRYPKWPGVLLTTLWWIAVTTIMPAVLSSFFTYDLTYGGLAGVMIALFFFWL 247

Query: 258 LGVFFILGAELNASM 272
           +G+  ++GAELNA++
Sbjct: 248 VGLGVVIGAELNAAL 262


>gi|327438684|dbj|BAK15049.1| predicted membrane protein [Solibacillus silvestris StLB046]
          Length = 311

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/263 (27%), Positives = 124/263 (47%), Gaps = 7/263 (2%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
           I D I      D   M + ++   LLS FP ++F   L  +L   Q    + D +    P
Sbjct: 34  IQDLIYRTKNVDMSGMGAQLAYFFLLSFFPMLIFMVTLLPYLNLEQ--GQIFDFLSDVMP 91

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
           E +   I   +  VL     GL +I  +   + +S GV+AL  SLNRAY V E R+ ++ 
Sbjct: 92  EEVYGLIETTLTDVLNNQNGGLLSIGIIGTLWSASRGVDALMKSLNRAYDV-EGRAGFLN 150

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL-F 190
           RL S  + + A V +++++ VF      +  +   +  +      +W    + T   L F
Sbjct: 151 RLWSLVFTI-ALVAVILIALVFPVFGQQIGNIVFGYLGVEESFANVWTFVRWITPPTLIF 209

Query: 191 IGLIFVHLFLPAAKSKIM--SILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           I +  ++  +P    ++   S++PG +F  + W+V    F+ YI  F  YS+ Y  +  +
Sbjct: 210 IVISVMYWIVPNTDPRLTMFSVIPGAVFATLGWLVLTYGFSFYINNFGNYSSTYGSIGGV 269

Query: 249 MTCLVFLYMLGVFFILGAELNAS 271
           +  +++LY  G+  ILG  LNAS
Sbjct: 270 IILMLWLYFTGMIIILGGLLNAS 292


>gi|303242465|ref|ZP_07328946.1| ribonuclease BN [Acetivibrio cellulolyticus CD2]
 gi|302589989|gb|EFL59756.1| ribonuclease BN [Acetivibrio cellulolyticus CD2]
          Length = 281

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/269 (26%), Positives = 135/269 (50%), Gaps = 14/269 (5%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGF--LGAHQFVPTVIDVVF 67
           +++ D    F ++D  A+AS ++   +L++FPF++F  NL     + + Q +  +  ++ 
Sbjct: 12  NVVKDLYFRFNDDDVPALASQLAYYFILAIFPFLIFLINLVSLTPITSEQALNDLSKII- 70

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P  +   I   I QV     +   + S  A  + SSNG+ A+  SLN+AY   E R+
Sbjct: 71  ---PTAVYDIIRGVIGQVAQTNRETFLSFSMAATLWVSSNGMNAVVKSLNKAYDQHETRA 127

Query: 128 WYITRLISFGYVLLASVTLV-IMSFVFVAIPLALAYVRKFFPALG--NLLLIIWNG-RIY 183
           ++  R    G  ++A++     + F F+ + L     R  F  LG  N   ++W   R  
Sbjct: 128 FWKVR----GLSIIATIAFAFTILFSFILLILGEIIGRNVFIFLGFSNSFKMLWPYIRFI 183

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
             +L +FI    ++ ++P  + K   +  G +F+   W + ++LF+ Y+  FS YS+ Y 
Sbjct: 184 IPVLIMFIVFTLLYRYMPNRRMKYYEVFAGSLFSSFGWFITSILFSLYVNNFSNYSSTYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASM 272
            +  I+  +++LY + +  +LG ELNAS+
Sbjct: 244 SIGGIILLIIWLYWISIIILLGGELNASL 272


>gi|227550490|ref|ZP_03980539.1| ribonuclease BN [Enterococcus faecium TX1330]
 gi|257888517|ref|ZP_05668170.1| ribonuclease BN [Enterococcus faecium 1,141,733]
 gi|257897108|ref|ZP_05676761.1| ribonuclease BN [Enterococcus faecium Com12]
 gi|257899047|ref|ZP_05678700.1| ribonuclease BN [Enterococcus faecium Com15]
 gi|293377331|ref|ZP_06623535.1| YihY family protein [Enterococcus faecium PC4.1]
 gi|293572525|ref|ZP_06683504.1| ribonuclease BN [Enterococcus faecium E980]
 gi|227180391|gb|EEI61363.1| ribonuclease BN [Enterococcus faecium TX1330]
 gi|257824571|gb|EEV51503.1| ribonuclease BN [Enterococcus faecium 1,141,733]
 gi|257833673|gb|EEV60094.1| ribonuclease BN [Enterococcus faecium Com12]
 gi|257836959|gb|EEV62033.1| ribonuclease BN [Enterococcus faecium Com15]
 gi|291607442|gb|EFF36785.1| ribonuclease BN [Enterococcus faecium E980]
 gi|292644023|gb|EFF62129.1| YihY family protein [Enterococcus faecium PC4.1]
          Length = 307

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 122/235 (51%), Gaps = 2/235 (0%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           LLS+FP I+   N+  FL   Q   TV+  +    PE + + I   I  +L   + GL +
Sbjct: 41  LLSLFPLIIAFGNILPFLHIDQ--ETVLTYLREVIPETVYQFIGPAIKDLLTQSSGGLLS 98

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
           +SALAA + +S  + AL+I++N+AY V   +++ I R  S   ++L  + +  ++ V   
Sbjct: 99  VSALAALWSASQSINALQIAMNKAYGVENRKNFLIVRFFSLIVIVLFMIAISGVTIVLGL 158

Query: 156 IPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVI 215
             L L  ++       N +      +   T++ALF+ +  ++L +P A+ K+ +I+PG I
Sbjct: 159 GQLILDAIQPIVQIPVNFIDQFQTLKWPITLVALFVIMFLIYLIVPNAQLKLKTIIPGTI 218

Query: 216 FTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           F  + W++ + +F+ Y   F+T  + Y  + S +  +++L       ILG  +NA
Sbjct: 219 FATVGWMLLSQVFSIYARYFATRISGYQIIGSFIVLMLWLNFAATIIILGGIINA 273


>gi|56964680|ref|YP_176411.1| hypothetical protein ABC2916 [Bacillus clausii KSM-K16]
 gi|56910923|dbj|BAD65450.1| conserved hypothetical protein [Bacillus clausii KSM-K16]
          Length = 276

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/261 (26%), Positives = 130/261 (49%), Gaps = 18/261 (6%)

Query: 27  MASHISLSALLSVFPFIVFG-ANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQV 85
           +A+ ++   +LS+FP ++F  A ++ F   +  V  +I+  F   P  I    +  +L  
Sbjct: 25  LAATLAFYFILSIFPLMIFVLAGVSFFEINNDEVQNLINAYF---PGEIGDTFSRIVLNT 81

Query: 86  LAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVT 145
           +  P  GL +I  L   + +SNG+ A   S+NRAY + E R +   R I+ G     +V 
Sbjct: 82  IGEPQAGLLSIGILGTLWSASNGINAFIRSVNRAYNIEETRHFLKLRSIAIGL----TVG 137

Query: 146 LVIMSFVFVAIPL------ALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLF 199
           +V++  + +A+P+       L       P    ++ ++ N R  A    + + L+ ++  
Sbjct: 138 MVLLIIITLALPVFGNQILNLLEAFLLLPT--EVVAMLDNFRWIAAFAIMIVALMALYWI 195

Query: 200 LPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLG 259
            P AK +    L G IF  I W + +  F+ Y+  ++ Y + Y  LA ++  + + ++ G
Sbjct: 196 APNAKQRFRDGLIGAIFATIGWQLISFFFSLYVSNYANYESTYGPLAGVIILMFWFFLTG 255

Query: 260 VFFILGAELNASMIIYYWRKK 280
           +  I+GAE+NA++  ++ RKK
Sbjct: 256 IILIVGAEINATL--HHLRKK 274


>gi|69244644|ref|ZP_00602908.1| Ribonuclease BN [Enterococcus faecium DO]
 gi|257882958|ref|ZP_05662611.1| ribonuclease BN [Enterococcus faecium 1,231,502]
 gi|257885209|ref|ZP_05664862.1| ribonuclease BN [Enterococcus faecium 1,231,501]
 gi|257891460|ref|ZP_05671113.1| ribonuclease BN [Enterococcus faecium 1,231,410]
 gi|258614499|ref|ZP_05712269.1| ribonuclease BN, putative [Enterococcus faecium DO]
 gi|260560536|ref|ZP_05832710.1| ribonuclease BN [Enterococcus faecium C68]
 gi|261206549|ref|ZP_05921249.1| ribonuclease BN [Enterococcus faecium TC 6]
 gi|289565459|ref|ZP_06445908.1| ribonuclease BN [Enterococcus faecium D344SRF]
 gi|293553216|ref|ZP_06673853.1| ribonuclease BN [Enterococcus faecium E1039]
 gi|293560238|ref|ZP_06676738.1| ribonuclease BN [Enterococcus faecium E1162]
 gi|293568268|ref|ZP_06679592.1| ribonuclease BN [Enterococcus faecium E1071]
 gi|294614679|ref|ZP_06694581.1| ribonuclease BN [Enterococcus faecium E1636]
 gi|294619024|ref|ZP_06698519.1| ribonuclease BN [Enterococcus faecium E1679]
 gi|294620967|ref|ZP_06700166.1| ribonuclease BN [Enterococcus faecium U0317]
 gi|314950073|ref|ZP_07853360.1| YihY family protein [Enterococcus faecium TX0082]
 gi|68196235|gb|EAN10664.1| Ribonuclease BN [Enterococcus faecium DO]
 gi|257818616|gb|EEV45944.1| ribonuclease BN [Enterococcus faecium 1,231,502]
 gi|257821061|gb|EEV48195.1| ribonuclease BN [Enterococcus faecium 1,231,501]
 gi|257827820|gb|EEV54446.1| ribonuclease BN [Enterococcus faecium 1,231,410]
 gi|260073538|gb|EEW61866.1| ribonuclease BN [Enterococcus faecium C68]
 gi|260079259|gb|EEW66950.1| ribonuclease BN [Enterococcus faecium TC 6]
 gi|289162788|gb|EFD10639.1| ribonuclease BN [Enterococcus faecium D344SRF]
 gi|291588980|gb|EFF20804.1| ribonuclease BN [Enterococcus faecium E1071]
 gi|291592417|gb|EFF24024.1| ribonuclease BN [Enterococcus faecium E1636]
 gi|291594685|gb|EFF26067.1| ribonuclease BN [Enterococcus faecium E1679]
 gi|291599425|gb|EFF30443.1| ribonuclease BN [Enterococcus faecium U0317]
 gi|291602626|gb|EFF32841.1| ribonuclease BN [Enterococcus faecium E1039]
 gi|291605810|gb|EFF35244.1| ribonuclease BN [Enterococcus faecium E1162]
 gi|313643608|gb|EFS08188.1| YihY family protein [Enterococcus faecium TX0082]
          Length = 307

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 122/235 (51%), Gaps = 2/235 (0%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           LLS+FP I+   N+  FL   Q   TV+  +    PE + + I   I  +L   + GL +
Sbjct: 41  LLSLFPLIIAFGNILPFLHIDQ--ETVLTYLREVIPETVYQFIGPAIKDLLTQSSGGLLS 98

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
           +SALAA + +S  + AL+I++N+AY V   +++ I R  S   ++L  + +  ++ V   
Sbjct: 99  VSALAALWSASQSINALQIAMNKAYGVENRKNFLIVRFFSLIVIVLFMIAISGVTIVLGL 158

Query: 156 IPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVI 215
             L L  ++       N +      +   T++ALF+ +  ++L +P A+ K+ +I+PG I
Sbjct: 159 GQLILDAIQPIVQIPVNFIDQFQTLKWPITLVALFVIMFLIYLIVPNAQLKLKTIIPGTI 218

Query: 216 FTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           F  + W++ + +F+ Y   F+T  + Y  + S +  +++L       ILG  +NA
Sbjct: 219 FATVGWMLLSQVFSIYARYFATRISGYQIIGSFIVLMLWLNFAATIIILGGIINA 273


>gi|168334236|ref|ZP_02692437.1| hypothetical protein Epulo_04779 [Epulopiscium sp. 'N.t. morphotype
           B']
          Length = 292

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 134/274 (48%), Gaps = 24/274 (8%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH-----QFVPTVIDVVF 67
           Y+  + F+  D    ++ ++   +L++FPF++   NL  ++        ++VP V+    
Sbjct: 9   YNIKKRFLNHDVSPRSAQMTYYWILAIFPFLLMIINLISYVKIDSINFMEYVPKVV---- 64

Query: 68  GAWPEVIAKPITDEILQVL--AVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
              P ++A P+ +  +  +       G+F + A+ A + +S  V  L   +  AY VV+ 
Sbjct: 65  ---PSMVA-PLVESTVNSMIEKRSGTGIF-VGAVLALWSTSAAVNTLIKGIYLAYGVVDS 119

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFF----PALGNLLLIIWN-G 180
           R++ + +L    Y LL +  L+ M  + +       Y+ K F    P    L+   W+  
Sbjct: 120 RNFVVRKLAGMMYSLLLAFILIAMVVLLIFGNKLGQYILKLFLVRYPKSYTLM---WDLT 176

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R+  + + L     F+H  +P    K   + PGV FT ISW V + LF+ Y+  FS Y +
Sbjct: 177 RLCLSWILLISSSYFIHRVIPRRHIKNRYLWPGVFFTAISWYVFSYLFSIYVEHFSNYGS 236

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMII 274
           MY  +  I   L++LY  G+F ++GAE+NA ++I
Sbjct: 237 MYGSIGGIFVLLIWLYTNGLFILIGAEINAIILI 270


>gi|56418955|ref|YP_146273.1| transporter [Geobacillus kaustophilus HTA426]
 gi|56378797|dbj|BAD74705.1| transporter [Geobacillus kaustophilus HTA426]
          Length = 277

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 107/204 (52%), Gaps = 8/204 (3%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+     I   + +++     GL + S +AA + +SNG+ A+  + NRAY V E R ++I
Sbjct: 65  PKEALHLIETNVYRLMNEQNGGLLSFSIIAAIWSASNGMSAIMRAFNRAYDVQEDRPFWI 124

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKF-FPALG--NLLLIIWNG-RIYATM 186
            R    G  ++ ++ ++++  V + +P+    +  F F ALG     L +WN  R   + 
Sbjct: 125 VR----GLSIVLTLGMIVVIIVALVLPVFGRIIGLFLFSALGLSQQFLEVWNAFRWVTSS 180

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           L LF     ++ F P  + + ++++ G +F    W+  ++ F +Y+  F+ Y+ MY  L 
Sbjct: 181 LLLFAVFTALYYFAPNKQLRCVNVVRGALFATAGWIAASLAFAYYVNNFADYTAMYGSLG 240

Query: 247 SIMTCLVFLYMLGVFFILGAELNA 270
            ++  +V+ Y+ G+  +LG ELNA
Sbjct: 241 GMIVLMVWFYLSGMILVLGGELNA 264


>gi|331085373|ref|ZP_08334459.1| hypothetical protein HMPREF0987_00762 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330408156|gb|EGG87646.1| hypothetical protein HMPREF0987_00762 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 277

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/273 (24%), Positives = 131/273 (47%), Gaps = 11/273 (4%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M+E     + ++   ++   E    A A+  +   +LS+ PFI+        L   Q+ P
Sbjct: 1   MKETIMKKYRLLNRIMDRISENHTGAYAAQSAFFIVLSMIPFIML------LLALVQYTP 54

Query: 61  TVIDVVFGAWPEVIAK---PITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLN 117
                V  A   V+ K   P+   I+  +   ++ + +++ L A + +  GV A+   LN
Sbjct: 55  VTKADVIRAVTHVLPKTIYPMIVSIVNQVYNQSQAMISLTGLVAIWSAGRGVLAMSAGLN 114

Query: 118 RAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALA-YVRKFFPALGNLLLI 176
             Y   E R++   RL +  Y +L  + +V +S V +     L+ ++   +P +  ++ +
Sbjct: 115 SVYGSKETRNYIYLRLRAAFYTVLFIIAIV-LSLVILGFGDRLSIFIVNHYPFMKGIIDL 173

Query: 177 IWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFS 236
           I N R  A+++ L +  + ++ FLP  K+K +   PG   T I W   + +F+ Y+  F+
Sbjct: 174 IINIRAVASIVVLTVFSMTIYHFLPNKKTKFIRQFPGAFLTAIGWAAASYIFSAYVNIFT 233

Query: 237 TYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
            +STMY  + +IM  +++LY      +LG E+N
Sbjct: 234 GFSTMYGSMTTIMLIMLWLYACMYIMLLGGEVN 266


>gi|222151855|ref|YP_002561015.1| hypothetical protein MCCL_1612 [Macrococcus caseolyticus JCSC5402]
 gi|222120984|dbj|BAH18319.1| conserved hypothetical protein [Macrococcus caseolyticus JCSC5402]
          Length = 342

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 131/255 (51%), Gaps = 12/255 (4%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVIDVVFGAWPEVIAKPIT 79
           ++D   +++ ++   LLS+FP ++F   L   +   +  P T+ +++    P   A  IT
Sbjct: 84  KDDAAGLSAQLAYYFLLSLFPMLIF---LLTLVPLFKVSPETITNMIAKNAPGDAANMIT 140

Query: 80  DEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYV 139
           D I  V+     GL +   +AA + +SNG+ AL  + N +Y V + R+  +++L+S    
Sbjct: 141 DVISDVMNNANGGLLSFGLIAALWSASNGMTALMNAFNVSYEVEDARNPIVSKLLS---- 196

Query: 140 LLASVTLVIMSFVFVAIPLALAYVRKF-FPALGNLLLIIWNGRIYATMLALFIG-LIFVH 197
           +L +V +V++  V +A+P+    +  + F   G      W   +    L L +  ++F  
Sbjct: 197 VLFTVVMVLVFGVALALPVFGEQIGNYLFGQFGLESQFKWIFSLVKVALPLIVTFIVFTT 256

Query: 198 LFL--PAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFL 255
           L+   P  K +  S++PG +F  I W+  + LF +Y+  F  YS  Y  +  I+  +++L
Sbjct: 257 LYAIAPNIKLQFKSVIPGALFATIVWIGASFLFGYYVSNFGNYSKTYGSIGGIIVLMLWL 316

Query: 256 YMLGVFFILGAELNA 270
           Y+ G   I+G+++NA
Sbjct: 317 YLTGFIIIIGSQINA 331


>gi|254520560|ref|ZP_05132616.1| YihY family protein [Clostridium sp. 7_2_43FAA]
 gi|226914309|gb|EEH99510.1| YihY family protein [Clostridium sp. 7_2_43FAA]
          Length = 280

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/262 (24%), Positives = 132/262 (50%), Gaps = 8/262 (3%)

Query: 14  DAIEHFV----EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D+I +F+     +D +A+ + ++   +L+ FPF++F   L GF   +     ++D +   
Sbjct: 14  DSIIYFIVKINNDDIFALGAQLAYYLILAFFPFLIFLLTLIGFSRLNS--ADILDGLRTI 71

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P  +   +   +++++     GL   S + + + +S+G  A+   +N+AY + E RS+ 
Sbjct: 72  LPNNVFTLVDTTVVEIVDTQNAGLLGASIVLSMWSASSGFRAVIKGVNKAYDIREHRSFI 131

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLA 188
               I+  + L  ++ +++   + V   +   Y+   FP   N+L  IWN  R    +LA
Sbjct: 132 KRAFIAIFFTLALALIIMLTLAMLVFGEIIGKYLISVFP-FQNILRNIWNISRYIVVILA 190

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           +      ++ + PA K     + PG I + + W+V ++ F++YI   + YS +Y  + ++
Sbjct: 191 MIWIFACIYRYTPARKIPWKEVFPGAIVSTLGWIVVSLAFSYYINNIANYSRLYGSVGAV 250

Query: 249 MTCLVFLYMLGVFFILGAELNA 270
              + +LY+  +  ILGAE+N+
Sbjct: 251 FILMTWLYITSMILILGAEINS 272


>gi|311029165|ref|ZP_07707255.1| ribonuclease BN [Bacillus sp. m3-13]
          Length = 274

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/207 (28%), Positives = 105/207 (50%), Gaps = 10/207 (4%)

Query: 78  ITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFG 137
           I   + ++L      L +   +A  +F+SNG+ A+  + NRA+ V E R ++I R    G
Sbjct: 71  IESNVSRILNEQRGDLLSFGIIATIWFASNGINAIVRAFNRAFDVNENRHFFIVR----G 126

Query: 138 YVLLASVTLVIMSFVFVAIPLALAYVRKF-FPALG--NLLLIIWNG-RIYATMLALFIGL 193
             +L ++ +V +  V + +P+    +  F F + G     L IWN  R   + + LF   
Sbjct: 127 TAILLTLAMVFVIIVALLLPVFGREIGLFIFSSYGLSEEFLTIWNTIRWGVSFVILFFVF 186

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++L  P  +  +  +L G  F  + W+  +VLF++Y+  F  Y+ MY  L  I+  LV
Sbjct: 187 TCLYLAAPNIRLHLKDVLAGSFFATVGWMTVSVLFSYYVSNFGNYTAMYGSLGGIIVLLV 246

Query: 254 FLYMLGVFFILGAELNASMIIYYWRKK 280
           + Y+ G+  I+G E+NA  I+  W+K 
Sbjct: 247 WFYLSGLMIIIGGEINA--ILLQWKKS 271


>gi|85709734|ref|ZP_01040799.1| hypothetical protein NAP1_12653 [Erythrobacter sp. NAP1]
 gi|85688444|gb|EAQ28448.1| hypothetical protein NAP1_12653 [Erythrobacter sp. NAP1]
          Length = 365

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/252 (28%), Positives = 119/252 (47%), Gaps = 1/252 (0%)

Query: 22  EDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDE 81
           +DG+  A +++  ++L++FPF + GA L    G      +++  V    P   AK I   
Sbjct: 77  QDGFIHAGNLAYLSMLAIFPFFILGAALFELFGGRDLAVSMVQTVVAGLPPSAAKVIAPV 136

Query: 82  ILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLL 141
              V+      L    A  A +  S+ +E++R  L RAY      S+   RL+S G +L 
Sbjct: 137 AEDVVYARTGWLLWFGAAVALWTVSSLIESIRDILRRAYGTRARHSFVRYRLLSAGIILG 196

Query: 142 ASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY-ATMLALFIGLIFVHLFL 200
           A V L+   F  V I  A   + + FP L   L  +   R+  A  L L + L+F  L  
Sbjct: 197 AVVVLMASLFAQVMIGTAQVVIMERFPQLLEALGTLRLSRVVPAAGLMLSLYLLFYTLTP 256

Query: 201 PAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGV 260
              ++K+    PG +FT + W    +     + +F TY   Y  +A I+  L F +++G+
Sbjct: 257 TEYRAKVYPKWPGALFTAVWWFGVTIALPPIMRSFFTYDLTYGSMAGIIIALFFFWLVGL 316

Query: 261 FFILGAELNASM 272
             ++GAELNA++
Sbjct: 317 GLVIGAELNAAL 328


>gi|261418745|ref|YP_003252427.1| ribonuclease BN [Geobacillus sp. Y412MC61]
 gi|319765561|ref|YP_004131062.1| ribonuclease BN [Geobacillus sp. Y412MC52]
 gi|261375202|gb|ACX77945.1| ribonuclease BN [Geobacillus sp. Y412MC61]
 gi|317110427|gb|ADU92919.1| ribonuclease BN [Geobacillus sp. Y412MC52]
          Length = 277

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 107/204 (52%), Gaps = 8/204 (3%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+     I   + +++     GL + S +AA + +SNG+ A+  + NRAY V E R ++I
Sbjct: 65  PKEALHLIETNVYRLMNEQNGGLLSFSIIAAIWSASNGMSAIMRAFNRAYDVQEDRPFWI 124

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKF-FPALG--NLLLIIWNG-RIYATM 186
            R    G  ++ ++ ++++  V + +P+    +  F F ALG     L +WN  R   + 
Sbjct: 125 VR----GLSIVLTLGMIMVIIVALVLPVFGRIIGLFLFSALGLSQQFLEVWNAFRWVTSS 180

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           L LF     ++ F P  + + ++++ G +F    W+  ++ F +Y+  F+ Y+ MY  L 
Sbjct: 181 LLLFAVFTALYYFAPNKQLRCVNVVRGALFATAGWIAASLAFAYYVNNFADYTAMYGSLG 240

Query: 247 SIMTCLVFLYMLGVFFILGAELNA 270
            ++  +V+ Y+ G+  +LG ELNA
Sbjct: 241 GMIVLMVWFYLSGMILVLGGELNA 264


>gi|325660901|ref|ZP_08149529.1| hypothetical protein HMPREF0490_00261 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325472975|gb|EGC76185.1| hypothetical protein HMPREF0490_00261 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 277

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 68/273 (24%), Positives = 130/273 (47%), Gaps = 11/273 (4%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M+E     + ++   +    E    A A+  +   +LS+ PFI+        L   Q+ P
Sbjct: 1   MKETIMKKYRLLNRIMNRISENHTGAYAAQSAFFIVLSMIPFIML------LLALVQYTP 54

Query: 61  TVIDVVFGAWPEVIAK---PITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLN 117
                V  A   V+ K   P+   I+  +   ++ + +++ L A + +  GV A+   LN
Sbjct: 55  VTKADVIRAVTHVLPKTIYPMIVSIVNQVYNQSQAMISLTGLVAIWSAGRGVLAMSAGLN 114

Query: 118 RAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALA-YVRKFFPALGNLLLI 176
             Y   E R++   RL +  Y +L  + +V +S V +     L+ ++   +P +  ++ +
Sbjct: 115 SVYGSKETRNYIYLRLRAAFYTVLFIIAIV-LSLVILGFGDRLSIFIVNHYPFMKGIIDL 173

Query: 177 IWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFS 236
           I N R  A+++ L +  + ++ FLP  K+K +   PG   T I W   + +F+ Y+  F+
Sbjct: 174 IINIRAVASIVVLTVFSMTIYHFLPNKKTKFIRQFPGAFLTAIGWAAASYIFSAYVNIFT 233

Query: 237 TYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
            +STMY  + +IM  +++LY      +LG E+N
Sbjct: 234 GFSTMYGSMTTIMLIMLWLYACMYIMLLGGEVN 266


>gi|49086024|gb|AAT51322.1| PA2751 [synthetic construct]
          Length = 300

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 131/278 (47%), Gaps = 31/278 (11%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV-------- 59
           +F ++   +  F+E D    AS ++   L S+FPF++    L G+L   +F         
Sbjct: 11  LFGLVKRTVNEFLEGDMPTYASALAYQMLFSLFPFLLVLITLVGYLHLPEFFAWLREQAA 70

Query: 60  ----PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRIS 115
               P  +D V          P+ D++ Q       GL  I    A + SS G+ ++ I+
Sbjct: 71  LLLPPEAMDQV---------NPVIDQLQQ----QKGGLLPIGIAVALWTSSAGIRSMMIA 117

Query: 116 LNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLL 175
           LN AY V E R  +    +S  Y L  ++ L++ + + V  P  +A++      L   L+
Sbjct: 118 LNAAYDVKESRPVWKRFSLSILYTLGIALLLLVAAGLMVTGPQVIAWIAGLV-GLEQYLV 176

Query: 176 IIWNGRIYATMLALFIGLIFVHLF---LPAAKSKIMSILPGVIFTWISWVVGAVLFTHYI 232
            +W    +   LA+F+ ++ V LF   +P  + +   I PG + + I+W+  ++ +  Y+
Sbjct: 177 TLWTWLRWP--LAVFLLMLAVALFYYLVPDVEQRFRFITPGSVLSVIAWIAASLAYGFYV 234

Query: 233 VTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
             F+ Y+ MY  + +I+  L++ Y+     + GAELNA
Sbjct: 235 KNFANYNAMYGSIGAIIILLLYFYLSAAVVLFGAELNA 272


>gi|297531287|ref|YP_003672562.1| ribonuclease BN [Geobacillus sp. C56-T3]
 gi|297254539|gb|ADI27985.1| ribonuclease BN [Geobacillus sp. C56-T3]
          Length = 277

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 107/204 (52%), Gaps = 8/204 (3%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+     I   + +++     GL + S +AA + +SNG+ A+  + NRAY V E R ++I
Sbjct: 65  PKEALHLIETNVHRLIDEQNGGLLSFSIIAAIWSASNGMSAIMRAFNRAYDVQEDRPFWI 124

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKF-FPALG--NLLLIIWNG-RIYATM 186
            R    G  ++ ++ ++++  V + +P+    +  F F ALG     L +WN  R   + 
Sbjct: 125 VR----GLSIVLTLGMIMVIIVALVLPVFGRIIGLFLFSALGLSQQFLEVWNAFRWVTSS 180

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           L LF     ++ F P  + + ++++ G +F    W+  ++ F +Y+  F+ Y+ MY  L 
Sbjct: 181 LLLFAVFTALYYFAPNKQLRCVNVVRGALFATAGWIAASLAFAYYVNNFADYTAMYGSLG 240

Query: 247 SIMTCLVFLYMLGVFFILGAELNA 270
            ++  +V+ Y+ G+  +LG ELNA
Sbjct: 241 GMIVLMVWFYLSGMILVLGGELNA 264


>gi|302876247|ref|YP_003844880.1| ribonuclease BN [Clostridium cellulovorans 743B]
 gi|307686979|ref|ZP_07629425.1| ribonuclease BN [Clostridium cellulovorans 743B]
 gi|302579104|gb|ADL53116.1| ribonuclease BN [Clostridium cellulovorans 743B]
          Length = 286

 Score = 83.2 bits (204), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 131/270 (48%), Gaps = 12/270 (4%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGF--LGAHQFVPTVIDVVFGAWPE 72
           A++ + E+   ++ASHISL+ LLS FP +VF   LAG+  +   Q +  ++D +    P 
Sbjct: 19  AVKRYNEDAADSLASHISLNLLLSFFPIMVFLLTLAGYSPIEGDQVIALILDFI----PT 74

Query: 73  VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
                + + I QVL      L ++S L   Y +S G +A+ + LN AY V E R + +  
Sbjct: 75  EAHTLMKNTIYQVLDHKNPTLLSLSLLTTMYGASRGFKAILLGLNIAYDVDENRGFIVRN 134

Query: 133 LISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA-LFI 191
           L++  +     + ++    + V       ++        N   IIW    YA M + ++I
Sbjct: 135 LLAIFFTFAIVLLVIGSLLLLVLGQTIWDFIENMLDLPDNFF-IIWTFIRYAGMFSIMYI 193

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
               ++    A K    ++  G +FT ISW V +  F+ Y+  F  Y+ +Y G+A +   
Sbjct: 194 TFAILYAKSSAIKLPFKTVRYGTLFTTISWFVVSYGFSFYVDNFGNYANIYGGIAGLFIM 253

Query: 252 LVFLYMLGVFFILGAELNASMIIYYWRKKP 281
           +++L ++    + G ELNA+  IYY  K P
Sbjct: 254 ILWLNLMSSVILFGGELNAA--IYY--KNP 279


>gi|229543009|ref|ZP_04432069.1| ribonuclease BN [Bacillus coagulans 36D1]
 gi|229327429|gb|EEN93104.1| ribonuclease BN [Bacillus coagulans 36D1]
          Length = 280

 Score = 83.2 bits (204), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 109/214 (50%), Gaps = 8/214 (3%)

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            V+++V    P    K I   + +VL     GL +   +A  + +SNG+ A+  +LNRAY
Sbjct: 62  DVLNMVRHFAPSQSFKLIETTLKEVLTNRHGGLLSFGMIATLWSASNGMNAVIKALNRAY 121

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPL----ALAYVRKFFPALGNLLLI 176
           +V E R   + RL+S    ++ ++ ++I+    + IP+     + YV  +F    +L  +
Sbjct: 122 KVEESRPPVMQRLMS----VMLTLGMIIVFIAVILIPVFGEQLIHYVFSYFGLPNDLKNM 177

Query: 177 IWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFS 236
           I   R   T + LFI    ++ F P  K   ++++PG IF  + W+V ++  + Y+  F 
Sbjct: 178 INILRWVLTPVLLFIVFALLYFFAPNEKFGCLTVVPGAIFATVGWIVASLALSFYVSHFG 237

Query: 237 TYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
            Y+  Y  L  ++  +++ Y+ G+  I G ELNA
Sbjct: 238 NYNATYGSLGGMIIMMLWFYISGIILIFGGELNA 271


>gi|254796762|ref|YP_003081598.1| YihY family protein [Neorickettsia risticii str. Illinois]
 gi|254590007|gb|ACT69369.1| YihY family protein [Neorickettsia risticii str. Illinois]
          Length = 279

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 138/279 (49%), Gaps = 17/279 (6%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVF----GANLAGFLGA- 55
           M+  F ++   +Y+ + H     G   A ++S   LLS+FPF+ F      ++A  +GA 
Sbjct: 1   MKRIFAVLKISLYNMLYH----GGSEYAGYLSFLLLLSIFPFLFFFTAVAGHIANIIGAS 56

Query: 56  -HQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRI 114
            ++    ++ V     PE I + I   I ++L  P  GL T++ L A + +S+ VE L+ 
Sbjct: 57  SYEITRKLLSVFIENVPENIIEGIMPYIKEILEGPTHGLLTLTILGAIWTASSIVEGLKA 116

Query: 115 SLNRAYR--VVEMRSWYI-TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALG 171
           ++N+AY      + S YI  RLIS    LL SV ++    VF+  P     + K    L 
Sbjct: 117 AVNKAYNFGTEALVSEYILRRLISVIQFLLISVIIL----VFLLFPTIYPLLTKKVSFLH 172

Query: 172 NLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHY 231
            L    W      T   +F  +  +++F P  K     ++PG I     W++ ++ F+ Y
Sbjct: 173 TLKRPSWLPYSTITTCCVFFFVSALYIFFPKEKQGFCDVIPGSIMVVSLWILTSIAFSFY 232

Query: 232 IVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           + +F+  + +Y  +A I+  +++ Y+L + FI GAE+NA
Sbjct: 233 LHSFAQMNIIYGSIAGIIVVMLYFYLLNLCFIYGAEINA 271


>gi|138894066|ref|YP_001124519.1| ribonuclease BN [Geobacillus thermodenitrificans NG80-2]
 gi|134265579|gb|ABO65774.1| Ribonuclease BN [Geobacillus thermodenitrificans NG80-2]
          Length = 273

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 108/207 (52%), Gaps = 14/207 (6%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+     I   +  ++ V    L ++S + A + +SNG+ A+  + NRAY V E R +++
Sbjct: 61  PKEALHLIETNVHHLMDVQNGKLLSLSIIGAVWSASNGMRAIMRAFNRAYDVEENRPFWV 120

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRK----FFPALG--NLLLIIWNG-RIY 183
            R +S       ++TL +++ + VA+ L + + R      F ALG     L +WN  R  
Sbjct: 121 ARGLS------VALTLGMIAVIIVALVLPV-FGRTIGLFLFSALGLSEQFLTVWNAFRWT 173

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            + L LF     ++ F P  + + ++++ G +F    W+  ++ F +Y+  F+ Y+ MY 
Sbjct: 174 TSSLLLFAVFTALYYFAPNKQLRCVNVVRGALFATAGWIATSLAFAYYVNHFANYTAMYG 233

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNA 270
            L  ++  +++LY+ G+  +LG E+NA
Sbjct: 234 SLGGLIVLMIWLYLSGMILVLGGEMNA 260


>gi|196250266|ref|ZP_03148959.1| ribonuclease BN [Geobacillus sp. G11MC16]
 gi|196210155|gb|EDY04921.1| ribonuclease BN [Geobacillus sp. G11MC16]
          Length = 277

 Score = 82.8 bits (203), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 108/207 (52%), Gaps = 14/207 (6%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+     I   +  ++ V    L ++S + A + +SNG+ A+  + NRAY V E R +++
Sbjct: 65  PKEALHLIETNVHHLMDVQNGKLLSLSIIGAVWSASNGMRAIMRAFNRAYDVEENRPFWV 124

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRK----FFPALG--NLLLIIWNG-RIY 183
            R +S       ++TL +++ + VA+ L + + R      F ALG     L +WN  R  
Sbjct: 125 ARGLS------VALTLGMIAVIIVALVLPV-FGRTIGLFLFSALGLSEQFLTVWNAFRWT 177

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            + L LF     ++ F P  + + ++++ G +F    W+  ++ F +Y+  F+ Y+ MY 
Sbjct: 178 TSSLLLFAVFTALYYFAPNKQLRCVNVVRGALFATAGWIATSLAFAYYVNHFANYTAMYG 237

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNA 270
            L  ++  +++LY+ G+  +LG E+NA
Sbjct: 238 SLGGLIVLMIWLYLSGMILVLGGEMNA 264


>gi|223044001|ref|ZP_03614041.1| transporter [Staphylococcus capitis SK14]
 gi|222442544|gb|EEE48649.1| transporter [Staphylococcus capitis SK14]
          Length = 417

 Score = 82.8 bits (203), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 71/258 (27%), Positives = 127/258 (49%), Gaps = 16/258 (6%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           ++D   +A+ ++   +L++FP ++F   L   LG  QF+    D +     + +    T 
Sbjct: 84  KDDASGLAAQMTYHFVLAMFPMLIF---LLTLLG--QFITINTDQINQKVSQYVPDQSTA 138

Query: 81  EILQ-----VLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
           +++      +      G+ +I  + A + +SNG+ A+  S N AY V + R+ ++ +++S
Sbjct: 139 DVITKIFSGISDSANGGVLSIGLILAIWSASNGMSAIINSFNVAYDVEDSRNGFVLKILS 198

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN---GRIYATMLALFIG 192
             Y L+  +  V+     V I L     +  F  LG    + W     RI   ++ + I 
Sbjct: 199 VLYTLVLGIVFVV---AIVLITLGPVISKFLFGPLGLDKQVEWVFDLVRIVLPLIIIIIL 255

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
              ++   P  K+K+ S+LPG +FT I W+VG+ LF  YI  F  Y+  Y  LA I+   
Sbjct: 256 FTVLYSVAPNVKTKLRSVLPGALFTSIIWLVGSFLFGWYISNFGNYNKTYGSLAGIIILF 315

Query: 253 VFLYMLGVFFILGAELNA 270
           ++LY+     I+GAE+NA
Sbjct: 316 LWLYITSFIIIIGAEINA 333


>gi|190571310|ref|YP_001975668.1| ribonuclease, BN family [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018707|ref|ZP_03334515.1| ribonuclease, BN family [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357582|emb|CAQ55023.1| ribonuclease, BN family [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995658|gb|EEB56298.1| ribonuclease, BN family [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 271

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 133/279 (47%), Gaps = 29/279 (10%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIV----FGANLAGFLGAH 56
           +++++ IV+  +Y A+   +  DG   A ++S   LLS+FPF++      +  A FL  +
Sbjct: 2   LQKFYSIVY-CLYRALIDTIYNDGVEHAGYLSFLILLSIFPFLIVLIAMASTFANFLDQY 60

Query: 57  QFV-PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRIS 115
                 +ID +    P+ I   +   I ++++ P + L T++ + A + +S+ +E  R  
Sbjct: 61  NVGWAFIIDNM----PQDILSSLMPRIREIISGPPQSLLTLAIVGAVWTASSTIEGFRTI 116

Query: 116 LNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLL 175
           LN+AY+ V + S YI R +           L I+ F+ + +   L  V  FF  +  L+ 
Sbjct: 117 LNKAYK-VPVSSPYIWRRV-----------LSILQFLVITLVTTLTIV--FFTLVPMLID 162

Query: 176 IIWNGRIYATML----ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHY 231
             + G  Y   L     LF  + +++  LP  K  +  + PG     I W + A  F  Y
Sbjct: 163 FSYQGLSYTRYLLIEFVLFTIVSWLYFTLPNIKQNLSDVFPGSCVAVILWTISASAFKQY 222

Query: 232 I-VTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
           +  +F   + +Y  L  ++  L+F Y+L + FI GA+ N
Sbjct: 223 LKASFDQLNLIYGSLGGVVVSLLFFYVLSLIFIYGAKFN 261


>gi|168185392|ref|ZP_02620027.1| ribonuclease BN [Clostridium botulinum C str. Eklund]
 gi|169296339|gb|EDS78472.1| ribonuclease BN [Clostridium botulinum C str. Eklund]
          Length = 271

 Score = 82.4 bits (202), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 135/279 (48%), Gaps = 38/279 (13%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGF--LGAHQFVPTVIDVVF 67
            II+  +    +++ +A+AS ++ S LLS FPF++F   +A F  L +   + T+ +++ 
Sbjct: 8   KIIFKLLYKLKKDEIFALASQLAYSLLLSFFPFLIFLFTVASFSSLQSEGIIMTLKNII- 66

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P+     +   + +        L + S +   + +SNG +A+  +LN+AY   E RS
Sbjct: 67  ---PDSAYNLVYSILNETFEASNVNLLSFSFIITIWIASNGFKAVIRALNKAYGEEEERS 123

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNL-------------- 173
           +   +        +  ++ VI++F+ +           F   LGN+              
Sbjct: 124 FIKIQF-------MGIISTVILTFLII--------FSLFILVLGNIIGLKIITMLSLPIS 168

Query: 174 LLIIWNGRIYATMLALFIGLIF--VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHY 231
           L  IWN   Y  ML +F+ +IF  V+   P  K     +LPG IF  I W++ ++ F+ Y
Sbjct: 169 LYFIWNVLRYFVML-IFMIIIFAIVYKITPCRKLTFKDVLPGAIFATIGWIIVSLGFSFY 227

Query: 232 IVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           +  F+ YS +Y  + +++  LV+L++  +  ++G E+NA
Sbjct: 228 VDNFANYSRLYGSIGAVIVLLVWLFLSSIIILIGGEINA 266


>gi|42521087|ref|NP_967002.1| ribonuclease BN family protein [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|42410828|gb|AAS14936.1| ribonuclease, BN family [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 271

 Score = 82.4 bits (202), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 129/279 (46%), Gaps = 31/279 (11%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIV----FGANLAGFLGAHQ 57
           ++++ IV+  +Y A+   +  DG   A ++S   LLS+FPF++      +  A FL  + 
Sbjct: 3   QKFYSIVY-CLYRALIDTIYNDGVEHAGYLSFLILLSIFPFLIVLMAMASTFANFLDQYN 61

Query: 58  FVPTVIDVVF--GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRIS 115
                I  VF     P+ I   +   I ++++ P + L T++ + A + +S+ +E LR  
Sbjct: 62  -----IGWVFIIDNMPQDILSSLMPRIREIISGPPQSLLTLAIVGAVWTASSTIEGLRTI 116

Query: 116 LNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLL 175
           LN+AY+      + + R++S            I+ F+ + + + L  V  F   +  L+ 
Sbjct: 117 LNKAYKAPVSPPYILRRVLS------------ILQFLVITLIITLTIV--FSTLVPMLID 162

Query: 176 IIWNGRIYATML----ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHY 231
             + G  Y   L     LF  + +++  LP  K  +  + PG     I W + A  F  Y
Sbjct: 163 FSYQGLSYTRYLLIEFVLFTVVSWLYFMLPNIKQNLSDVFPGSCVAVILWTISASAFKQY 222

Query: 232 I-VTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
           +  +F     +Y  L  ++  L+F YML + FI GA+ N
Sbjct: 223 LKASFGQLDLIYGSLGGVVVSLLFFYMLSLIFIYGAKFN 261


>gi|242371808|ref|ZP_04817382.1| ribonuclease BN [Staphylococcus epidermidis M23864:W1]
 gi|242350509|gb|EES42110.1| ribonuclease BN [Staphylococcus epidermidis M23864:W1]
          Length = 418

 Score = 82.0 bits (201), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 77/270 (28%), Positives = 132/270 (48%), Gaps = 25/270 (9%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA----WPEVIAK 76
           ++D   +A+ ++   +L++FP ++F   L   LG  QF+    D +        P+    
Sbjct: 84  KDDASGLAAQMTYHFVLAMFPMLIF---LLTLLG--QFITINTDQINHKVSQYIPDQSTA 138

Query: 77  PITDEILQVLAVPAKG-LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            +  +I   ++  A G + +I  + A + +SNG+ A+  S N AY V + R+  + +++S
Sbjct: 139 DVVTKIFSSISDSANGGVLSIGLILAIWSASNGMSAIINSFNVAYDVEDARNGIVLKILS 198

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIF 195
             Y L+  +  V+     V I L     +  F  LG    + W   I+  +  +   +I 
Sbjct: 199 VIYTLVLGIVFVV---AIVLITLGPVISKFLFGPLGLDKQVEW---IFDVVRIVLPLIII 252

Query: 196 VHLFL------PAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           + LF       P  K+K+ S+LPG +FT I W+VG+ LF  YI  F  Y+  Y  LA I+
Sbjct: 253 IILFTVLYSVAPNVKTKLRSVLPGALFTSIIWLVGSFLFGWYISNFGNYNKTYGSLAGII 312

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
              ++LY+     I+GAE+NA   I + RK
Sbjct: 313 ILFLWLYITSFIIIIGAEINA---IIHQRK 339


>gi|149183505|ref|ZP_01861932.1| hypothetical protein BSG1_15038 [Bacillus sp. SG-1]
 gi|148848777|gb|EDL63000.1| hypothetical protein BSG1_15038 [Bacillus sp. SG-1]
          Length = 280

 Score = 81.3 bits (199), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 98/194 (50%), Gaps = 14/194 (7%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P    + I   I +V++    GL + S +A  + +SNG+ A+  SLN AY V E RS+ +
Sbjct: 71  PGETMQMIQSTINEVMSNRNTGLLSFSIIATIWSASNGMNAIVKSLNDAYEVEESRSYIV 130

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRK----FFPALG--NLLLIIWNGRIYA 184
           TRL+S        V  + M FVF+   L   + ++     F   G  +  L IW    +A
Sbjct: 131 TRLMSI-------VLTIAMIFVFIIALLLPVFGKQIGLFLFSQFGFSDQFLTIWGAIRWA 183

Query: 185 -TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            + + LFI  + ++   P+ K K +S +PG +F  + WV  ++ F++Y+  F  YS  Y 
Sbjct: 184 ISPIILFIVFVGLYFIAPSKKIKCLSAVPGAVFAALGWVGASLAFSYYVSNFGNYSATYG 243

Query: 244 GLASIMTCLVFLYM 257
            +  I+  +++ Y+
Sbjct: 244 SIGGIIVLMIWFYL 257


>gi|314934048|ref|ZP_07841411.1| YihY family protein [Staphylococcus caprae C87]
 gi|313653159|gb|EFS16918.1| YihY family protein [Staphylococcus caprae C87]
          Length = 417

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/258 (27%), Positives = 126/258 (48%), Gaps = 16/258 (6%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           ++D   +A+ +    +L++FP ++F   L   LG  QF+    D +     + +    T 
Sbjct: 84  KDDASGLAAQMMYHFVLAMFPMLIF---LLTLLG--QFITINTDQINQKVSQYVPDQSTA 138

Query: 81  EILQ-----VLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
           +++      +      G+ +I  + A + +SNG+ A+  S N AY V + R+ ++ +++S
Sbjct: 139 DVITKIFSGISDSANGGVLSIGLILAIWSASNGMSAIINSFNVAYDVEDSRNGFVLKILS 198

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN---GRIYATMLALFIG 192
             Y L+  +  V+     V I L     +  F  LG    + W     RI   ++ + I 
Sbjct: 199 VLYTLVLGIVFVV---AIVLITLGPVISKFLFGPLGLDKQVEWVFDLVRIVLPLIIIIIL 255

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
              ++   P  K+K+ S+LPG +FT I W+VG+ LF  YI  F  Y+  Y  LA I+   
Sbjct: 256 FTVLYSVAPNVKTKLRSVLPGALFTSIIWLVGSFLFGWYISNFGNYNKTYGSLAGIIILF 315

Query: 253 VFLYMLGVFFILGAELNA 270
           ++LY+     I+GAE+NA
Sbjct: 316 LWLYITSFIIIIGAEINA 333


>gi|58584733|ref|YP_198306.1| tRNA processing exoribonuclease BN [Wolbachia endosymbiont strain
           TRS of Brugia malayi]
 gi|58419049|gb|AAW71064.1| tRNA processing exoribonuclease BN [Wolbachia endosymbiont strain
           TRS of Brugia malayi]
          Length = 274

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 129/278 (46%), Gaps = 27/278 (9%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIV----FGANLAGFLGAH 56
           +++++ I++  +Y A+   +  DG   A ++S   LLS+FPF++      +  A FL  +
Sbjct: 5   LKKFYGIIY-CLYHALIDTIYNDGMEHAGYLSFLILLSIFPFLIVLMALASTFANFLDQY 63

Query: 57  QFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISL 116
               T I       P+ I   +   I ++++ P + L T++ + A + +S+ +E LR  L
Sbjct: 64  NIGWTFI---IDNMPQDILASLMPRIREIISGPPQSLLTLAIVGAIWTASSTIEGLRTIL 120

Query: 117 NRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLI 176
           N+AY+V     + + R++S    L+ +  + +       +P+ + +              
Sbjct: 121 NKAYKVPVSPPYVLRRILSILQFLIITFIITLTIVFSTLVPMLIDFS------------- 167

Query: 177 IWNGRIYATML----ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYI 232
            ++G  Y   L     LFI + +++  LP  +  +  + PG     + W V A  F  Y+
Sbjct: 168 -YHGLSYTRYLLIEFVLFIVVSWLYFMLPNIRQNVSDVFPGSYIAVMLWTVSASAFKQYL 226

Query: 233 -VTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
             +F     +Y  L  ++  L+F YM+ + FI GA+ N
Sbjct: 227 RASFDQLDLIYGSLGGVVVSLLFFYMVSLIFIYGAKFN 264


>gi|297624536|ref|YP_003705970.1| ribonuclease BN [Truepera radiovictrix DSM 17093]
 gi|297165716|gb|ADI15427.1| ribonuclease BN [Truepera radiovictrix DSM 17093]
          Length = 289

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/265 (25%), Positives = 129/265 (48%), Gaps = 9/265 (3%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           F ++  A   F E+D    AS ++   L S+FPFI+F   L GFL     +P   + + G
Sbjct: 12  FAVLRRAFGKFGEDDMGTYASALAYQVLFSLFPFIIFLVALLGFLN----IPEFFEYLRG 67

Query: 69  AWPEVIAKPITDEILQVL---AVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
              EV+   + D++ Q++     P  GL ++  L A + +S GV A   +LN AY V E 
Sbjct: 68  QANEVLPAQVADQVNQIIDEIEQPRGGLLSLGILVALWTASAGVRATMNALNVAYGVSEG 127

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG-RIYA 184
           R  +    +S  Y +  +  L+  + + +  P  ++++ +      N+ + +WN  R+  
Sbjct: 128 RPVWKRMPLSLLYTVGLAAMLIAAAALLIFGPQVMSWLGELV-GFANIFVTLWNLLRLPV 186

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
            ++ L + +  V+   P  + + + I PG +   + W++ +  F+ Y+  F+ +S  Y  
Sbjct: 187 AVVLLMLVVALVYYAFPDTEQRFVFITPGSVLAVLVWLLASWGFSLYVQNFADFSATYGS 246

Query: 245 LASIMTCLVFLYMLGVFFILGAELN 269
           L +++  L + Y+     + GAE+N
Sbjct: 247 LGAVVVILFYFYISASVLLFGAEIN 271


>gi|15615917|ref|NP_244221.1| hypothetical protein BH3355 [Bacillus halodurans C-125]
 gi|10175978|dbj|BAB07074.1| BH3355 [Bacillus halodurans C-125]
          Length = 272

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 118/242 (48%), Gaps = 14/242 (5%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           +LS+FP I+F   L  +    Q    +  ++    PE +A   T  IL V++ P  GL +
Sbjct: 31  MLSIFPLIIFILALIPYFSIDQ--QYLYQIIVDYLPEDLADVFTSVILDVVSRPQGGLVS 88

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS----FGYVLLASVTLVIMSF 151
             ALAA + +SNG+ AL  ++NR Y V E RS Y  R +S     G +L+   TL++  F
Sbjct: 89  FGALAAIWTASNGMNALIRAVNRCYAVEETRSLYNLRFLSIMLTIGMMLVFVTTLLLPVF 148

Query: 152 VFVAIPLA--LAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMS 209
             + I L   L  V +   ++ N L      R    +  + I LI ++L  P    K+  
Sbjct: 149 GHLIIQLLDWLFIVPEGTASVLNAL------RWIVGICLMTIILIVIYLLAPNTSLKLKD 202

Query: 210 ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
           ++ G +   I W + +  F+ Y+  F  +S  Y  L  ++  +++ ++  +  I+G E+N
Sbjct: 203 VVTGAVVATIGWQLISYGFSAYVSNFGNFSATYGSLGGVIVLMLWFFLSSLMLIIGGEVN 262

Query: 270 AS 271
           A+
Sbjct: 263 AA 264


>gi|258508049|ref|YP_003170800.1| ribonuclease BN-like family protein [Lactobacillus rhamnosus GG]
 gi|257147976|emb|CAR86949.1| Ribonuclease BN-like family enzyme [Lactobacillus rhamnosus GG]
 gi|259649370|dbj|BAI41532.1| ribonuclease BN [Lactobacillus rhamnosus GG]
          Length = 334

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 81/269 (30%), Positives = 135/269 (50%), Gaps = 16/269 (5%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVI 74
           AI    + +    A+ ++   LLS+FP I+F AN   +LG      ++   +  A P  +
Sbjct: 46  AINRISDSNIGQSAAALAYYTLLSLFPLILFVANALPYLGLK--YSSLATYLTQAVPANV 103

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
            + +   I  +L   + GL  I A+A  + +S GV  L++  N+ Y V   +++ I RL+
Sbjct: 104 MEWLDPIIANLLDSSSGGLLGIGAIATLWAASLGVTGLKMGFNQVYGVEATQNFIIQRLL 163

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL------LIIWNG-RIYATML 187
           S    +L + TL+I   V  AI +A A+ R+F   L  LL      L  +N  R   T+ 
Sbjct: 164 S----MLMTFTLII---VMGAILIAFAFGRQFLEWLIPLLRLDTSWLRTFNTLRWPITVT 216

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           ALFI ++F+  FLP  K K+ ++LPG  FT I W++ A  F+ Y+  F T    Y  + +
Sbjct: 217 ALFIIIMFLDYFLPNVKIKMWTVLPGTAFTVIGWLLIAQAFSLYMHYFGTRYLSYGTIGT 276

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYY 276
            +  +++L    +  + GA +NA    Y+
Sbjct: 277 FIAIMLWLNFSALVLLWGAVINALTAEYF 305


>gi|295702560|ref|YP_003595635.1| YihY family protein [Bacillus megaterium DSM 319]
 gi|294800219|gb|ADF37285.1| YihY family protein [Bacillus megaterium DSM 319]
          Length = 279

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 130/259 (50%), Gaps = 15/259 (5%)

Query: 26  AMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQV 85
           ++++ ++   LLS+FPF++F   L GFL        ++D+V    P+     I   +  +
Sbjct: 27  SLSAELAYYLLLSLFPFLIFLITLIGFLPLES--TDLLDLVENVAPQQTLHMIESNVSHI 84

Query: 86  LAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR----LISFGYVLL 141
           +    + L +   +A  + +SNG+ A+  + NRAY V E R + + R    L++F  + +
Sbjct: 85  IGSHNEKLLSFGIIATMWSASNGINAIVRAFNRAYHVQENRPFLVARGMAVLLTFAMIFV 144

Query: 142 ASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLIFVHLFL 200
             V L++  F  + I L L+    F        L +W+  R   + L LF     ++ F 
Sbjct: 145 IIVALLLPVFGHM-IGLYLSSTFGF----SETFLALWSASRWIISGLILFTVFTGLYYFA 199

Query: 201 PAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGV 260
           P  K  I +++ G  F  + W V ++LF +Y+  F+ Y+  Y  L  I+  L++LY+ G+
Sbjct: 200 PNKKLLIRNVVKGAAFATVGWTVVSMLFAYYVNHFNNYTATYGSLGGIIILLIWLYLSGM 259

Query: 261 FFILGAELNASMIIYYWRK 279
             ++G E+NA   I+Y R+
Sbjct: 260 IIVIGGEINA---IFYDRR 275


>gi|229551895|ref|ZP_04440620.1| ribonuclease BN [Lactobacillus rhamnosus LMS2-1]
 gi|258539317|ref|YP_003173816.1| ribonuclease BN-like family enzyme [Lactobacillus rhamnosus Lc 705]
 gi|229314739|gb|EEN80712.1| ribonuclease BN [Lactobacillus rhamnosus LMS2-1]
 gi|257150993|emb|CAR89965.1| Ribonuclease BN-like family enzyme [Lactobacillus rhamnosus Lc 705]
          Length = 334

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 81/269 (30%), Positives = 135/269 (50%), Gaps = 16/269 (5%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVI 74
           AI    + +    A+ ++   LLS+FP I+F AN   +LG      ++   +  A P  +
Sbjct: 46  AINRISDSNIGQSAAALAYYTLLSLFPLILFVANALPYLGLK--YSSLATYLTQAVPANV 103

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
            + +   I  +L   + GL  I A+A  + +S GV  L++  N+ Y V   +++ I RL+
Sbjct: 104 MEWLDPIIANLLDSSSGGLLGIGAIATLWAASLGVTGLKMGFNQVYGVEATQNFIIQRLL 163

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL------LIIWNG-RIYATML 187
           S    +L + TL+I   V  AI +A A+ R+F   L  LL      L  +N  R   T+ 
Sbjct: 164 S----MLMTFTLII---VMGAILIAFAFGRQFLEWLIPLLRLDTSWLRTFNTLRWPITVT 216

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           ALFI ++F+  FLP  K K+ ++LPG  FT I W++ A  F+ Y+  F T    Y  + +
Sbjct: 217 ALFIIIMFLDYFLPNVKIKMWTVLPGTAFTVIGWLLIAQAFSLYMHYFGTRYLSYGTIGT 276

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYY 276
            +  +++L    +  + GA +NA    Y+
Sbjct: 277 FIAIMLWLNFSALVLLWGAVINALTAEYF 305


>gi|239626306|ref|ZP_04669337.1| ribonuclease BN [Clostridiales bacterium 1_7_47_FAA]
 gi|239516452|gb|EEQ56318.1| ribonuclease BN [Clostridiales bacterium 1_7_47FAA]
          Length = 278

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/271 (24%), Positives = 136/271 (50%), Gaps = 20/271 (7%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV-----IDVVFGAWP 71
           + + E++    A+ +S   +LSV PFI+        L A Q +P++     ++++ G  P
Sbjct: 15  DKYAEDEMTVYAAQVSFFIILSVVPFIML------LLTAVQMIPSISNAQFMELIVGLVP 68

Query: 72  EVIAKPITDEILQVLAVPAKG-LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
            V  K +   ++  L++ +   + +++A+ A + +  G+ ++   LNR +   E R + +
Sbjct: 69  -VDYKSLAFRVVNDLSLKSPATMISVTAITALWSAGRGMFSVARGLNRVHGHGEKRWYVV 127

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            RLI  GY ++  +  ++   + V   +  A++   FP + +++  I N R    ++ L 
Sbjct: 128 GRLICSGYTIVFILVCILSLGLLVFGNMIQAFMVNRFPIVADVVTHIINFRALWALMILI 187

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYI--VTFSTYSTMYAGLASI 248
           +  + ++ F+P  K K+   +PG +F+ + W+  +  F+ Y   +    YS MY  L +I
Sbjct: 188 MFFLGIYTFVPDKKLKLQDQIPGAVFSTVGWMAFSFAFSLYFNHIGGRNYSYMYGSLTAI 247

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           +  L++LYM       GAE+N     YYW++
Sbjct: 248 VLLLLWLYMCMCILFFGAEIN-----YYWKE 273


>gi|294497189|ref|YP_003560889.1| YihY family protein [Bacillus megaterium QM B1551]
 gi|294347126|gb|ADE67455.1| YihY family protein [Bacillus megaterium QM B1551]
          Length = 279

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 130/259 (50%), Gaps = 15/259 (5%)

Query: 26  AMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQV 85
           ++++ ++   LLS+FPF++F   L GFL        ++D+V    P+     I   +  +
Sbjct: 27  SLSAELAYYLLLSLFPFLIFLITLIGFLPLES--TDLLDLVENVAPQQTLHMIESNVSHI 84

Query: 86  LAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR----LISFGYVLL 141
           +    + L +   +A  + +SNG+ A+  + NRAY V E R + + R    L++F  + +
Sbjct: 85  IGSHNEKLLSFGIIATMWSASNGINAIVRAFNRAYHVQENRPFLVARGMAVLLTFAMIFV 144

Query: 142 ASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLIFVHLFL 200
             V L++  F  + I L L+    F        L +W+  R   + L LF     ++ F 
Sbjct: 145 IIVALLLPVFGHM-IGLYLSSTFGF----SETFLALWSASRWIISGLILFTVFTGLYYFA 199

Query: 201 PAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGV 260
           P  K  I +++ G  F  + W V ++LF +Y+  F+ Y+  Y  L  I+  L++LY+ G+
Sbjct: 200 PNKKLLIRNVVKGAAFATVGWTVVSMLFAYYVNHFNNYTATYGSLGGIIILLIWLYLSGM 259

Query: 261 FFILGAELNASMIIYYWRK 279
             ++G E+NA   I+Y R+
Sbjct: 260 IIVIGGEINA---IFYDRR 275


>gi|327480116|gb|AEA83426.1| ribonuclease BN, putative [Pseudomonas stutzeri DSM 4166]
          Length = 291

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 67/263 (25%), Positives = 128/263 (48%), Gaps = 3/263 (1%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           F ++   ++ F  +D    AS ++   L ++FPF+VF   L GFL    F   +      
Sbjct: 12  FTLLKRTLKEFSSDDMSTYASALAYRGLFAMFPFLVFLIALLGFLDLQNFFDWLRMQAEL 71

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
           A P V  + I   I Q+    A GL +   L A + +S G  +L  +LNRAY V E R  
Sbjct: 72  ALPPVAMEQINPVIDQLQEQQA-GLLSFGILVALWTASIGFRSLMNALNRAYDVEEGRPT 130

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +   +++  Y    +V L+  + + V  P A+ ++      +  L++++W    +  ++ 
Sbjct: 131 WKLIILALAYTAGVAVLLLFTAGLMVIGPQAMEWLAGQV-GMRELVVVLWTWLRWPVIVL 189

Query: 189 LFIGLIFVHLFL-PAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           + + ++ +  ++ P  + +   I PG +   + W++ +V F  Y+  F+ Y+  Y  + +
Sbjct: 190 MLMLVVALLYYVAPDVEQEFRFITPGSVLAVLVWILASVAFGVYVQNFADYNATYGSIGA 249

Query: 248 IMTCLVFLYMLGVFFILGAELNA 270
           I+  L++LY+     + GAELNA
Sbjct: 250 IIVLLLYLYISAAVLLFGAELNA 272


>gi|323489804|ref|ZP_08095029.1| transport protein [Planococcus donghaensis MPA1U2]
 gi|323396542|gb|EGA89363.1| transport protein [Planococcus donghaensis MPA1U2]
          Length = 299

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 127/265 (47%), Gaps = 20/265 (7%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-----FVPTVIDVVFGAWP 71
           +   + D   + + ++   LLS+FP ++F   L  +L   +     F+  V+       P
Sbjct: 34  QRIKDVDVPGLGAQLAFFFLLSIFPLLIFLVTLLPYLALSRGEIFSFLEEVV-------P 86

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
             +   I   +++VL     GL +   LA  + +S G+ AL  SLN +Y+V E R   + 
Sbjct: 87  GTVYVLIESTVIEVLTTQNTGLLSFGILATIWSASLGMNALIKSLNLSYKVAENRPILLA 146

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKF---FPALGNLLLIIWNG-RIYATML 187
           R +S    ++ +V L+ +  V +A+P+    + +    F  L    L++WN  R     +
Sbjct: 147 RAMS----IILTVLLIFILIVALALPIFGEQLGRLIFSFLGLEANFLVVWNSVRFTIPAI 202

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            +F+    ++   P  +  I+S+L G  F    W++ + LF+ Y+  F  +S  Y  + +
Sbjct: 203 VIFVACAIIYWLAPNVRLNILSVLVGAAFAATGWLLTSYLFSIYVKNFGNFSATYGSIGA 262

Query: 248 IMTCLVFLYMLGVFFILGAELNASM 272
           I+  +++LY+  +  ++G ++NA M
Sbjct: 263 IIVLMLWLYVSAMILVIGGQINAVM 287


>gi|70731937|ref|YP_261679.1| ribonuclease BN [Pseudomonas fluorescens Pf-5]
 gi|68346236|gb|AAY93842.1| ribonuclease BN, putative [Pseudomonas fluorescens Pf-5]
          Length = 316

 Score = 79.7 bits (195), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 67/261 (25%), Positives = 129/261 (49%), Gaps = 13/261 (4%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQF-----VPTVIDVVFGAW 70
           +  F+ ++    AS ++   L S+FPFI+F   L GFL    F     + + + +   A 
Sbjct: 19  VNEFIADEMSTYASALAYQMLFSLFPFILFLIALIGFLHLPDFFTWLRLQSELVLPHEAL 78

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
            +V   P+ D++ Q       GL +I  + A + +S GV  +  ++N AY VVE R  + 
Sbjct: 79  EQV--NPVIDQLQQ----SKGGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIWK 132

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLAL 189
              +S  Y +  +  L+  + + V  P  +A++      L + ++ +W   R    +L +
Sbjct: 133 RFPLSVFYTVGIAGMLLAAAALMVLGPQVMAWLAGQV-GLEDFIVTLWTILRWPVIVLLM 191

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + +  ++  +P  + K   I PG +   + W+V ++ F +Y+ TF+ Y+ MY  + +I+
Sbjct: 192 MVAVALMYYVMPDVQQKFRFITPGSVLAVVVWIVASLGFAYYVKTFANYNAMYGSIGAII 251

Query: 250 TCLVFLYMLGVFFILGAELNA 270
             L++ Y+     +LGAE+NA
Sbjct: 252 VLLLYFYISAAVLLLGAEMNA 272


>gi|167765672|ref|ZP_02437725.1| hypothetical protein CLOSS21_00160 [Clostridium sp. SS2/1]
 gi|167712647|gb|EDS23226.1| hypothetical protein CLOSS21_00160 [Clostridium sp. SS2/1]
 gi|291559907|emb|CBL38707.1| Predicted membrane protein [butyrate-producing bacterium SSC/2]
          Length = 289

 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 124/273 (45%), Gaps = 5/273 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT-VIDVVFG 68
            +I   I+   ++   A ++  +   +LS FPF++   +L  +       P  +I++V  
Sbjct: 6   SMIGSVIDKAQKDHVTAFSAQAAFFTILSFFPFMIVLLSLTRYF---PITPNDMIELVRT 62

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
             P   +  +   I  +         +I+ L   + +S G+ +L   LN  + + E R++
Sbjct: 63  YLPPKYSGMVVPIIRSLNGKLTTTYMSITILTLLWSASKGILSLMTGLNTIHEISEKRNY 122

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           ++ R IS  Y+ L ++ ++    + +     L  + +F P L N  +     R +     
Sbjct: 123 FVLRFISSIYIGLFAIAVLFGLILLLFGNSLLIQLYRFEPVLENKHVFFATIRFFLAFFT 182

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
             +  I ++ FLP+   K   ILPG  F+  +W V +  F+ Y   FS +STMY GL SI
Sbjct: 183 FMVVFIIMYRFLPSENFKTKQILPGAFFSSAAWFVLSFFFSMYFDNFSFFSTMYGGLTSI 242

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
           +  L +LY   +   +GAE+N    I    KKP
Sbjct: 243 LLTLFWLYFCMMMLFIGAEIN-HYFISQSSKKP 274


>gi|99034616|ref|ZP_01314573.1| hypothetical protein Wendoof_01000616 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 256

 Score = 79.3 bits (194), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 118/259 (45%), Gaps = 30/259 (11%)

Query: 22  EDGWAMASHISLSALLSVFPFIVF----GANLAGFLGAHQFVPTVIDVVF--GAWPEVIA 75
            DG   A ++S   LLS+FPF++      +  A FL  +      I  VF     P+ I 
Sbjct: 7   NDGVEHAGYLSFLILLSIFPFLIVLMAVASTFANFLDQYN-----IGWVFIIDNMPQDIL 61

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
             +   I ++++ P + L T++ + A + +S+ +E LR  LN+AY+V     + + R++S
Sbjct: 62  SSLMPRIREIISGPPQSLLTLAIVGAVWTASSTIEGLRTILNKAYKVPVSPPYILRRVLS 121

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML----ALFI 191
                       I+ F+ + + + L  V  F   +  L+   + G  Y   L     LF 
Sbjct: 122 ------------ILQFLVITLIITLTIV--FSTLVPMLIDFSYQGLSYTRYLLIEFVLFT 167

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYI-VTFSTYSTMYAGLASIMT 250
            + +++  LP  K  +  + PG     I W + A  F  Y+  +F     +Y  L  ++ 
Sbjct: 168 VVSWLYFMLPNIKQNLSDVFPGSCVAVILWTISASAFKQYLKASFDQLDLIYGSLGGVVV 227

Query: 251 CLVFLYMLGVFFILGAELN 269
            L+F YML + FI GA+ N
Sbjct: 228 SLLFFYMLSLIFIYGAKFN 246


>gi|229083712|ref|ZP_04216033.1| YihY [Bacillus cereus Rock3-44]
 gi|228699570|gb|EEL52234.1| YihY [Bacillus cereus Rock3-44]
          Length = 207

 Score = 79.3 bits (194), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 99/204 (48%), Gaps = 8/204 (3%)

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
            +  V+     GL +   L+  +F+SNGV A+  + NRAY V E RS+  TR +S   VL
Sbjct: 2   NVDSVVNKQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVKETRSYITTRALSI--VL 59

Query: 141 LASVTLVIMSFVFVAIPLALAYVRKFFPALG--NLLLIIWN-GRIYATMLALFIGLIFVH 197
             S+  +I+ F  +            F ALG       +W+  R+ A+ L LF    F++
Sbjct: 60  TLSIIFMIV-FALIVPVFGQVIGAAVFKALGLSESFSFVWSITRLVASFLVLFALFSFLY 118

Query: 198 LFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
            F P  K +   ++ G +F  I W+V +  F  Y+  F+ Y+  Y GL  I+  +++ Y+
Sbjct: 119 TFAPDRKLRRKEVVSGALFATIGWIVVSYSFAFYVDKFANYANTYGGLGGIIILMLWFYL 178

Query: 258 LGVFFILGAELNASMIIYYWRKKP 281
                +LG E+N   ++Y +R   
Sbjct: 179 TAWVILLGGEING--LLYSYRASD 200


>gi|317497559|ref|ZP_07955877.1| ribonuclease BN-like family protein [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|316895118|gb|EFV17282.1| ribonuclease BN-like family protein [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 289

 Score = 79.3 bits (194), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 124/273 (45%), Gaps = 5/273 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT-VIDVVFG 68
            +I   I+   ++   A ++  +   +LS FPF++   +L  +       P  +I++V  
Sbjct: 6   SMIGSVIDKAQKDHVTAFSAQAAFFTILSFFPFMIVLLSLTRYF---PITPNDMIELVRT 62

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
             P   +  +   I  +         +I+ L   + +S G+ +L   LN  + + E R++
Sbjct: 63  YLPPKYSGMVVPIIRSLNGKLTTTYMSITILTLLWSASKGILSLMTGLNTIHEIPEKRNY 122

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           ++ R IS  Y+ L ++ ++    + +     L  + +F P L N  +     R +     
Sbjct: 123 FVLRFISSIYIGLFAIAVLFGLILLLFGNSLLIQLYRFEPVLENKHVFFATIRFFLAFFT 182

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
             +  I ++ FLP+   K   ILPG  F+  +W V +  F+ Y   FS +STMY GL SI
Sbjct: 183 FMVVFIIMYRFLPSENFKTKQILPGAFFSSAAWFVLSFFFSMYFDNFSFFSTMYGGLTSI 242

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
           +  L +LY   +   +GAE+N    I    KKP
Sbjct: 243 LLTLFWLYFCMMMLFIGAEIN-HYFISQSSKKP 274


>gi|312886962|ref|ZP_07746566.1| ribonuclease BN [Mucilaginibacter paludis DSM 18603]
 gi|311300274|gb|EFQ77339.1| ribonuclease BN [Mucilaginibacter paludis DSM 18603]
          Length = 329

 Score = 79.0 bits (193), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 125/264 (47%), Gaps = 15/264 (5%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAK 76
           +   +E     AS ++ + LL++FP  +F   L  ++    F  T+++++    P     
Sbjct: 43  QELKQESLANKASSLAYTFLLAIFPGTIFLFTLIPYIPIKSFQDTLLNIIELILPSNAYA 102

Query: 77  PITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISF 136
                I  ++     GL +   L+A +F++NGV  L  + N++  +VE R+W   R I+ 
Sbjct: 103 AFESTIEDIVKNQHGGLLSFGFLSAMFFATNGVHKLMRAFNKSSLIVETRTWLKRRWIAL 162

Query: 137 GYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA-------- 188
              +L S +L    FV + I     Y+  F     N     W   IY  M++        
Sbjct: 163 VLTMLISFSL----FVAILIMTISQYIISFIQFQLNTGGKFW---IYLVMISRWLIVIVL 215

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
            F+ +  ++ + PA K +   + PG I      V+ ++ FT YI  FS+Y+ +Y  L ++
Sbjct: 216 FFVTVSILYRYGPAHKRRWKFLSPGSILATCLAVLTSLGFTFYINHFSSYNKLYGSLGTL 275

Query: 249 MTCLVFLYMLGVFFILGAELNASM 272
           +  +++LY+  +  ++G ELNAS+
Sbjct: 276 IVIMLWLYLNSLIILIGFELNASI 299


>gi|153005865|ref|YP_001380190.1| putative ribonuclease BN [Anaeromyxobacter sp. Fw109-5]
 gi|152029438|gb|ABS27206.1| putative ribonuclease BN [Anaeromyxobacter sp. Fw109-5]
          Length = 359

 Score = 79.0 bits (193), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 118/263 (44%), Gaps = 24/263 (9%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAK 76
           E   ++    +A+ ++   +LS+FPF++F   LA  +        +++ +    P  + +
Sbjct: 12  EELSKDQVTDIAATVTYYGVLSLFPFVLFLVALASVVIEPSDAERMVEELGQVAPGAVTQ 71

Query: 77  PITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISF 136
            I D I Q+ A     L    A+AA + +S GV A+  +LN AY V E R ++  R I+ 
Sbjct: 72  IIGDRIRQLGAEQNVSLLGFGAVAALWAASGGVTAVMRALNTAYDVKEGRPFWKVRGIAI 131

Query: 137 GYVLLASV---------TLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
              LLA                    +  PL  A      P  G +++++W         
Sbjct: 132 LMTLLAGALGLIAALVAIAAAPLAEAIGGPLGTAITWLRLPVAGLVMMLLW--------- 182

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
                   V+  LP  + +   I PG +F  + WV+ +  F+ Y+ +F +Y   Y  LA 
Sbjct: 183 ------ALVYYVLPDVEQRFRFITPGSVFGVLVWVLASWGFSRYVTSFGSYDKTYGSLAG 236

Query: 248 IMTCLVFLYMLGVFFILGAELNA 270
           ++  L+++++  +  ++GAE+NA
Sbjct: 237 VIVLLLWMWITSLVLLVGAEVNA 259


>gi|255523128|ref|ZP_05390100.1| ribonuclease BN [Clostridium carboxidivorans P7]
 gi|255513243|gb|EET89511.1| ribonuclease BN [Clostridium carboxidivorans P7]
          Length = 275

 Score = 78.6 bits (192), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 65/263 (24%), Positives = 127/263 (48%), Gaps = 10/263 (3%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           D I  F  +D  A+ S ++ + +LS FPFI+F   L G    +     ++  +    P  
Sbjct: 7   DLIYRFNNDDIPALGSQLAYNLVLSFFPFIIFLMTLIGHTSLNN--NEILLALSKIMPAS 64

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
               I+  + +V+      L + S +   + +S+G   +   LN+AY V E RS+   R+
Sbjct: 65  AFNLISTTVSEVITTKHSQLMSFSLILTIWSASSGFTGIIKGLNKAYGVPESRSFIKVRI 124

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY----ATMLAL 189
           IS    +  +  ++IM F+ +   +   Y   +  +  + L+I+W    Y    +T + +
Sbjct: 125 ISILCTIGMAFIILIMMFLLILGHIIWKYT-AYKLSFAHRLIILWTLTRYFIFISTAVFI 183

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           F  L   + + P  +   + +LPG +F  +  ++ +  F +Y+  F+ YS +Y  + +I+
Sbjct: 184 FTSL---YRYAPCKRLTWLEVLPGSLFAILHLILVSTGFAYYVNNFANYSVIYGSIGAII 240

Query: 250 TCLVFLYMLGVFFILGAELNASM 272
             L +L+++ +  ILG E NAS+
Sbjct: 241 VLLTWLFLISIIVILGGEFNASL 263


>gi|269958836|ref|YP_003328624.1| putative ribonuclease [Anaplasma centrale str. Israel]
 gi|269848666|gb|ACZ49310.1| putative ribonuclease [Anaplasma centrale str. Israel]
          Length = 286

 Score = 78.6 bits (192), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 68/261 (26%), Positives = 132/261 (50%), Gaps = 14/261 (5%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVF----GANLAGFLGAHQ-FVPTVIDVVFGA 69
           AI  F   DG   + ++S   LLS FPF+VF     +     L  H+ F+  ++  +   
Sbjct: 27  AIADFRRHDGLVYSGYLSFIFLLSTFPFLVFFTAMTSTALNVLDKHEDFLQGLVTSLLSE 86

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P      +   I ++L+ P + L T++ +   + +S+ +E +R  LN+A+RV     + 
Sbjct: 87  LPHETIAALLPRINEILSGPPQSLLTVAVVGIVWTASSAIEGMRTVLNKAFRVSAPPPYI 146

Query: 130 ITRLISFGYVLLASVTLVIMSFVF-VAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           + R++S     LA V +++ S +F V +P+ L  +   +  LG +  I+       + + 
Sbjct: 147 LGRMLSI-LQFLAIVLVMMCSVLFTVLVPIILDILDPKWGYLGYIKYIV-------SEVI 198

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           L + + F++  +P  + ++  +LPG +   + W + +  F+ Y+  F    TMY  L+ I
Sbjct: 199 LCLSVAFMYYMVPNTRQRMGVVLPGAVVVTVLWSLSSFTFSWYLSNFRVLHTMYGNLSGI 258

Query: 249 MTCLVFLYMLGVFFILGAELN 269
           +  ++F Y++ +FFI GAEL+
Sbjct: 259 VASMLFFYIISIFFIYGAELS 279


>gi|199598315|ref|ZP_03211735.1| Ribonuclease BN-like family enzyme [Lactobacillus rhamnosus HN001]
 gi|199590768|gb|EDY98854.1| Ribonuclease BN-like family enzyme [Lactobacillus rhamnosus HN001]
          Length = 334

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 79/269 (29%), Positives = 134/269 (49%), Gaps = 16/269 (5%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVI 74
           AI    + +    A+ ++   LLS+FP I+F AN   +LG      ++   +  A P  +
Sbjct: 46  AINRISDSNIGQSAAALAYYTLLSLFPLILFVANALPYLGLK--YSSLATYLTQAVPANV 103

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
            + +   I  +L   + GL  I A+A  + +S GV  L++  N+ Y V   +++ I RL+
Sbjct: 104 MEWLDPIIANLLDSSSGGLLGIGAIATLWAASLGVTGLKMGFNQVYGVEATQNFIIQRLL 163

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL------LIIWNG-RIYATML 187
           S    +L + TL+I   V  AI +  A+ R+F   L  LL      L  +N  R   T+ 
Sbjct: 164 S----MLMTFTLII---VMGAILIVFAFGRQFLEWLIPLLRLDTSWLRTFNTLRWPITVT 216

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           ALF+ ++F+  FLP  K K+ ++LPG  FT I W++ A  F+ Y+  F T    Y  + +
Sbjct: 217 ALFVIIMFLDYFLPNVKIKMWTVLPGTAFTVIGWLLIAQAFSLYMHYFGTRYLSYGTIGT 276

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYY 276
            +  +++L    +  + GA +NA    Y+
Sbjct: 277 FIAIMLWLNFSALVLLWGAVINALTAEYF 305


>gi|288553956|ref|YP_003425891.1| hypothetical protein BpOF4_04675 [Bacillus pseudofirmus OF4]
 gi|288545116|gb|ADC48999.1| hypothetical protein BpOF4_04675 [Bacillus pseudofirmus OF4]
          Length = 276

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 122/252 (48%), Gaps = 17/252 (6%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           +LS+FP ++F   L  +   +  +  V  +++   P  +A    + IL+V++ P  GL +
Sbjct: 31  MLSIFPLLIFMIALLPYFQLN--IDQVYQILYDYVPSDLADLFGNTILEVISHPQGGLVS 88

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
              +AA + +SNGV AL  ++NRAY + E R++           LL+ +  + M FV V 
Sbjct: 89  FGVIAAMWSASNGVNALIRAVNRAYGIEETRNFLSL-------RLLSILLTLCMIFVVVT 141

Query: 156 IPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIG-------LIFVHLFLPAAKSKIM 208
             L   + +     +  L  +      +  +L   IG       L+F++   P  K K  
Sbjct: 142 TLLLPVFGKLIINGMEYLFAVPPETAEFLNVLRWIIGIGLMTLVLMFLYWAAPNVKLKFK 201

Query: 209 SILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAEL 268
            ++ G +   I W + ++LF++Y+  F  YS  Y  L  ++  +++ ++ G+  I+G E+
Sbjct: 202 QVIIGALSATIGWQIISLLFSYYVTNFGNYSATYGSLGGVIILMLWFFLTGLIIIVGGEI 261

Query: 269 NASMIIYYWRKK 280
           NA+ I +  R K
Sbjct: 262 NAT-IFHQKRAK 272


>gi|85375509|ref|YP_459571.1| hypothetical protein ELI_13410 [Erythrobacter litoralis HTCC2594]
 gi|84788592|gb|ABC64774.1| conserved hypothetical membrane protein [Erythrobacter litoralis
           HTCC2594]
          Length = 339

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 127/268 (47%), Gaps = 29/268 (10%)

Query: 22  EDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAK---PI 78
            DG+  A +++  A+L++FPF + GA +   +G        I+ V  A P  +A    P+
Sbjct: 54  NDGFIHAGNLAYMAVLAIFPFFITGAAIFSVIGEESDRAATINAVLLALPPSVANTIGPV 113

Query: 79  TDEILQVLA------VPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
             E+++  +        A GL+T+S+L         +E +R  L RAY    + +++  R
Sbjct: 114 AREVIEARSGWLLWVGGAVGLWTVSSL---------IETIRDILRRAYGTEAVLAFWRYR 164

Query: 133 LISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIG 192
           L+S G ++ A V L++     V I  A  +++ + P L ++L     G +  + +   IG
Sbjct: 165 LLSTGIIIAAVVLLMLSLIAQVMIGAAQEFIQAYVPQLIDML-----GELQISRIIPAIG 219

Query: 193 L------IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           L      +F  L     +S+     PG + T + WV   V     +  F  Y   Y  L+
Sbjct: 220 LFGSIYFLFYALTPHVYRSRRYPKWPGALATTVWWVGVTVALPPILRNFFAYDLTYGALS 279

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMII 274
            IM  L F +++G+  ++GAELNA++ +
Sbjct: 280 GIMIALFFFWLVGLGVVIGAELNAALAV 307


>gi|239638059|ref|ZP_04679018.1| transporter [Staphylococcus warneri L37603]
 gi|239596342|gb|EEQ78880.1| transporter [Staphylococcus warneri L37603]
          Length = 411

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 77/254 (30%), Positives = 129/254 (50%), Gaps = 11/254 (4%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           ++D   +A+ ++   +L++FP ++F   L  F    Q   + I  +  + P   +  I  
Sbjct: 82  KDDASGLAAQMTYHFVLAMFPMLIFLLTLLPFFNIEQ---SQITNMLSSAPSETSSIIKG 138

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
            I  V    + GL ++  + A + +SNG+ A+  S N AY V + R+  + +L+S  + +
Sbjct: 139 VIGDVTKNSSGGLLSVGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGILLKLLSVVFTV 198

Query: 141 LASVTLVIMSFVFVAIP-LALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLI-FVHL 198
           +  V   I     +A+P L  A     F  LG    + W   +   +L L I L+ F+ L
Sbjct: 199 VMGVVFAIA----MALPTLGSAISHYLFGPLGLDSEVKWVFNLIRVVLPLIIILVLFIVL 254

Query: 199 F--LPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
           +   P  K+KI+S+LPG IFT I W++G+  F  YI  F  YS  Y  +A I+  L++LY
Sbjct: 255 YSVAPNVKTKILSVLPGAIFTSIIWLLGSFAFGWYISNFGNYSKTYGSIAGIIILLIWLY 314

Query: 257 MLGVFFILGAELNA 270
           +     I+GAE+NA
Sbjct: 315 LTSFIIIIGAEINA 328


>gi|150391950|ref|YP_001321999.1| putative ribonuclease BN [Alkaliphilus metalliredigens QYMF]
 gi|149951812|gb|ABR50340.1| putative ribonuclease BN [Alkaliphilus metalliredigens QYMF]
          Length = 276

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 136/283 (48%), Gaps = 16/283 (5%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
           F  + +++      F +++  A+ + IS   +LS FPF++F   L G++   +   T+ +
Sbjct: 3   FRRIKEVLLHLYNQFDKDEVPALGAQISYYLILSFFPFLIFLIVLIGYIPLTE-ERTLYE 61

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
           +     P      + + IL++       L +   L   + +S G  A+   +N+AY V E
Sbjct: 62  LAL-ILPHDAYSLVEEIILEITTADNTTLISFGMLGTLWTASRGTSAMIRGMNKAYNVKE 120

Query: 125 MRS-WYITRL-----ISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIW 178
            R  W +  +     I   +++L S+TL++   +     L    + +    L  LL   W
Sbjct: 121 DRPFWKVAGMGVIFTIGLAFMILFSLTLLVFGQL-----LGEMLINQL--NLSTLLEPTW 173

Query: 179 NGRIYA-TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
               Y   +LALF     ++LF P    K+ +I  G +F+ + WVV ++ F +Y+  F  
Sbjct: 174 RLVRYGVALLALFSTFTLLYLFGPNYHLKLKNIYWGALFSTVGWVVISLGFAYYVNNFGN 233

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           Y+ +Y  +  +M  L++LY+  +  ++GAE+N+++ ++  R K
Sbjct: 234 YTRVYGSIGGVMILLIWLYLSSLIVLMGAEVNSTIWVFSKRGK 276


>gi|330685613|gb|EGG97259.1| YihY family protein [Staphylococcus epidermidis VCU121]
          Length = 411

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 77/254 (30%), Positives = 129/254 (50%), Gaps = 11/254 (4%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           ++D   +A+ ++   +L++FP ++F   L  F    Q   + I  +  + P   +  I  
Sbjct: 82  KDDASGLAAQMTYHFVLAMFPMLIFLLTLLPFFNIEQ---SQITSMLSSAPSETSSIIKG 138

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
            I  V    + GL ++  + A + +SNG+ A+  S N AY V + R+  + +L+S  + +
Sbjct: 139 VIGDVTKNSSGGLLSVGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGILLKLLSVVFTV 198

Query: 141 LASVTLVIMSFVFVAIP-LALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLI-FVHL 198
           +  V   I     +A+P L  A     F  LG    + W   +   +L L I L+ F+ L
Sbjct: 199 VMGVVFAIA----MALPTLGSAISHYLFGPLGLDSEVKWVFNLIRVVLPLIIILVLFIVL 254

Query: 199 F--LPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
           +   P  K+KI+S+LPG IFT I W++G+  F  YI  F  YS  Y  +A I+  L++LY
Sbjct: 255 YSVAPNVKTKILSVLPGAIFTSIIWLLGSFAFGWYISNFGNYSKTYGSIAGIIILLIWLY 314

Query: 257 MLGVFFILGAELNA 270
           +     I+GAE+NA
Sbjct: 315 LTSFIIIIGAEINA 328


>gi|225181231|ref|ZP_03734676.1| ribonuclease BN [Dethiobacter alkaliphilus AHT 1]
 gi|225168011|gb|EEG76817.1| ribonuclease BN [Dethiobacter alkaliphilus AHT 1]
          Length = 281

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 121/258 (46%), Gaps = 14/258 (5%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           E +  A  + +S   +LS+FPF++F   L  +    Q     +D +    P+     +  
Sbjct: 17  ENETTARGAQLSYFFILSIFPFLIFLITLIDYTPLSQ--QHTLDQLALLLPDNAFAIVEQ 74

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
            + +V A     L ++  L   + +S G  AL  SLN+AY + E RS+++   I     L
Sbjct: 75  IVSEVEAADNFTLLSLGILGTIWTASRGTAALIKSLNKAYDITESRSFFVLNTIGIAATL 134

Query: 141 LASVTLVI----MSFVFVAIPLALAYV--RKFFPALGNLLLIIWNGRIYATMLALFIGLI 194
             ++ ++     + F  V   LA  Y+     F AL  +L      R    +L +F+   
Sbjct: 135 ALALLILFTLSFLVFGQVIGELAFQYLGLEGLFQALWPVL------RFSIPLLIIFVSFT 188

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            + L+ P  + ++  + PG IF+ ++W++ +  F  Y+  F  +S  Y  +  I+  +++
Sbjct: 189 LLFLYSPNCRLRLRHVYPGAIFSTLAWIIASQAFAFYVNNFGNFSRTYGSIGGIIVFMIW 248

Query: 255 LYMLGVFFILGAELNASM 272
           LY+  V  +LG E+NA++
Sbjct: 249 LYLSSVVVLLGGEINATL 266


>gi|295704377|ref|YP_003597452.1| putative ribonuclease BN [Bacillus megaterium DSM 319]
 gi|294802036|gb|ADF39102.1| putative Ribonuclease BN [Bacillus megaterium DSM 319]
          Length = 282

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/269 (23%), Positives = 129/269 (47%), Gaps = 17/269 (6%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAK 76
           +   E+    +A+  +   +LS+FP ++   ++  +L         IDV+    P   A 
Sbjct: 13  KEIQEDQATGLAAEQAYYYMLSLFPMLILLISIVPYLSIKP--EEAIDVLQSVMPGETAA 70

Query: 77  PITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISF 136
              D ++Q ++ P  GL T+  L   + +SNG+ A   ++N+AY V E RS+   R    
Sbjct: 71  IFKDNVVQFVSQPNGGLLTVGILGTIWSASNGMNAFIRAMNQAYDVKEQRSFIKVR---- 126

Query: 137 GYVLLASVTLVIMSFVFVAIP----LALAYVRKFF--PALGNLLLIIWNGRIYATMLALF 190
           G  +L ++ L++   V + +P    + L ++ ++F  P+   ++L +    I   ++ L 
Sbjct: 127 GLSILLTIGLIVTIVVSLLLPVFGGVLLNWISEWFSLPSGTTVILNVLRWIIGVGIMVLV 186

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           + +++     P        + PG +   + W + ++ F+ Y+  F  YS  Y  L  ++ 
Sbjct: 187 LSVLY--RLAPNKTFPFAHVWPGALAATLLWQLTSLGFSFYVSNFGNYSATYGSLGGVIV 244

Query: 251 CLVFLYMLGVFFILGAELNASMIIYYWRK 279
            +++L++ G+  ++G E+NA   IY+  K
Sbjct: 245 LMLWLFLTGLILVIGGEINA---IYHRNK 270


>gi|89097332|ref|ZP_01170222.1| transporter [Bacillus sp. NRRL B-14911]
 gi|89088155|gb|EAR67266.1| transporter [Bacillus sp. NRRL B-14911]
          Length = 277

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 100/195 (51%), Gaps = 8/195 (4%)

Query: 80  DEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYV 139
           +  L  +A  +  L ++  +   + +SNG+ A+  + N AY V E R   + R    G  
Sbjct: 77  ESNLNQIADRSGTLLSVGIIGTIWSASNGIHAIVKAFNLAYEVKESRPLIVAR----GMA 132

Query: 140 LLASVTLVIMSFVFVAIPLALAYVRKF-FPA--LGNLLLIIWNG-RIYATMLALFIGLIF 195
           +L +  ++ +  V + +P+    +  F F A  L +  L  WN  R   +++ LFI  + 
Sbjct: 133 ILLTFAMIFVFVVALLLPVFGKQIGVFLFSAFDLSSEFLSAWNALRWLVSIVILFIVFLV 192

Query: 196 VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFL 255
           ++   P  K K +S LPG IF    W++ ++ F++Y+  F+ Y+  Y  + +I+  +V+ 
Sbjct: 193 LYWIAPNVKMKCISALPGAIFATAGWILASLAFSYYVGNFANYTAAYGSIGAIIVLMVWF 252

Query: 256 YMLGVFFILGAELNA 270
           Y+ GV  ILG E+NA
Sbjct: 253 YLTGVIIILGGEVNA 267


>gi|222055690|ref|YP_002538052.1| ribonuclease BN [Geobacter sp. FRC-32]
 gi|221564979|gb|ACM20951.1| ribonuclease BN [Geobacter sp. FRC-32]
          Length = 308

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 99/203 (48%), Gaps = 2/203 (0%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           PE     + D +  +      GL ++  + A + SSN + ++   +NR Y+V E R ++ 
Sbjct: 78  PEQAFSLVQDNVKSLFGNKQGGLLSLGFVLALWTSSNAITSIMDIMNRLYQVQEGRPFWK 137

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY-ATMLAL 189
            RL +   V + SV L I+S V +     L         LG+   I+WN  I  AT+  L
Sbjct: 138 VRLTAIALVTVLSV-LFILSLVLLMFGPKLGSFIAGITHLGHFFEILWNILIAPATLFML 196

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + +  ++ F P  +     I PG +     WV+ ++ F+ Y+  F +Y+  Y  + +++
Sbjct: 197 MLAIAIIYYFTPDVEQNWKWISPGAVIAIPVWVLASLAFSFYVNNFGSYNKTYGSIGAVI 256

Query: 250 TCLVFLYMLGVFFILGAELNASM 272
             L +LY+ G   + GAE+N+++
Sbjct: 257 ILLFWLYISGFIILAGAEINSAV 279


>gi|160935740|ref|ZP_02083115.1| hypothetical protein CLOBOL_00630 [Clostridium bolteae ATCC
           BAA-613]
 gi|158441484|gb|EDP19194.1| hypothetical protein CLOBOL_00630 [Clostridium bolteae ATCC
           BAA-613]
          Length = 279

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 67/271 (24%), Positives = 132/271 (48%), Gaps = 20/271 (7%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV-----IDVVFGAWP 71
           + F E++    A+ +S   +LSV PFI+        L A Q +P++     ++++ G  P
Sbjct: 13  DKFAEDEMTVYAAQVSFFIILSVVPFIML------LLTAVQMIPSISNARFMELIVGLVP 66

Query: 72  EVIAKPITDEILQVLAVPAKG-LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
            V  K +   ++  L++ +   + +++A+ A + +  G+ ++   LNR     E R + I
Sbjct: 67  -VDYKSLAFRVVNDLSLKSPATMISVTAVTALWSAGRGMFSVARGLNRVNGHGEKRWYVI 125

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            RLI  GY ++  +  ++   + V   +  A++   FP + ++   I N R    ++ L 
Sbjct: 126 NRLICSGYTIVFILVCILSLGLLVFGNMIQAFMVSRFPIIADVTTHIINFRALWALMILI 185

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYI--VTFSTYSTMYAGLASI 248
           I  + ++ F+P    K+   LPG +F+ + W+  +  F+ Y   +    YS MY  L +I
Sbjct: 186 IFFLGIYTFVPDKSLKLRDQLPGAVFSTVGWMAFSFAFSLYFSHIGGKNYSYMYGSLTAI 245

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           +  L++LY        GAE+N     Y+W++
Sbjct: 246 VLLLLWLYFCMCILFFGAEIN-----YFWKE 271


>gi|241889551|ref|ZP_04776849.1| ribonuclease BN [Gemella haemolysans ATCC 10379]
 gi|241863173|gb|EER67557.1| ribonuclease BN [Gemella haemolysans ATCC 10379]
          Length = 300

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 72/252 (28%), Positives = 131/252 (51%), Gaps = 18/252 (7%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVL 86
           +++++S   +LS+FP ++    L  +    Q    +++ +    P  +   + D I +VL
Sbjct: 40  LSANLSYYFILSLFPMLIVALALTPYFKIDQ--QFLLEKIQNYAPGDLGNYLFDMISEVL 97

Query: 87  AVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTL 146
                 + T+  +   + +S+G+  + I+ N A+RV + R W +T++IS   V+L ++ L
Sbjct: 98  NNKNNTIITVGIVFTLWSASSGIYGIIIAFNNAFRVRDGRIWIVTKIIS---VILTALFL 154

Query: 147 VIMSFVFVAIPL-----ALAYV--RKFFPALGNLLLIIWNGRIYA-TMLALFIGLIFVHL 198
           V M   F+A+ L      L Y+   KF   L      +W+   Y   +L +F   +F++ 
Sbjct: 155 VGM---FLALALIVFGKQLTYILFHKF--NLDQGFYNLWSVINYTLPLLFIFFVFVFLYT 209

Query: 199 FLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYML 258
             P  K K +SILPG +F  +SW + + LF +YI  FS+Y   Y  + + M  +++LY+ 
Sbjct: 210 MGPNLKLKAISILPGALFATLSWTIVSRLFGYYIDHFSSYIKTYGTIGAFMAFILWLYIT 269

Query: 259 GVFFILGAELNA 270
           G   I+GAE+NA
Sbjct: 270 GYILIIGAEINA 281


>gi|330807955|ref|YP_004352417.1| ribonuclease, ribonuclease_BN-like family [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327376063|gb|AEA67413.1| putative ribonuclease, Ribonuclease_BN-like family [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 316

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/264 (24%), Positives = 125/264 (47%), Gaps = 9/264 (3%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQF---VPTVIDVVF 67
           ++   +  F++++    AS ++   L S+FPFI+F   L GFL    F   +    ++V 
Sbjct: 14  VMMRTVTEFLDDEMSTYASALAYQMLFSLFPFILFLIALIGFLHLPDFFSWLRLQSELVL 73

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
                    P+ D++ Q       GL ++  + A + +S GV  +  ++N AY VVE R 
Sbjct: 74  PPQALEQVNPVIDQLQQS----KGGLLSVGIVIALWTASAGVRLMMSAMNAAYDVVEGRP 129

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATM 186
            +    +S  Y +  +  L+  + + V  P  + ++      L   ++ +W   R    +
Sbjct: 130 AWKRFPLSIFYTIGIAGMLLAAAALMVLGPQVMGWIAAQV-GLETFIVTLWTIVRWPVIV 188

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             L + +  ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + 
Sbjct: 189 FLLMVAVALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLGFAFYVKTFADYNAMYGSIG 248

Query: 247 SIMTCLVFLYMLGVFFILGAELNA 270
           +I+  L++ Y+     +LGAE+NA
Sbjct: 249 AIIVLLLYFYISSAVLLLGAEMNA 272


>gi|283796441|ref|ZP_06345594.1| YihY family protein [Clostridium sp. M62/1]
 gi|291075850|gb|EFE13214.1| YihY family protein [Clostridium sp. M62/1]
 gi|295091415|emb|CBK77522.1| Predicted membrane protein [Clostridium cf. saccharolyticum K10]
          Length = 279

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 80/292 (27%), Positives = 134/292 (45%), Gaps = 29/292 (9%)

Query: 4   YFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI 63
           YF +    IYD    FV+++    A+  S   +LS  PFI+        L   QFVP V 
Sbjct: 3   YFLVHCKQIYD---KFVKDEITVYAAQASFFIVLSSVPFIIL------LLTVLQFVPAVQ 53

Query: 64  DVVF----GAWPEVIAKP----ITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRIS 115
              F         +  +P    I DEI    +     + +I+ L +A   S G+  +   
Sbjct: 54  QSDFLYLLSRLLPIEVQPLVYTIVDEIYSKSSAALLSVSSITTLWSA---SRGMLGIEKG 110

Query: 116 LNRAYRVVEMRSWYITRLISFGY--VLLASVTLVIMSFVFVAIPLALAY-VRKFFPALGN 172
           LNR       R + I+R+I+ GY  V +A   L ++  VF  +   L + +  F   L  
Sbjct: 111 LNRIAGSPRRRGYVISRIINSGYTIVFMAVCILSLILLVFGTVIQNLIFKILPFLQGLSP 170

Query: 173 LLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYI 232
            L+ + +      ++A F+GL   + FLP  + ++   LPG +F+ + W++ +   + Y 
Sbjct: 171 YLISLRSMLALVILVAFFMGL---YTFLPYERQRLRCQLPGAVFSTLCWILFSYASSLYF 227

Query: 233 VTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMII---YYWRKKP 281
             FS++STMY  LAS+   +++LY       LGAE+N  +     Y + ++P
Sbjct: 228 KYFSSFSTMYGSLASLAVLMLWLYFCICILFLGAEINCHLTALGRYRFCRRP 279


>gi|225025891|ref|ZP_03715083.1| hypothetical protein EUBHAL_00119 [Eubacterium hallii DSM 3353]
 gi|224956788|gb|EEG37997.1| hypothetical protein EUBHAL_00119 [Eubacterium hallii DSM 3353]
          Length = 325

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 131/269 (48%), Gaps = 4/269 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R+    +++++ D ++   ++   A  +  +   LLS+FPF++F   L  ++   +    
Sbjct: 4   RKRIKNLYELVMDFLKKCSDDHVGAFGAMSAFFILLSIFPFMIFLLTLTRYIPFSKDDII 63

Query: 62  VIDVVFGAWPE-VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           VI     ++ E  + K I +EI +           IS +AA + SS GV ++ I LN  Y
Sbjct: 64  VILTRMISFEEGSLIKSIVNEIYRKTGTTVSA---ISIIAALWSSSRGVYSIVIGLNSVY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
            + E R+++  RL S  Y LL ++ + +M  ++V      +Y  + FP +  +L    + 
Sbjct: 121 DIDENRNYFAIRLFSLVYTLLFALMISVMLVMWVFGNSLYSYFLQKFPFVVPILGYFMHK 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           RI  +++ L +  + ++ ++P   S      PG +   + WV  +V  + Y+  F+ +S 
Sbjct: 181 RIIFSLIFLTLLFMIIYKWIPNRVSSFRKQFPGALIATLGWVAVSVGCSIYMDNFTNFSY 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELN 269
           +Y  +A IM  L++LY        GAE+N
Sbjct: 241 IYGSMAGIMILLLWLYFCMSMVFYGAEVN 269


>gi|239631810|ref|ZP_04674841.1| ribonuclease BN [Lactobacillus paracasei subsp. paracasei 8700:2]
 gi|239526275|gb|EEQ65276.1| ribonuclease BN [Lactobacillus paracasei subsp. paracasei 8700:2]
          Length = 308

 Score = 76.3 bits (186), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 77/269 (28%), Positives = 131/269 (48%), Gaps = 16/269 (5%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVI 74
           AI    E +    A+ ++   LLS+FP I+F AN   + G       +   +  A P  +
Sbjct: 19  AINRITESNIGQSAAALAYYTLLSLFPLILFVANALPYFGLT--YKGLAAYLTQAIPSNV 76

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
              +   I  +L   + GL  I A+A  + +S GV  L++  N+ Y V   +++ I RL+
Sbjct: 77  MNWLDPVIANLLDSSSGGLLGIGAVATLWAASLGVNGLKMGFNQIYGVESSQNFIIQRLL 136

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL------LIIWNG-RIYATML 187
           S    +L + TL+I   V  AI +  A+ R+F   L  LL      L  +N  R   T+ 
Sbjct: 137 S----MLMTFTLII---VMGAILIVFAFGRQFLEWLIPLLRLNDDWLRTFNTLRWPVTIT 189

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           ALF+ ++F++ FLP  K ++ ++LPG  FT   W++ A  F+ Y+  F T    Y  + +
Sbjct: 190 ALFVIIMFLNYFLPNVKIRMWTVLPGTAFTVAGWLLIAQAFSLYMKYFGTRYLSYGTIGT 249

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYY 276
            +  +++L    +  + GA +NA    Y+
Sbjct: 250 FIAIMLWLNFSALVLLWGAVINALTAEYF 278


>gi|300857074|ref|YP_003782058.1| putative ribonuclease BN [Clostridium ljungdahlii DSM 13528]
 gi|300437189|gb|ADK16956.1| predicted ribonuclease BN [Clostridium ljungdahlii DSM 13528]
          Length = 275

 Score = 76.3 bits (186), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 135/276 (48%), Gaps = 31/276 (11%)

Query: 18  HFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKP 77
            F+++D  A+AS ++ S L S+FPF+VF  +L G+         ++ ++    P+   + 
Sbjct: 15  RFIQDDVLALASQLAYSLLFSIFPFLVFFISLIGYSDISS--NDILLILSNVLPKNALEL 72

Query: 78  ITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS----WYITRL 133
           I + +++        L  +S +   +  S G  A+   LN+AY   E RS    + I+ L
Sbjct: 73  IENTVIKTANSKNIELLCLSLILTLWALSGGFHAVIKGLNKAYDQRETRSIFKIYIISIL 132

Query: 134 ISFGYVLLASVTLVIMSF-----VFVAIPLALAYVRKFFPALGNLL--LIIWNGRIYATM 186
            + G  L+   TL+ + F      F+A  L L+   + F  L N+L  +II+ G I    
Sbjct: 133 CTLGVTLIILCTLLFLVFGQMIGSFLAFRLGLS---EGFGFLWNILRYVIIFFGTI---- 185

Query: 187 LALFIGLIF--VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
                 LIF  V++F P  +     +LPG +F+ I  V+ ++ F  Y+  F  YS +Y  
Sbjct: 186 ------LIFAAVYIFTPNVRLTWRKVLPGAVFSTIGIVIASMGFAFYVNNFGNYSKIYGS 239

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           + +++  L +L++L    ILG E N+   + + R+K
Sbjct: 240 IGAVIILLTWLFILSTITILGGEFNS---VLFKREK 272


>gi|172056670|ref|YP_001813130.1| ribonuclease BN [Exiguobacterium sibiricum 255-15]
 gi|171989191|gb|ACB60113.1| ribonuclease BN [Exiguobacterium sibiricum 255-15]
          Length = 302

 Score = 76.3 bits (186), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 116/247 (46%), Gaps = 5/247 (2%)

Query: 37  LSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTI 96
           LS+FP I+F  ++  F    Q   T+   +    P       TD I Q +  P  GL ++
Sbjct: 36  LSIFPGIIFVISVLSFFDIDQ--QTLESQIRDLAPGGSVNTFTDVIFQAIKEPQGGLLSV 93

Query: 97  SALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAI 156
            A+ A + +S GV+ L  + N AY     R +   R I+    ++  + ++++  + V  
Sbjct: 94  GAILAIWSASKGVDRLITTANHAYGDFSPRGFVAARGIALILTIVLGIGMLLLIVLNVLG 153

Query: 157 PLALAYVRKF-FP-ALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGV 214
              ++Y+  F  P  +G  +L+       +T+L + I  IF  +  P         +PG 
Sbjct: 154 GPIISYLANFVIPIDMGQKILLTVLRYAISTVLLILILSIFYRV-APKRPITFKEAIPGA 212

Query: 215 IFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMII 274
           +F  I W + +V F  Y+  FS Y+  Y  L S++  L++LY  G+  +LG+ELNAS   
Sbjct: 213 VFGVIVWQLLSVGFGFYVSNFSNYNQTYGSLGSVVIVLLWLYFTGLIILLGSELNASWER 272

Query: 275 YYWRKKP 281
           +  +  P
Sbjct: 273 FMKKADP 279


>gi|88608339|ref|YP_506282.1| YihY family protein [Neorickettsia sennetsu str. Miyayama]
 gi|88600508|gb|ABD45976.1| YihY family protein [Neorickettsia sennetsu str. Miyayama]
          Length = 279

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 137/279 (49%), Gaps = 17/279 (6%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG------ 54
           M+  F ++   +Y+ + H     G   A ++S   LLS+FPF+ F   +AG+        
Sbjct: 1   MKRTFAVLKISLYNMLYH----GGSEYAGYLSFLLLLSIFPFLFFFTAVAGYTANIVGAS 56

Query: 55  AHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRI 114
           +++    ++ V     PE I + I   I ++L  P  GL T++ L A + +S+ VE L+ 
Sbjct: 57  SYEITRKLLSVFIENVPENIIEGIMPYIKEILEGPTHGLLTLTILGAIWTASSIVEGLKA 116

Query: 115 SLNRAYR--VVEMRSWYI-TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALG 171
           ++N+AY      + S YI  R +S    ++  + + I+  +F+  P     + K    L 
Sbjct: 117 AVNKAYNFGTETLVSEYILRRFVS----VIQFLLISIIILIFLLFPTVYPLLTKNVSFLH 172

Query: 172 NLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHY 231
            L    W      T   +F  +  +++F P  K K   ++PG I     W++ ++ F+ Y
Sbjct: 173 LLKRPSWLPYSTVTTCCIFCFVSALYIFFPKEKQKFTDVVPGSIMVVSLWILTSIAFSFY 232

Query: 232 IVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           + +F+  + +Y  +A I+  +++ Y+L + FI GAE+NA
Sbjct: 233 LHSFAQMNIIYGSIAGIIVVMLYFYLLNLCFIYGAEINA 271


>gi|313889055|ref|ZP_07822713.1| YihY family protein [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312844928|gb|EFR32331.1| YihY family protein [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 304

 Score = 75.9 bits (185), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 136/283 (48%), Gaps = 25/283 (8%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG--AHQFV 59
           ++ F     +IY  ++H    D  +    ++   +LS+FPF++   N   F G    +++
Sbjct: 11  KKAFTFFDKLIYRVLDH----DTLSYGGSLTYFLILSIFPFLISLINAINFSGILDPEYL 66

Query: 60  PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLF-TISALAAAYFSSNGVEALRISLNR 118
             ++DV+ G   E+I        L  L + + G F TIS +A  + +S  V  L   +N+
Sbjct: 67  YGLLDVLPGEIQEIIR-----NFLNELHMSSSGSFLTISFVAGLFTASTAVFKLMKIINQ 121

Query: 119 AYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPL--ALAYVR--KFFPALGNLL 174
           +Y  VE R +   RL++    L  ++ L++M F+ V   +   + YV+   +        
Sbjct: 122 SYGFVESRGFLAQRLMA----LFFTLALILMIFLLVLTQIFGQIIYVKVMSYLGIENASF 177

Query: 175 LIIWNGRIYATMLA-LFIGLIFVHLFLPAAKSK----IMSILPGVIFTWISWVVGAVLFT 229
             IW+    A  LA + I  I ++ F P+   +    I S+LPG IF  +  ++ +  F 
Sbjct: 178 DKIWSIAKNAIPLAYMLITFILLYKFSPSKSRENMITIKSVLPGSIFATLGLIIASSGFN 237

Query: 230 HYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
            Y+  F  YS  Y  L  I+  L++LY+L    ++GAE+N+++
Sbjct: 238 FYVSNFGKYSITYGSLGGIIVFLIWLYLLSTITLVGAEINSTL 280


>gi|325103819|ref|YP_004273473.1| ribonuclease BN [Pedobacter saltans DSM 12145]
 gi|324972667|gb|ADY51651.1| ribonuclease BN [Pedobacter saltans DSM 12145]
          Length = 332

 Score = 75.5 bits (184), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 61/267 (22%), Positives = 122/267 (45%), Gaps = 6/267 (2%)

Query: 12  IYDAIEHFVEEDGWA----MASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +Y     F +E G       AS ++ + L++VFP I+F   L  ++    F   ++ ++ 
Sbjct: 34  LYTVATFFFQEIGKESLVNKASSLAYNFLMAVFPAIIFLFTLIPYIPIKNFQNQLMAIIA 93

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              PE   K   D +  ++      L +I  L A +F++NG+  L  + N++  +VE R+
Sbjct: 94  LLLPENAYKAFEDTLEDIVKNQNGKLLSIGFLLALFFATNGIHTLMQAFNKSSLIVETRT 153

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNL--LLIIWNGRIYAT 185
           W   RL++    +L   ++++   + V     L   R+      N   + +I  GR    
Sbjct: 154 WLKQRLVAMNLTVLTIFSIILGVSITVITEFILNTFREELNFENNKFWIFLITIGRWIII 213

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +   F     ++ + PA   K     PG     +  ++  + FT +I  F  Y+ +Y  +
Sbjct: 214 VCVYFFTTSLLYRYGPANAKKWKLFSPGAWLATVLAILTTLGFTFFINNFGAYNKLYGSI 273

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASM 272
            +++  +++LY+  +  ++G ELNAS+
Sbjct: 274 GTLLVVMIWLYLNSLILLIGFELNASL 300


>gi|253577946|ref|ZP_04855218.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251850264|gb|EES78222.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 298

 Score = 75.5 bits (184), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 124/266 (46%), Gaps = 9/266 (3%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           V  +++  +E    +   A A+  +   ++S  P I+F   L       ++ P   +VV 
Sbjct: 10  VTGLLFGFMERVSGDHVGAYATQAAYFLIMSFIPCILFLTTLV------RYTPLTYNVVR 63

Query: 68  GAWPEVIAKPITDEILQVLAVPAK---GLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
            A    I + +   +L ++    K    +  +SA+ A + +  G++++   LN  Y V E
Sbjct: 64  DAIVAFIPENLQSFVLGIVVDVYKRSTAIVPLSAIVALWSAGKGMQSIINGLNTIYHVKE 123

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R+W +TR+ +  Y L   + +++   + V        V ++ P LG +L  I   R   
Sbjct: 124 TRNWLLTRIYAVFYTLSLVIAVIVSLLMLVLGNEIQKVVSRYIPFLGRVLGKILGARALL 183

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
               LF+  + ++  LP  K+   S +PG +   ++W + +  F+ Y   F  +S MY  
Sbjct: 184 VFGVLFLVFLMLYKVLPNRKATFKSQIPGALIIAVAWSIFSYGFSFYFEIFPGFSNMYGN 243

Query: 245 LASIMTCLVFLYMLGVFFILGAELNA 270
           LA+I+  +V+LY+     + GAE+NA
Sbjct: 244 LATIIMVMVWLYICMNLLLYGAEINA 269


>gi|116494587|ref|YP_806321.1| ribonuclease BN-like family protein [Lactobacillus casei ATCC 334]
 gi|191638025|ref|YP_001987191.1| YihY family protein [Lactobacillus casei BL23]
 gi|301066135|ref|YP_003788158.1| ribonuclease BN-like family enzyme [Lactobacillus casei str. Zhang]
 gi|116104737|gb|ABJ69879.1| Ribonuclease BN-like family enzyme [Lactobacillus casei ATCC 334]
 gi|190712327|emb|CAQ66333.1| YihY family protein [Lactobacillus casei BL23]
 gi|300438542|gb|ADK18308.1| Ribonuclease BN-like family enzyme [Lactobacillus casei str. Zhang]
 gi|327382107|gb|AEA53583.1| Methionine aminopeptidase Map [Lactobacillus casei LC2W]
 gi|327385249|gb|AEA56723.1| Methionine aminopeptidase Map [Lactobacillus casei BD-II]
          Length = 335

 Score = 75.5 bits (184), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 77/269 (28%), Positives = 131/269 (48%), Gaps = 16/269 (5%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVI 74
           AI    E +    A+ ++   LLS+FP I+F AN   + G       +   +  A P  +
Sbjct: 46  AINRITESNIGQSAAALAYYTLLSLFPLILFVANALPYFGLT--YKGLAAYLTQAIPSNV 103

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
              +   I  +L   + GL  I A+A  + +S GV  L++  N+ Y V   +++ I RL+
Sbjct: 104 MNWLDPVIANLLDSSSGGLLGIGAVATLWAASLGVNGLKMGFNQIYGVESSQNFIIQRLL 163

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL------LIIWNG-RIYATML 187
           S    +L + TL+I   V  AI +  A+ R+F   L  LL      L  +N  R   T+ 
Sbjct: 164 S----MLMTFTLII---VMGAILIVFAFGRQFLEWLIPLLRLNDDWLRTFNTLRWPVTIT 216

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           ALF+ ++F++ FLP  K ++ ++LPG  FT   W++ A  F+ Y+  F T    Y  + +
Sbjct: 217 ALFVIIMFLNYFLPNVKIRMWTVLPGTAFTVAGWLLIAQAFSLYMKYFGTRYLSYGTIGT 276

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYY 276
            +  +++L    +  + GA +NA    Y+
Sbjct: 277 FIAIMLWLNFSALVLLWGAVINALTAEYF 305


>gi|146281873|ref|YP_001172026.1| ribonuclease BN, putative [Pseudomonas stutzeri A1501]
 gi|145570078|gb|ABP79184.1| ribonuclease BN, putative [Pseudomonas stutzeri A1501]
          Length = 265

 Score = 75.5 bits (184), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 119/244 (48%), Gaps = 3/244 (1%)

Query: 28  ASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLA 87
           AS ++   L ++FPF+VF   L GFL    F   +      A P V  + I   I Q L 
Sbjct: 5   ASALAYRGLFAMFPFLVFLIALLGFLDLQNFFDWLRMQAELALPPVAMEQINPVIDQ-LQ 63

Query: 88  VPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLV 147
               GL +   L A + +S G  +L  +LNRAY V E R  +   +++  Y    +V L+
Sbjct: 64  EQQAGLLSFGILVALWTASIGFRSLMNALNRAYDVEEGRPTWKLIILALAYTAGVAVLLL 123

Query: 148 IMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFL-PAAKSK 206
             + + V  P A+ ++      +  L++++W    +  ++ + + ++ +  ++ P  + +
Sbjct: 124 FTAGLMVIGPQAMEWLAGQV-GMRELVVVLWTWLRWPVIVLMLMLVVALLYYVAPDVEQE 182

Query: 207 IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGA 266
              I PG +   + W++ +V F  Y+  F+ Y+  Y  + +I+  L++LY+     + GA
Sbjct: 183 FRFITPGSVLAVLVWILASVAFGVYVQNFADYNATYGSIGAIIVLLLYLYISAAVLLFGA 242

Query: 267 ELNA 270
           ELNA
Sbjct: 243 ELNA 246


>gi|302386605|ref|YP_003822427.1| ribonuclease BN [Clostridium saccharolyticum WM1]
 gi|302197233|gb|ADL04804.1| ribonuclease BN [Clostridium saccharolyticum WM1]
          Length = 278

 Score = 75.1 bits (183), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 66/268 (24%), Positives = 122/268 (45%), Gaps = 23/268 (8%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
           IYD    + +++    A+  S  ++++ FPF++        L   Q +P++         
Sbjct: 11  IYD---KYSKDEMTVYAAQASFFSIIAAFPFMML------LLALIQLIPSITKANLLQLI 61

Query: 72  EVIAKPITDEILQVLAVPAKGLFT--------ISALAAAYFSSNGVEALRISLNRAYRVV 123
             I  P T EI  V+      L+T        ++A AA + +S G+ ++   LNR Y   
Sbjct: 62  ITII-PSTLEINSVIVTVIDDLYTNSPVAVLSVTAAAAVWSASRGMLSIERGLNRVYGHE 120

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R++++TR+I  GY ++  V  ++   + V       ++ + FP L  +   +   R  
Sbjct: 121 KKRNYFVTRIICAGYTIVFMVICLLTLVLLVLGSSIQGFMNRHFPLLAEITQSVLTFR-- 178

Query: 184 ATMLALFIGLIF--VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
            TML   +   F  ++ ++P  K +    LPG  F  + W+  +  F+ Y   F  YS M
Sbjct: 179 -TMLVFMLTACFAVLYTYVPEKKQEFYKQLPGAAFCTLGWIAFSFAFSIYFNNFGNYSVM 237

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELN 269
           Y  L +I+  ++++Y       LGAE+N
Sbjct: 238 YGSLTAIVLLMLWIYSCICILFLGAEIN 265


>gi|227535434|ref|ZP_03965483.1| ribonuclease BN [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
 gi|227186917|gb|EEI66984.1| ribonuclease BN [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
          Length = 349

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 77/269 (28%), Positives = 131/269 (48%), Gaps = 16/269 (5%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVI 74
           AI    E +    A+ ++   LLS+FP I+F AN   + G       +   +  A P  +
Sbjct: 60  AINRITESNIGQSAAALAYYTLLSLFPLILFVANALPYFGLT--YKGLAAYLTQAIPSNV 117

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
              +   I  +L   + GL  I A+A  + +S GV  L++  N+ Y V   +++ I RL+
Sbjct: 118 MNWLDPVIANLLDSSSGGLLGIGAVATLWAASLGVNGLKMGFNQIYGVESSQNFIIQRLL 177

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL------LIIWNG-RIYATML 187
           S    +L + TL+I   V  AI +  A+ R+F   L  LL      L  +N  R   T+ 
Sbjct: 178 S----MLMTFTLII---VMGAILIVFAFGRQFLEWLIPLLRLNDDWLRTFNTLRWPVTIT 230

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           ALF+ ++F++ FLP  K ++ ++LPG  FT   W++ A  F+ Y+  F T    Y  + +
Sbjct: 231 ALFVIIMFLNYFLPNVKIRMWTVLPGTAFTVAGWLLIAQAFSLYMKYFGTRYLSYGTIGT 290

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYY 276
            +  +++L    +  + GA +NA    Y+
Sbjct: 291 FIAIMLWLNFSALVLLWGAVINALTAEYF 319


>gi|160881600|ref|YP_001560568.1| ribonuclease BN [Clostridium phytofermentans ISDg]
 gi|160430266|gb|ABX43829.1| ribonuclease BN [Clostridium phytofermentans ISDg]
          Length = 289

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 106/223 (47%), Gaps = 5/223 (2%)

Query: 53  LGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLA-----VPAKGLFTISALAAAYFSSN 107
           L   QF+P   + V  A   V    I   ++ ++        +  + +++ +A  + SS 
Sbjct: 45  LSIMQFLPFTENEVMNACRSVFPAAIQGFVISIITELYGKATSTAILSVTLVATLWSSSK 104

Query: 108 GVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFF 167
           G  ++   +N  Y   E R++ + R+ S  Y LL +  +++   +FV       ++ K F
Sbjct: 105 GFLSIIRGMNGVYANTETRNYIVIRIKSAIYTLLFAFMIILFLVIFVFGNQLYLWIVKRF 164

Query: 168 PALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVL 227
           P L    L+I + R    +  L +  +F+ + +P  K+K++  LPG I     W++ + L
Sbjct: 165 PVLKEFALVIISVRTIVGLCLLIVFFLFMFMVIPNRKTKLIKELPGAILASCGWMIFSYL 224

Query: 228 FTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           ++ YI   S YS  Y  L +I+  +++LY       +GAE+N+
Sbjct: 225 YSFYIDNMSNYSYTYGSLTAIVLAMIWLYTCMYMMFIGAEVNS 267


>gi|294499057|ref|YP_003562757.1| putative Ribonuclease BN [Bacillus megaterium QM B1551]
 gi|294348994|gb|ADE69323.1| putative Ribonuclease BN [Bacillus megaterium QM B1551]
          Length = 282

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 128/269 (47%), Gaps = 17/269 (6%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAK 76
           +   E+    +A+  +   +LS+FP ++   ++  +L         ID++    P   A 
Sbjct: 13  KEIQEDQATGLAAEQAYYYMLSLFPMLILLISIVPYLSIKP--EEAIDLLQSVMPGETAA 70

Query: 77  PITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISF 136
              D + Q ++ P  GL T+  L   + +SNG+ A   ++N+AY V E RS+   R    
Sbjct: 71  IFKDNVAQFVSQPNGGLLTVGILGTIWSASNGMNAFIRAMNQAYDVKEQRSFIKVR---- 126

Query: 137 GYVLLASVTLVIMSFVFVAIP----LALAYVRKFF--PALGNLLLIIWNGRIYATMLALF 190
           G  +L ++ L++   V + +P    + L ++ ++F  P+   ++L I    +   ++ L 
Sbjct: 127 GLSILLTIGLIVTIVVSLLLPVFGGVLLNWISEWFSLPSGTTVVLNILRWIVGVGIMVLV 186

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           + +++     P        + PG +   + W + ++ F+ Y+  F  YS  Y  L  ++ 
Sbjct: 187 LSVLY--RLAPNKTFPFAHVWPGALAATLLWQLTSLGFSFYVSNFGNYSATYGSLGGVIV 244

Query: 251 CLVFLYMLGVFFILGAELNASMIIYYWRK 279
            +++L++ G+  ++G E+NA   IY+  K
Sbjct: 245 LMLWLFLTGLILVIGGEINA---IYHRNK 270


>gi|317127299|ref|YP_004093581.1| ribonuclease BN [Bacillus cellulosilyticus DSM 2522]
 gi|315472247|gb|ADU28850.1| ribonuclease BN [Bacillus cellulosilyticus DSM 2522]
          Length = 261

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 73/262 (27%), Positives = 125/262 (47%), Gaps = 21/262 (8%)

Query: 18  HFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG-AHQFVPTVI-DVVFGAWPEVIA 75
            F E     +A+  S   LLS+FPF++F   L  FL    +F   VI DVV    P  I 
Sbjct: 10  RFKEHRLIELAAQCSYYLLLSIFPFLIFILTLFSFLPLTLEFDINVIQDVV----PAEIF 65

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
           + I  +  ++ +    GL + S +   + +S  +  +   LNRAY V E R     RLIS
Sbjct: 66  QFIEGQWTRITSQHNTGLLSFSIIFTIWTASLALNTILRLLNRAYHVTEERKMLKGRLIS 125

Query: 136 FGYVLLASVTLVIMSFVFVAIPLAL--AYVRKFFPALGNLL---LIIWNGRIYATMLALF 190
                   +T+ + + V VA+ L +  A ++   P   N+    L+ W      + L LF
Sbjct: 126 I------FLTIGMFAVVLVALGLQVIGATLKDVLPFDFNIFKFNLLRWG----ISSLVLF 175

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           I  + ++L  P  + K+  +  G IF  + W++   +FT Y+  F+ Y+  Y  + +++ 
Sbjct: 176 IVFMLLYLVGPNIRLKLRDVYIGAIFATLGWLLTTSMFTFYLDNFANYTATYGTIGAVIA 235

Query: 251 CLVFLYMLGVFFILGAELNASM 272
            +V+ ++  V  +LG E+NA +
Sbjct: 236 LMVWFHLSSVIILLGGEINAEL 257


>gi|269838968|ref|YP_003323660.1| ribonuclease BN [Thermobaculum terrenum ATCC BAA-798]
 gi|269790698|gb|ACZ42838.1| ribonuclease BN [Thermobaculum terrenum ATCC BAA-798]
          Length = 363

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 68/275 (24%), Positives = 124/275 (45%), Gaps = 8/275 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M E   +V D +   ++   E+     A H++ S L +VFPF+VF  +L G   A + V 
Sbjct: 23  MTERLGLV-DFVKQVLKEAQEDHLSVFAGHLTYSGLFAVFPFMVFLLSLLGIFRAEELVN 81

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFS----SNGVEALRISL 116
            ++     A P      I   I Q+    A G F +SAL +   +    S    ++  ++
Sbjct: 82  ELLSRASTAMPREAVDLIGGPIRQIAQSKATGAFGLSALVSILLALWGVSGAFRSVMEAM 141

Query: 117 NRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAY-VRKFFPALGNLLL 175
           N  Y V E R ++   LIS   + L +  L+I + V V     +A  + +    LG +  
Sbjct: 142 NVMYEVKEGRPFWKRYLISI-LLSLGAAVLIIAALVLVVFGADIATAIARASAGLGPVFR 200

Query: 176 IIWNGRIYATMLA-LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVT 234
             W    +  ++  + +    ++ F P  + +   I PG +     W+V ++LF+ Y+  
Sbjct: 201 WTWIILQWPVLVGFVLLAFALIYYFAPDVEQQFRFITPGSLVAVALWLVFSLLFSLYVNN 260

Query: 235 FSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
           F +Y+  Y  LA ++  ++++Y      +LG E+N
Sbjct: 261 FGSYNKTYGALAGVIILMLYMYYSAYILLLGTEIN 295


>gi|253681524|ref|ZP_04862321.1| ribonuclease BN [Clostridium botulinum D str. 1873]
 gi|253561236|gb|EES90688.1| ribonuclease BN [Clostridium botulinum D str. 1873]
          Length = 271

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 120/235 (51%), Gaps = 10/235 (4%)

Query: 40  FPFIVFGANLAGF--LGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTIS 97
           FPF++F   +A +  + + + + T+ +++    P+     +   I +VL      L + S
Sbjct: 38  FPFLIFLFTIASYSSIQSDRILFTLKNII----PQSAYTLVYSIINEVLQSRNANLLSFS 93

Query: 98  ALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIP 157
            +   + +SNG +A+  +LN+AY   E RS+   + ++    ++ +  ++   F+ V   
Sbjct: 94  FIITIWIASNGFKAVIRALNKAYGEKEERSFIKLQFMAIITTIILTFLIIFSLFILVLGN 153

Query: 158 LALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIF--VHLFLPAAKSKIMSILPGVI 215
           L    +  FF    NL  I WN   Y  ML +F+ LIF  ++   P  K     +LPG I
Sbjct: 154 LIGYKIMTFFSLPDNLFFI-WNVFRYFLML-IFMILIFAVIYKLTPCRKLTFGEVLPGSI 211

Query: 216 FTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           F  I W++ ++ F+ Y+  F+ YS +Y  + +++  +++L++  +  ++G E+NA
Sbjct: 212 FATIGWIIVSIGFSFYVDNFANYSRLYGSIGAVIILMIWLFLTSIIILIGGEINA 266


>gi|86748374|ref|YP_484870.1| ribonuclease BN, putative [Rhodopseudomonas palustris HaA2]
 gi|86571402|gb|ABD05959.1| ribonuclease BN, putative [Rhodopseudomonas palustris HaA2]
          Length = 356

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 116/245 (47%), Gaps = 18/245 (7%)

Query: 32  SLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAK 91
            +SAL+S +     G  + G L   Q    V        PE     I D++ +VLA    
Sbjct: 111 GISALVSSYALFTDGGTINGHL--QQLAAIV--------PEGTYSVIEDQVGRVLANGET 160

Query: 92  --GLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVI 148
             GL  +S+LA A +S NG V+A+  + N  Y   E R +     +S G+ + A   ++ 
Sbjct: 161 RLGLAFLSSLALALWSVNGGVKAVIDASNVVYDKQESRGFIKLNALSLGFTIGALAAVLS 220

Query: 149 MSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIM 208
              + +A P+AL+ +       G   ++I  GR     L  F GL  ++   P   +   
Sbjct: 221 AIGLVIATPIALSMIGME----GQGAVLIGYGRWPLLALLTFAGLAVLYRHAPDRDTPHW 276

Query: 209 S-ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAE 267
             +LPG +F  ++W+VG+ L ++Y+  F+ Y   Y  L + +  +++++M  +  ++G E
Sbjct: 277 RWVLPGCVFATLAWIVGSALLSYYLGNFANYDATYGSLGAAIGLMIWMWMTAIVVLVGGE 336

Query: 268 LNASM 272
           LNA +
Sbjct: 337 LNAEI 341


>gi|167748842|ref|ZP_02420969.1| hypothetical protein ANACAC_03616 [Anaerostipes caccae DSM 14662]
 gi|167651812|gb|EDR95941.1| hypothetical protein ANACAC_03616 [Anaerostipes caccae DSM 14662]
          Length = 271

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 116/249 (46%), Gaps = 10/249 (4%)

Query: 26  AMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP----TVIDVVFGAWPEVIAKPITDE 81
           A ++  +   +LS FPF++   +L       +FVP     +I +V    PE  +  +   
Sbjct: 22  AFSAQAAFFTVLSFFPFLIVVLSLM------RFVPVTPKDLIGLVNYYLPEQYSVSLVAV 75

Query: 82  ILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLL 141
           I  +         + + +   + +S G+ ++   LN  + + E R++++ R IS  Y+  
Sbjct: 76  INSLYGKITTTYMSFTIITLLWSASKGILSMMTGLNTIHEIPEKRNYFVLRFISTMYIAF 135

Query: 142 ASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLP 201
            +V ++I   V +     L  + +F+P L N  +I    R        F+    ++ FLP
Sbjct: 136 IAVAVLIGIIVLLFGNTLLNQLYQFYPFLSNQHIIFLLIRFGIAFFIFFLVFFIMYRFLP 195

Query: 202 AAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVF 261
           +   K   ++PGVIF+   W++ + LF+ Y   F  +S MY GL  I+  L +LY   + 
Sbjct: 196 SEHFKARQVMPGVIFSSAGWIILSSLFSIYFDNFKFFSIMYGGLTGILLTLFWLYFCMMI 255

Query: 262 FILGAELNA 270
             +GAELN 
Sbjct: 256 LFIGAELNQ 264


>gi|257870278|ref|ZP_05649931.1| ribonuclease BN [Enterococcus gallinarum EG2]
 gi|257804442|gb|EEV33264.1| ribonuclease BN [Enterococcus gallinarum EG2]
          Length = 307

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 115/226 (50%), Gaps = 6/226 (2%)

Query: 47  ANLAGFL--GAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYF 104
            NL  FL       +P V +++ G   E I   I +    +L   + GL +ISALAA + 
Sbjct: 52  GNLLPFLSIAPSNVLPYVQELIPGQVYEFIGPAIEN----LLTSGSGGLLSISALAALWS 107

Query: 105 SSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVR 164
           +S  + AL+I++N+A+ V +  ++ + R +SF  +LL  + +V ++ V     + L +++
Sbjct: 108 ASQSINALQIAMNKAFGVDQRSNFIVVRAVSFVIILLFMIAIVGVTMVIGLGKIILDFLQ 167

Query: 165 KFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVG 224
             F    +L+      +   T++AL   L+ ++  +P AK K+ S LPG +F    W++ 
Sbjct: 168 PIFHIQDDLIATFQTVKWPLTIIALLFILMLIYWLVPNAKVKLRSTLPGAVFATAGWMLL 227

Query: 225 AVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           + +F  Y   F+   + Y  + S +  +++L +     ILG  +NA
Sbjct: 228 SQVFGLYARFFAARISGYQIIGSFIVLMIWLNLAATIIILGGIINA 273


>gi|224476940|ref|YP_002634546.1| hypothetical protein Sca_1456 [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222421547|emb|CAL28361.1| hypothetical protein SCA_1456 [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 358

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 109/217 (50%), Gaps = 14/217 (6%)

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            +++++    P   A  +T  I  ++   +  + ++  + A + +SNG+ AL  + N AY
Sbjct: 117 KIVNMIANNAPASTADLLTGIIGDIMKNASGSILSVGLILALWSASNGMTALMNAFNVAY 176

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRK----FFPALGNLLLI 176
            V + R+  + +LIS  +        VIM  VF+A  +   + ++     F  LG    I
Sbjct: 177 DVEDGRNPIVLKLISVLFT-------VIMGAVFIAAMIFPVFGQQIGHLLFGPLGLDSQI 229

Query: 177 IWNGRIYATMLA-LFIGLIFVHLFL--PAAKSKIMSILPGVIFTWISWVVGAVLFTHYIV 233
            W   I +  L  + I L+FV L+   P  K K+ S++PG +F  + W++G   F  Y+ 
Sbjct: 230 KWIFNILSYALPFVVIFLLFVTLYTLAPNIKIKMKSVIPGALFASVVWILGTAAFGLYVS 289

Query: 234 TFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
            F+ YS  Y  +  I+  +++LY+ G   I+GAE+NA
Sbjct: 290 NFANYSKTYGSIGGIIVLMLWLYITGFIIIVGAEINA 326


>gi|103486149|ref|YP_615710.1| ribonuclease BN [Sphingopyxis alaskensis RB2256]
 gi|98976226|gb|ABF52377.1| ribonuclease BN [Sphingopyxis alaskensis RB2256]
          Length = 355

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 124/255 (48%), Gaps = 6/255 (2%)

Query: 23  DGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEI 82
           DG+  A +++  AL+++FPF +  A     +G        ++ VF   P  +AK ++  I
Sbjct: 82  DGFIHAGNLAYLALIALFPFFILLAAALSLVGGSVGGERAVEAVFSTMPPTVAKALSGPI 141

Query: 83  LQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLA 142
            +V++        + AL A +   + +E +R  L RAY     + ++  RL+S G ++  
Sbjct: 142 REVMSARTGIFLWLGALVALWTVGSLIETVRDILRRAYGTHFSKGFFHYRLLSIG-IITG 200

Query: 143 SVTLVIMSFVFVAIPLAL-AYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLP 201
           +V L+++SF    + + +  +V +  P       +++  R   +   LF+ +  +   L 
Sbjct: 201 AVVLMLLSFSMQVLIVGVEQFVTRVLPEQYQARGLVFISRA-VSGFGLFVAIYLLFYSLT 259

Query: 202 AAKSKIMSIL---PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYML 258
            +K + +      PG +FT + W+   +     + +  +Y   Y  LA +M  L F Y++
Sbjct: 260 PSKYRRLKRCPKWPGALFTTLWWIGVTLALPPLLASLLSYDATYGSLAGVMVALFFFYLV 319

Query: 259 GVFFILGAELNASMI 273
           G+  ++GAELNA+++
Sbjct: 320 GLGMVMGAELNAALV 334


>gi|317470319|ref|ZP_07929712.1| ribonuclease BN family protein [Anaerostipes sp. 3_2_56FAA]
 gi|316902227|gb|EFV24148.1| ribonuclease BN family protein [Anaerostipes sp. 3_2_56FAA]
          Length = 212

 Score = 72.8 bits (177), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 84/166 (50%)

Query: 105 SSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVR 164
           +S G+ ++   LN  + + E R++++ R IS  Y+   +V ++I   V +     L  + 
Sbjct: 40  ASKGILSMMTGLNTIHEIPEKRNYFVLRFISTMYIAFIAVAVLIGIIVLLFGNTLLNQLY 99

Query: 165 KFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVG 224
           +F+P L N  ++    R        F+    ++ FLP+   K   ++PGVIF+   W++ 
Sbjct: 100 QFYPFLSNQHIVFLLIRFGIAFFIFFLVFFIMYRFLPSEHFKARQVMPGVIFSSAGWIIL 159

Query: 225 AVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           + LF+ Y   F  +S MY GL  I+  L +LY   +   +GAELN 
Sbjct: 160 SSLFSIYFDNFKFFSIMYGGLTGILLTLFWLYFCMMILFIGAELNQ 205


>gi|326792696|ref|YP_004310517.1| ribonuclease BN [Clostridium lentocellum DSM 5427]
 gi|326543460|gb|ADZ85319.1| ribonuclease BN [Clostridium lentocellum DSM 5427]
          Length = 289

 Score = 72.8 bits (177), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 126/258 (48%), Gaps = 3/258 (1%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           I  +   +  A +++++   +L+ FPFI+F  +L  +      V  ++  +    P+ + 
Sbjct: 18  IRRYSAHNVSATSAYMAYYWVLAFFPFIIFLISLLSYTKIP--VSVLLQYLSEMVPDSLV 75

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
             I + I Q +   +  L ++  L   + +   V AL   ++ AY    ++ ++  RLI+
Sbjct: 76  PVIENTIKQFILYRSTALLSVGGLVTLWSAGTAVNALTRGIHIAYNSKYIKPFWQARLIA 135

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGLI 194
             Y +L ++ L+++    V       Y+         + + IWN  R+    +AL + L 
Sbjct: 136 LVYTVLLALLLILLMVGLVFGNRLGDYLFGVLDMQKGIFMPIWNMARLTMPFIALIVVLY 195

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++ F+P    K  ++ PGV+FT + W + +++F+ Y+  +S Y+ +Y  + S+   L++
Sbjct: 196 IIYKFIPRKYLKSTNVWPGVMFTSVGWYLFSLIFSIYVDNYSKYNQLYGSIGSVFILLIW 255

Query: 255 LYMLGVFFILGAELNASM 272
           LY      +LGAE+NA +
Sbjct: 256 LYGSCTLLLLGAEINAQL 273


>gi|326386229|ref|ZP_08207853.1| ribonuclease BN [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209454|gb|EGD60247.1| ribonuclease BN [Novosphingobium nitrogenifigens DSM 19370]
          Length = 374

 Score = 72.4 bits (176), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 78/263 (29%), Positives = 118/263 (44%), Gaps = 23/263 (8%)

Query: 22  EDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA---KPI 78
            DG   A + +   L+S+FPF + GA L   LG        +  V  A P V+A    P+
Sbjct: 85  NDGTIHAGNFAYMVLISLFPFCITGAALFSLLGKASEREAALSTVLAALPPVVAGVLGPV 144

Query: 79  TDEILQVLAVP------AKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
              +L+           A GL+T+ +L         VE +R  L RAY     R+++  R
Sbjct: 145 ARGVLEARTGSLLWIGGAVGLWTVGSL---------VETIRDVLRRAYGTRMTRAFWERR 195

Query: 133 LISFGYVLLASVTLVIMSFVF-VAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
           L S G ++LASV L++++    VAI  A   +    P L   +  +   R   T L LF 
Sbjct: 196 LGSTG-LILASVVLILLAITAQVAIAGAQEALFALAPELDGWIAGLALSRFLPTPL-LFA 253

Query: 192 GL--IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            L  IFV L     + +     PGV+F    W    +     +    TY   Y  LA +M
Sbjct: 254 ALWIIFVTLTPEPYRGRRYPKWPGVLFVTCWWQAITIALPKLLRYLFTYDLTYGSLAGVM 313

Query: 250 TCLVFLYMLGVFFILGAELNASM 272
             L F +++G+  ++GAELNA++
Sbjct: 314 IALFFFWLVGLGMVVGAELNAAL 336


>gi|297583355|ref|YP_003699135.1| ribonuclease BN [Bacillus selenitireducens MLS10]
 gi|297141812|gb|ADH98569.1| ribonuclease BN [Bacillus selenitireducens MLS10]
          Length = 290

 Score = 72.0 bits (175), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/273 (24%), Positives = 128/273 (46%), Gaps = 40/273 (14%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAK 76
           + F +++   +A+  +   +LS+FP ++   ++  +      +  V+++++   P  IA 
Sbjct: 19  QEFTKDNVPLLAAAQAYYYMLSLFPMLILILSIIPYFDLDPNI--VVELMYQFIPGEIAS 76

Query: 77  PITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS- 135
            I  +I+ ++     GL T   LA  + +SNG+     + N AY V   R ++  RL+S 
Sbjct: 77  MIEGQIVNLVTEQRGGLLTFGILATIWSASNGMNTFIKAQNEAYNVKVQRPFWKARLVSI 136

Query: 136 ---FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLL--IIWNGRIYATMLALF 190
              FG +L   V L++                   P +G+ ++  I   G + A +  LF
Sbjct: 137 ALTFGLILALIVALIL-------------------PVMGDAIISFISSFGILTAELEELF 177

Query: 191 -----------IGLIFVHLFLPAAKSKI--MSILPGVIFTWISWVVGAVLFTHYIVTFST 237
                      + +IF  L+  A  +KI     LPG +F  ++W +    F+ YI  F+ 
Sbjct: 178 RLLRWVVSISLLAMIFAALYYLAPNTKIPFRYALPGALFATLAWQLTGFGFSIYISNFAN 237

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           +S  Y  L  I+  +++L+++G+  ++GAE+NA
Sbjct: 238 FSQTYGSLGGIIVLMLWLFLIGIVLVVGAEINA 270


>gi|311032903|ref|ZP_07710993.1| putative Ribonuclease BN [Bacillus sp. m3-13]
          Length = 286

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/255 (23%), Positives = 117/255 (45%), Gaps = 12/255 (4%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH-----QFVPTVIDVVFGAWPEVIA 75
           ++    +A+  +   +LS+FP +V   ++  +L        +F+ T++       PE IA
Sbjct: 17  KDRATGLAAEQAYYYMLSLFPLLVLALSIIPYLNIDPQKVIEFLQTMMP------PETIA 70

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
               + I + +  P  GL T   L   + +SNG+ A   ++N A+ V E R +Y+ RL+S
Sbjct: 71  V-FEENINEFVNKPNGGLLTFGILGTIWSASNGMNAFISAMNEAFNVEESRPFYLVRLLS 129

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIF 195
            G  +      +I  F+ V   + +  +       G+  +I+   R       +F  +  
Sbjct: 130 IGLTIGLIFAFLIAFFLPVFGGIIIKQLESVIYIPGSTAIILNILRFIIAFFVIFTIIAV 189

Query: 196 VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFL 255
           ++   P        +LPG I   + W + ++ F+ Y+  F  YS  Y  L  ++  +++L
Sbjct: 190 LYRIAPDISKSFKQLLPGAIVATVIWQLVSLGFSFYVSNFGNYSATYGSLGGVIILMLWL 249

Query: 256 YMLGVFFILGAELNA 270
           ++ G+  ++G E+NA
Sbjct: 250 FLTGLALVIGGEINA 264


>gi|299535175|ref|ZP_07048499.1| transport protein [Lysinibacillus fusiformis ZC1]
 gi|298729296|gb|EFI69847.1| transport protein [Lysinibacillus fusiformis ZC1]
          Length = 305

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 106/208 (50%), Gaps = 11/208 (5%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+ + K I + + ++L      L +I  L   + +S G+ AL  +LN+AY   E R+  +
Sbjct: 92  PDEVYKLIENTLNEILTNRNSSLLSIGVLGTIWSASKGINALLRALNKAYDT-EGRAGIL 150

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKF-FPALG--NLLLIIWNG-RIYATM 186
            R    G  L+ ++ LVI+  V + +P+    +  F F  +G       +W+  R     
Sbjct: 151 DR----GLSLVFTIALVIVIAVALLLPVFGQQIGHFLFSIVGIEEQFESVWHRLRWSIPP 206

Query: 187 LALFIGLIFVHLFLP--AAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
           L +FI L+ ++ F+P  + + KIM + PG +F  ++W+     F+ YI  F+ YS  Y  
Sbjct: 207 LLIFIVLMGIYWFVPNTSPRLKIMGVWPGALFATLAWLAVTYGFSFYINNFANYSATYGS 266

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASM 272
           +  ++  +++LY  G+  I G  LNA+M
Sbjct: 267 IGGVIILMLWLYFTGIILIFGGVLNATM 294


>gi|262202449|ref|YP_003273657.1| ribonuclease BN [Gordonia bronchialis DSM 43247]
 gi|262085796|gb|ACY21764.1| ribonuclease BN [Gordonia bronchialis DSM 43247]
          Length = 349

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 128/263 (48%), Gaps = 9/263 (3%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQF-VPTVIDVVFGAWPEVIA 75
             F  +    +A+ ++  A+LS+FP ++   +L G  G  Q  V  V+ +V    P    
Sbjct: 37  REFSRDQCTDLAAALTYYAVLSLFPALLAVVSLLGVFGQGQRTVDAVLQMVDDVGPSSAV 96

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITRLI 134
             + D + Q+++ P+ G   +  LA A +S++G V A   ++NR Y + E R  +  R  
Sbjct: 97  DTLRDPVQQLVSAPSAGFALVLGLAGALWSASGYVGAFGRAMNRMYEIDEGRPIWKLRP- 155

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALG--NLLLIIWNGRIYATML--ALF 190
               +L+ +V L++   + V + ++    +    A+G  +  L +WN   +  +L  A+ 
Sbjct: 156 --QMLLVTAVALLMAGAIAVMLAISGPVAKAVGDAIGAGDAALTVWNIARWPLVLIFAIL 213

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           +  I  +      + K   I  G     + W++ +VLF  Y+  FS+Y+  Y  LA ++ 
Sbjct: 214 VVAILYYSTPNVKQPKFRWISIGATVAIVVWILASVLFGLYVANFSSYNKTYGALAGVVV 273

Query: 251 CLVFLYMLGVFFILGAELNASMI 273
            L++L++  +  + GAE++A ++
Sbjct: 274 FLLWLWITNLALLFGAEIDAELV 296


>gi|167761163|ref|ZP_02433290.1| hypothetical protein CLOSCI_03568 [Clostridium scindens ATCC 35704]
 gi|167660829|gb|EDS04959.1| hypothetical protein CLOSCI_03568 [Clostridium scindens ATCC 35704]
          Length = 281

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 104/220 (47%), Gaps = 5/220 (2%)

Query: 57  QFVP----TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEAL 112
           Q+ P     V+  V   +P  +   IT  + QV    + G+  I+ + A + +  GV A+
Sbjct: 50  QYTPVTKADVMTAVIQVFPTSVDSMITSIVNQVYN-QSSGIIPITVVVALWSAGKGVLAM 108

Query: 113 RISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGN 172
              LN  Y+  E R++   R+ +  Y ++  + ++ +  + V       ++    P L N
Sbjct: 109 TSGLNCVYKCNETRNYIFLRIRATIYTVMFILVIIFLLVLSVFGNTLNIFIAAHVPILKN 168

Query: 173 LLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYI 232
           L   +   R   T + L +  + ++ FLP  K K+   LPG +F  I W++ + +F+ Y+
Sbjct: 169 LADRLIAMRTIITPIVLMVFCLLIYKFLPNRKDKLRKQLPGAVFAAIGWMIVSWIFSVYV 228

Query: 233 VTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
             F  +S MY  L +I+  ++++Y      +LG ELN  M
Sbjct: 229 DIFKGFSDMYGSLTTIVLIMLWMYFCMYCILLGGELNMMM 268


>gi|126649530|ref|ZP_01721771.1| ribonuclease BN, putative [Bacillus sp. B14905]
 gi|126593855|gb|EAZ87778.1| ribonuclease BN, putative [Bacillus sp. B14905]
          Length = 305

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 106/208 (50%), Gaps = 11/208 (5%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+ + K I + + ++L      L +I  L   + +S G+ AL  +LN+AY   E R+  +
Sbjct: 92  PDEVYKLIENTLKEILTNRNSSLLSIGVLGTIWSASKGINALIRALNKAYDT-EGRAGIL 150

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKF-FPALG--NLLLIIW-NGRIYATM 186
            R    G  L+ +V LVI+  V + +P+    +  F F  +G       +W N R     
Sbjct: 151 DR----GLSLVFTVALVIVIAVALLLPVFGQQIGHFLFSIVGIEEQFESVWHNLRWSIPP 206

Query: 187 LALFIGLIFVHLFLP--AAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
           + +FI L+ ++ F+P  + + KI+ + PG +F  + W++    F+ YI  F+ YS  Y  
Sbjct: 207 ILIFIVLMGIYWFVPNTSPRLKILGVWPGAMFATLGWLMVTYAFSFYINNFANYSATYGS 266

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASM 272
           +  ++  +++LY  G+  I G  LNA+M
Sbjct: 267 IGGVIILMLWLYFTGIILIFGGVLNATM 294


>gi|115372638|ref|ZP_01459945.1| ribonuclease BN [Stigmatella aurantiaca DW4/3-1]
 gi|310823830|ref|YP_003956188.1| ribonuclease bn family protein [Stigmatella aurantiaca DW4/3-1]
 gi|115370359|gb|EAU69287.1| ribonuclease BN [Stigmatella aurantiaca DW4/3-1]
 gi|309396902|gb|ADO74361.1| Ribonuclease BN family protein [Stigmatella aurantiaca DW4/3-1]
          Length = 349

 Score = 71.2 bits (173), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 98/199 (49%), Gaps = 12/199 (6%)

Query: 78  ITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFG 137
           I + +  ++  P   L T+  L A + +S GV+ALR +LN AY V E R  + T+ ++  
Sbjct: 82  IDEHLRSLVNQPRPKLLTLGFLVALWSASRGVDALRKALNLAYDVPESRPVWKTQGVAML 141

Query: 138 YVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL---LIIWNGRIY---ATMLALFI 191
             L+ ++ L +   VF    L    V ++F     L+    + W+   +   A+++ L +
Sbjct: 142 MTLVGTLLLPLSFTVF----LLGGRVGQWFAERLQLIDAFHLFWSWLRWPFTASLVMLML 197

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
            L +    LP  K +   I PG +   + W+V    FT Y+  F  Y+  Y  +  ++  
Sbjct: 198 ALCYY--VLPDVKQRFKYITPGSVLGTVLWLVSTWGFTQYVDEFGNYNVTYGSIGGVVVL 255

Query: 252 LVFLYMLGVFFILGAELNA 270
           L +LY+ G+ FI+G E+NA
Sbjct: 256 LTWLYISGLIFIVGGEVNA 274


>gi|166032624|ref|ZP_02235453.1| hypothetical protein DORFOR_02339 [Dorea formicigenerans ATCC
           27755]
 gi|166026981|gb|EDR45738.1| hypothetical protein DORFOR_02339 [Dorea formicigenerans ATCC
           27755]
          Length = 273

 Score = 71.2 bits (173), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/266 (22%), Positives = 123/266 (46%), Gaps = 11/266 (4%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP----TVI 63
           ++D I +      ++   A A+  +   +L + P I+        L   Q+ P     V+
Sbjct: 7   LYDDIMELTGEITKDHVGAYAAQTAFFFMLCMIPIILL------LLTMVQYTPVTKADVM 60

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             V   +P  +   IT  + QV    + G+  I+ + A + +  GV A+   LN  Y   
Sbjct: 61  TAVIQVFPSSVDSLITSIVNQVYN-QSSGIIPITIVVALWSAGKGVLAMSSGLNCVYNCR 119

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R+++  R+ +  Y ++  + ++ +  + V       ++ +  P L N+   +   R  
Sbjct: 120 ETRNYFFLRIRATVYTVMFILVIIFLLVLSVFGNSLNIFIAEHVPFLRNMADWLIRARNI 179

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T + + + L+ ++ FLP  +      LPG +F+ + W+V + +F+ Y+  F  +S+MY 
Sbjct: 180 ITPIVMIVFLLLIYKFLPNRRDTYKRQLPGAVFSTLGWMVISWVFSVYVDVFKGFSSMYG 239

Query: 244 GLASIMTCLVFLYMLGVFFILGAELN 269
            L +IM  ++++Y      ++G ELN
Sbjct: 240 SLTTIMLIMMWMYFCMYCILIGGELN 265


>gi|300774226|ref|ZP_07084093.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33861]
 gi|300758905|gb|EFK55734.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 322

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 118/264 (44%), Gaps = 14/264 (5%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAK 76
           +    E     AS ++ + LL++FP I+F   +  ++    F   +++ +    P     
Sbjct: 43  QEIARESILNKASSLAYNFLLAMFPAIIFLFTMIPYIPIDNFQEQLLEFLKVIIPHNAFD 102

Query: 77  PITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISF 136
            I   +  ++     GL +   + AA+FS+NG+  L ++ N+A    E RSW   RL++ 
Sbjct: 103 VIQTTLEDIIKNQNGGLLSFGFVLAAFFSTNGMHTLMLAFNKASLTTENRSWIRQRLVAL 162

Query: 137 GYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLII---WNGRIYATMLALFIGL 193
                  V L +   +F    + + Y++       N+ + +   W   I A    +  G+
Sbjct: 163 ALSFTIIVALTVGMGIFTFAGIVINYLK------SNISVDVSWFWTFIIKAARWIILFGI 216

Query: 194 IF-----VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
            F     ++ F PA+  K     PG     I  ++    F +YI  F  Y+ +Y  + +I
Sbjct: 217 YFFTVSCLYKFGPASNQKWKLFSPGATLATILAILTFSGFAYYINHFGAYNKLYGSIGTI 276

Query: 249 MTCLVFLYMLGVFFILGAELNASM 272
           +  ++++Y+  +  ++G ELNAS+
Sbjct: 277 IVIMIWMYLNSLILLVGYELNASI 300


>gi|23098330|ref|NP_691796.1| hypothetical protein OB0875 [Oceanobacillus iheyensis HTE831]
 gi|22776556|dbj|BAC12831.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831]
          Length = 274

 Score = 70.5 bits (171), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 99/204 (48%), Gaps = 9/204 (4%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           PE + + I+   L  L     GL +IS L   + +SNGV A+  + NR+Y +   RS++ 
Sbjct: 65  PEQVMQLISTN-LDTLTEQNTGLLSISILGTLWAASNGVNAITRAFNRSYWIDTERSFFT 123

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIP----LALAYVRKFFPALGNLLLIIWNGRIYATM 186
           TRLIS    ++ ++ +VI+  + + +P    +   YV   F      + I    R   + 
Sbjct: 124 TRLIS----IVLTIGMVIIILLALLLPVFGRMIGLYVFSMFGFTTGFIEIWETLRWIISS 179

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
              FI L+F++   P  +     ++ G +F   SW + +  F+ Y+     YST Y  L 
Sbjct: 180 AIFFIVLLFLYKLAPHKRIVFSEVIWGTVFATFSWQLVSWGFSFYVNNLGNYSTTYGSLG 239

Query: 247 SIMTCLVFLYMLGVFFILGAELNA 270
           +++  +++ Y+ G+  I G  LNA
Sbjct: 240 TVIVLMIWFYLFGIIIITGGVLNA 263


>gi|256847880|ref|ZP_05553325.1| ribonuclease BN [Lactobacillus coleohominis 101-4-CHN]
 gi|256715569|gb|EEU30545.1| ribonuclease BN [Lactobacillus coleohominis 101-4-CHN]
          Length = 296

 Score = 70.5 bits (171), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 124/256 (48%), Gaps = 2/256 (0%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAK 76
            HF      A A+ ++  +LLS+FP I+   NL   +G      TV+  +  A PE +  
Sbjct: 17  HHFQMAQVSASAAVLAYYSLLSIFPAILVVGNLLPMIGID--ANTVLGYLQTAVPESVFA 74

Query: 77  PITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISF 136
            I   +   L   + G+ T  A+ A + +S G+ A + S+N AY V E ++  I R +SF
Sbjct: 75  FIKPIVYDFLRHGSGGILTTGAVIALWSTSQGIAAFQRSVNHAYGVAENQNPIINRTVSF 134

Query: 137 GYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFV 196
            ++L+  + L +M+  +      L  ++  F    + +      +   T  +LFI L  +
Sbjct: 135 IWMLVVILILFLMALTYGIGEDLLQSLQPIFRFNTSYIKTFAQLKWPVTFFSLFIALTLL 194

Query: 197 HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
           + F+P A+ ++  ++ G +   + W+  + +F+ Y    S   T Y  + + +  +++L 
Sbjct: 195 YYFVPNARVRLRYVVVGAVIVALLWMGLSRVFSMYAQLLSRRVTSYKTIGAFIAMMIWLD 254

Query: 257 MLGVFFILGAELNASM 272
             G+  ++GA +NA++
Sbjct: 255 FSGMLVMIGATINATL 270


>gi|28868803|ref|NP_791422.1| ribonuclease BN [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213969591|ref|ZP_03397727.1| ribonuclease BN [Pseudomonas syringae pv. tomato T1]
 gi|302058803|ref|ZP_07250344.1| ribonuclease BN, putative [Pseudomonas syringae pv. tomato K40]
 gi|302134492|ref|ZP_07260482.1| ribonuclease BN, putative [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|28852042|gb|AAO55117.1| ribonuclease BN, putative [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213925687|gb|EEB59246.1| ribonuclease BN [Pseudomonas syringae pv. tomato T1]
 gi|331017340|gb|EGH97396.1| ribonuclease BN, putative [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 323

 Score = 70.5 bits (171), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 100/197 (50%), Gaps = 8/197 (4%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL +I  + A + +S GV  +  ++N AY VVE R  +    +S
Sbjct: 82  NPVIDQLQQ----SKGGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIWKRFPLS 137

Query: 136 FGYVL-LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGL 193
             Y + +A + L   +F+ +  P  + ++      + + ++ +W   R  A +L L + +
Sbjct: 138 ILYTVGIAGMLLAAAAFMVLG-PQVMNWIAAQI-GMEDFIVTLWTILRWPAIILLLMVAV 195

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+  L+
Sbjct: 196 ALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAIIVLLL 255

Query: 254 FLYMLGVFFILGAELNA 270
           + Y+     +LGAE+NA
Sbjct: 256 YFYISAAVLLLGAEMNA 272


>gi|330967398|gb|EGH67658.1| ribonuclease BN [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 323

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 100/197 (50%), Gaps = 8/197 (4%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL +I  + A + +S GV  +  ++N AY VVE R  +    +S
Sbjct: 82  NPVIDQLQQ----SKGGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIWKRFPLS 137

Query: 136 FGYVL-LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGL 193
             Y + +A + L   +F+ +  P  + ++      + + ++ +W   R  A +L L + +
Sbjct: 138 ILYTVGIAGMLLAAAAFMVLG-PQVMNWIAAQI-GMEDFIVTLWTILRWPAIILLLMVAV 195

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+  L+
Sbjct: 196 ALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAIIVLLL 255

Query: 254 FLYMLGVFFILGAELNA 270
           + Y+     +LGAE+NA
Sbjct: 256 YFYISAAVLLLGAEMNA 272


>gi|330957628|gb|EGH57888.1| ribonuclease BN [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 323

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 99/197 (50%), Gaps = 8/197 (4%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL +I  + A + +S GV  +  ++N AY VVE R  +    +S
Sbjct: 82  NPVIDQLQQ----SKGGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIWKRFPLS 137

Query: 136 FGYVL-LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGL 193
             Y + +A + L   +F+ +  P  + ++      +   ++ +W   R  A +L L I +
Sbjct: 138 ILYTIGIAGMLLAAAAFMVLG-PQVMNWIAAQV-GMEEFIVTLWTILRWPAIILLLMIAV 195

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+  L+
Sbjct: 196 ALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAIIVLLL 255

Query: 254 FLYMLGVFFILGAELNA 270
           + Y+     +LGAE+NA
Sbjct: 256 YFYISAAVLLLGAEMNA 272


>gi|225573600|ref|ZP_03782355.1| hypothetical protein RUMHYD_01794 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039039|gb|EEG49285.1| hypothetical protein RUMHYD_01794 [Blautia hydrogenotrophica DSM
           10507]
          Length = 323

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 125/273 (45%), Gaps = 9/273 (3%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M++    V   +   I    ++   A A+  +   +LS  PF++F   L       Q+ P
Sbjct: 1   MKKKLGPVLSSLSGFIRRTQKDHVGAYAAQAAYFIILSFIPFMLFLMTLV------QYTP 54

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLA---VPAKGLFTISALAAAYFSSNGVEALRISLN 117
              + V  A    + + I   +L ++A     +  +  ++ + A + +  G++AL   LN
Sbjct: 55  LTYNAVRSAIVSFLPREIQSFVLGIVAEVFSKSGAVLPVTLVTAIWSAGKGIQALTNGLN 114

Query: 118 RAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLII 177
             Y V E R+W  TRL S  Y +L    L+    + V        + ++ P LG ++   
Sbjct: 115 TIYHVKETRNWLTTRLWSMLYTVLFVFALIGSLILLVFGNSIQQTLMRYVPFLGEMVARF 174

Query: 178 WNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
              + +   + L +  +F++  LP  ++ + S +PG + T I+W V +  F+ Y   F  
Sbjct: 175 LGAKNFLVFIVLVLLFLFLYKALPNRRASLKSQVPGAVLTAIAWSVFSFGFSIYFTFFPN 234

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           +S MY  L +I+  ++++Y+     + GAE+NA
Sbjct: 235 FSNMYGSLTTIILIMLWMYICMNIVLFGAEINA 267


>gi|227538328|ref|ZP_03968377.1| TRNA-processing ribonuclease BN [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227241843|gb|EEI91858.1| TRNA-processing ribonuclease BN [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 322

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 118/264 (44%), Gaps = 14/264 (5%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAK 76
           +    E     AS ++ + LL++FP I+F   +  ++    F   +++ +    P     
Sbjct: 43  QEIARESILNKASSLAYNFLLAMFPAIIFLFTMIPYIPIDNFQEQLLEFLKVIIPHNAFG 102

Query: 77  PITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISF 136
            I   +  ++     GL +   + AA+FS+NG+  L ++ N+A    E RSW   RL++ 
Sbjct: 103 VIQTTLEDIIKNQNGGLLSFGFVLAAFFSTNGMHTLMLAFNKASLTTENRSWVRQRLVAL 162

Query: 137 GYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLII---WNGRIYATMLALFIGL 193
                  V L +   +F    + + Y++       N+ + +   W   I A    +  G+
Sbjct: 163 ALSFTIIVALTVGMSIFTFAGIVINYLK------SNISVDVSWFWTFIIKAARWIILFGI 216

Query: 194 IF-----VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
            F     ++ F PA+  K     PG     I  ++    F +YI  F  Y+ +Y  + +I
Sbjct: 217 YFFTVSCLYKFGPASNQKWKLFSPGATLATILAILTFSGFAYYINHFGAYNKLYGSIGTI 276

Query: 249 MTCLVFLYMLGVFFILGAELNASM 272
           +  ++++Y+  +  ++G ELNAS+
Sbjct: 277 IVIMIWMYLNSLILLVGYELNASI 300


>gi|218517092|ref|ZP_03513932.1| putative ribonuclease protein [Rhizobium etli 8C-3]
          Length = 52

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 29/52 (55%), Positives = 42/52 (80%)

Query: 1  MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGF 52
          MR+    ++D++YDAI H VE+DG+AMASH++LS+LL+VFPF++FG  L  F
Sbjct: 1  MRKVLRTIYDVVYDAICHMVEDDGFAMASHVALSSLLAVFPFLIFGTALQAF 52


>gi|194466846|ref|ZP_03072833.1| ribonuclease BN [Lactobacillus reuteri 100-23]
 gi|194453882|gb|EDX42779.1| ribonuclease BN [Lactobacillus reuteri 100-23]
          Length = 296

 Score = 70.1 bits (170), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 124/257 (48%), Gaps = 2/257 (0%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           I+H       + A+ ++   LLS+FP ++   NL   +G      T++  +  A PE + 
Sbjct: 16  IQHITMAQISSSAAVLAYYTLLSIFPAVMVVGNLLPMIGID--AKTILAYLSTAIPESVY 73

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
             I   I   L   + G+ T  AL A + +S G+ A + S+N AY + E ++  + R++S
Sbjct: 74  SFIQPLIYDFLRRGSGGILTTGALIALWSTSQGIAAFQRSVNHAYGIAENQNPVMNRIVS 133

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIF 195
           F ++++  V + I+  ++      L  ++  F    + + I  + R   T   LFI L  
Sbjct: 134 FVWMIVVLVIIFIIIILYGFGEQVLKSIQPIFNFRRDYIAIFSSLRWPVTFGVLFIALTL 193

Query: 196 VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFL 255
           ++ F+P AK ++   L G     + W+  + LF+ Y + FS     Y  + + +  +V+L
Sbjct: 194 LYYFVPNAKVRLRYALAGSFLASLLWMGLSRLFSFYTLLFSHGVISYKTIGAFIAMMVWL 253

Query: 256 YMLGVFFILGAELNASM 272
              G   +LGA LNA++
Sbjct: 254 DFSGYIIMLGAALNAAL 270


>gi|289676936|ref|ZP_06497826.1| ribonuclease BN [Pseudomonas syringae pv. syringae FF5]
 gi|330896887|gb|EGH28477.1| ribonuclease BN [Pseudomonas syringae pv. japonica str. M301072PT]
 gi|330942464|gb|EGH45061.1| ribonuclease BN [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 321

 Score = 70.1 bits (170), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 100/197 (50%), Gaps = 8/197 (4%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL +I  + A + +S GV  +  ++N AY VVE R  +    +S
Sbjct: 82  NPVIDQLQQ----SKGGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIWKRLPLS 137

Query: 136 FGYVL-LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGL 193
             Y + +A + L   +F+ +  P  + ++      + + ++ +W   R  A ++ L + +
Sbjct: 138 ILYTVGIAGMLLAAAAFMVLG-PQVMNWIAAQI-GMEDFIVTLWTILRWPAIIILLMVAV 195

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+  L+
Sbjct: 196 ALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAIIVLLL 255

Query: 254 FLYMLGVFFILGAELNA 270
           + Y+     +LGAE+NA
Sbjct: 256 YFYISAAVLLLGAEMNA 272


>gi|66047009|ref|YP_236850.1| ribonuclease BN [Pseudomonas syringae pv. syringae B728a]
 gi|63257716|gb|AAY38812.1| Ribonuclease BN [Pseudomonas syringae pv. syringae B728a]
          Length = 321

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 100/197 (50%), Gaps = 8/197 (4%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL +I  + A + +S GV  +  ++N AY VVE R  +    +S
Sbjct: 82  NPVIDQLQQ----SKGGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIWKRLPLS 137

Query: 136 FGYVL-LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGL 193
             Y + +A + L   +F+ +  P  + ++      + + ++ +W   R  A ++ L + +
Sbjct: 138 ILYTVGIAGMLLAAAAFMVLG-PQVMNWIAAQI-GMEDFIVTLWTILRWPAIIILLMVAV 195

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+  L+
Sbjct: 196 ALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAIIVLLL 255

Query: 254 FLYMLGVFFILGAELNA 270
           + Y+     +LGAE+NA
Sbjct: 256 YFYISAAVLLLGAEMNA 272


>gi|320327458|gb|EFW83471.1| ribonuclease BN, putative [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 316

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 100/197 (50%), Gaps = 8/197 (4%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL +I  + A + +S GV  +  ++N AY VVE R  +    +S
Sbjct: 82  NPVIDQLQQ----SKGGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIWKRLPLS 137

Query: 136 FGYVL-LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGL 193
             Y + +A + L   +F+ +  P  + ++      + + ++ +W   R  A ++ L + +
Sbjct: 138 ILYTVGIAGMLLAAAAFMVLG-PQVMNWIAAQI-GMEDFIVTLWTILRWPAIIILLMVAV 195

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+  L+
Sbjct: 196 ALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAIIVLLL 255

Query: 254 FLYMLGVFFILGAELNA 270
           + Y+     +LGAE+NA
Sbjct: 256 YFYISAAVLLLGAEMNA 272


>gi|330971090|gb|EGH71156.1| ribonuclease BN [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 321

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 100/197 (50%), Gaps = 8/197 (4%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL +I  + A + +S GV  +  ++N AY VVE R  +    +S
Sbjct: 82  NPVIDQLQQ----SKGGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIWKRLPLS 137

Query: 136 FGYVL-LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGL 193
             Y + +A + L   +F+ +  P  + ++      + + ++ +W   R  A ++ L + +
Sbjct: 138 ILYTVGIAGMLLAAAAFMVLG-PQVMNWIAAQI-GMEDFIVTLWTILRWPAIIILLMVAV 195

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+  L+
Sbjct: 196 ALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAIIVLLL 255

Query: 254 FLYMLGVFFILGAELNA 270
           + Y+     +LGAE+NA
Sbjct: 256 YFYISAAVLLLGAEMNA 272


>gi|302187707|ref|ZP_07264380.1| ribonuclease BN [Pseudomonas syringae pv. syringae 642]
          Length = 321

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 100/197 (50%), Gaps = 8/197 (4%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL +I  + A + +S GV  +  ++N AY VVE R  +    +S
Sbjct: 82  NPVIDQLQQ----SKGGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIWKRLPLS 137

Query: 136 FGYVL-LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGL 193
             Y + +A + L   +F+ +  P  + ++      + + ++ +W   R  A ++ L + +
Sbjct: 138 ILYTVGIAGMLLAAAAFMVLG-PQVMNWIAAQI-GMEDFIVTLWTILRWPAIIILLMVAV 195

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+  L+
Sbjct: 196 ALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAIIVLLL 255

Query: 254 FLYMLGVFFILGAELNA 270
           + Y+     +LGAE+NA
Sbjct: 256 YFYISAAVLLLGAEMNA 272


>gi|330949876|gb|EGH50136.1| ribonuclease BN [Pseudomonas syringae Cit 7]
          Length = 322

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 100/197 (50%), Gaps = 8/197 (4%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL +I  + A + +S GV  +  ++N AY VVE R  +    +S
Sbjct: 82  NPVIDQLQQ----SKGGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIWKRLPLS 137

Query: 136 FGYVL-LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGL 193
             Y + +A + L   +F+ +  P  + ++      + + ++ +W   R  A ++ L + +
Sbjct: 138 ILYTVGIAGMLLAAAAFMVLG-PQVMNWIAAQI-GMEDFIVTLWTILRWPAIIILLMVAV 195

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+  L+
Sbjct: 196 ALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAIIVLLL 255

Query: 254 FLYMLGVFFILGAELNA 270
           + Y+     +LGAE+NA
Sbjct: 256 YFYISAAVLLLGAEMNA 272


>gi|330877283|gb|EGH11432.1| ribonuclease BN [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 313

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 100/197 (50%), Gaps = 8/197 (4%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL +I  + A + +S GV  +  ++N AY VVE R  +    +S
Sbjct: 82  NPVIDQLQQ----SKGGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIWKRLPLS 137

Query: 136 FGYVL-LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGL 193
             Y + +A + L   +F+ +  P  + ++      + + ++ +W   R  A ++ L + +
Sbjct: 138 ILYTVGIAGMLLAAAAFMVLG-PQVMNWIAAQI-GMEDFIVTLWTILRWPAIIILLMVAV 195

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+  L+
Sbjct: 196 ALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAIIVLLL 255

Query: 254 FLYMLGVFFILGAELNA 270
           + Y+     +LGAE+NA
Sbjct: 256 YFYISAAVLLLGAEMNA 272


>gi|257486817|ref|ZP_05640858.1| ribonuclease BN, putative [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289625973|ref|ZP_06458927.1| ribonuclease BN, putative [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289647974|ref|ZP_06479317.1| ribonuclease BN, putative [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|298488187|ref|ZP_07006224.1| Ribonuclease BN [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298157466|gb|EFH98549.1| Ribonuclease BN [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|330869370|gb|EGH04079.1| ribonuclease BN [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330988666|gb|EGH86769.1| ribonuclease BN [Pseudomonas syringae pv. lachrymans str. M301315]
          Length = 322

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 100/197 (50%), Gaps = 8/197 (4%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL +I  + A + +S GV  +  ++N AY VVE R  +    +S
Sbjct: 82  NPVIDQLQQ----SKGGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIWKRLPLS 137

Query: 136 FGYVL-LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGL 193
             Y + +A + L   +F+ +  P  + ++      + + ++ +W   R  A ++ L + +
Sbjct: 138 ILYTVGIAGMLLAAAAFMVLG-PQVMNWIAAQI-GMEDFIVTLWTILRWPAIIILLMVAV 195

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+  L+
Sbjct: 196 ALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAIIVLLL 255

Query: 254 FLYMLGVFFILGAELNA 270
           + Y+     +LGAE+NA
Sbjct: 256 YFYISAAVLLLGAEMNA 272


>gi|227543996|ref|ZP_03974045.1| ribonuclease BN [Lactobacillus reuteri CF48-3A]
 gi|300909547|ref|ZP_07127008.1| YihY family protein [Lactobacillus reuteri SD2112]
 gi|227186025|gb|EEI66096.1| ribonuclease BN [Lactobacillus reuteri CF48-3A]
 gi|300893412|gb|EFK86771.1| YihY family protein [Lactobacillus reuteri SD2112]
          Length = 298

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 124/257 (48%), Gaps = 2/257 (0%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           I+H       + A+ ++   LLS+FP ++   NL   +G      T++  +  A PE + 
Sbjct: 16  IQHITMAQISSSAAVLAYYTLLSIFPAVMVVGNLLPMIGID--AKTILAYLSTAIPESVY 73

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
             I   I   L   + G+ T  AL A + +S G+ A + S+N AY + E ++  + R++S
Sbjct: 74  DFIQPLIYDFLRRGSGGVLTTGALIALWSTSQGIAAFQRSVNHAYGIAENQNPVMNRIVS 133

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIF 195
           F ++++  V + I+  ++      L  ++  F    + + +  + R   T   LFI L  
Sbjct: 134 FVWMIVVLVIIFIIIILYGFGEQVLKSIQPIFNFRRDYISLFSSLRWPVTFGVLFIALTL 193

Query: 196 VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFL 255
           ++ F+P AK ++   L G     + W+  + LF+ Y + FS     Y  + + +  +V+L
Sbjct: 194 LYYFVPNAKVRLRYALAGSFLASLLWMGLSRLFSFYTILFSHSVISYKTIGAFIAMMVWL 253

Query: 256 YMLGVFFILGAELNASM 272
              G   +LGA LNA++
Sbjct: 254 DFSGYIIMLGAALNAAL 270


>gi|312129376|ref|YP_003996716.1| ribonuclease bn [Leadbetterella byssophila DSM 17132]
 gi|311905922|gb|ADQ16363.1| ribonuclease BN [Leadbetterella byssophila DSM 17132]
          Length = 304

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 119/248 (47%), Gaps = 5/248 (2%)

Query: 28  ASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLA 87
           A+ ++ S LL+VFP I+F   L  ++        ++D      PE +   +   I ++++
Sbjct: 48  ATSVAFSFLLAVFPGILFLFTLIPYIPIDHLDIQIMDFSRNLMPEGLYDVVAQTIYEIIS 107

Query: 88  VPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLV 147
            P   + +     + Y ++NG+ +L  + N A    + R +  +R  +   ++L    LV
Sbjct: 108 RPRGDILSFGFFFSLYAATNGINSLTNAFNGALEKKKDRGFMRSRGTAALVLVLLVTVLV 167

Query: 148 IMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI---GLIFVHLFLPAAK 204
           I   + +A  + L Y+ +    + +  + IW  R    +   FI   G+  ++ F PA  
Sbjct: 168 ISVVILIAGKIVLNYIAR--AGILDDQINIWGIRTLGYLSIFFIFYFGIACLYYFAPAMD 225

Query: 205 SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFIL 264
            KI     G  F+ +  ++   LF++Y+  FS+Y+ +Y  + +++  +V+ Y++ +  IL
Sbjct: 226 KKIRFFNFGAFFSSVLSILATNLFSYYLENFSSYNKLYGSIGTLIAIMVWTYLICLILIL 285

Query: 265 GAELNASM 272
           G E+N  +
Sbjct: 286 GFEINVDL 293


>gi|71737082|ref|YP_273727.1| ribonuclease BN [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71557635|gb|AAZ36846.1| ribonuclease BN, putative [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|320325401|gb|EFW81466.1| ribonuclease BN, putative [Pseudomonas syringae pv. glycinea str.
           B076]
          Length = 322

 Score = 69.7 bits (169), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 100/197 (50%), Gaps = 8/197 (4%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL +I  + A + +S GV  +  ++N AY VVE R  +    +S
Sbjct: 82  NPVIDQLQQ----SKGGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIWKRLPLS 137

Query: 136 FGYVL-LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGL 193
             Y + +A + L   +F+ +  P  + ++      + + ++ +W   R  A ++ L + +
Sbjct: 138 ILYTVGIAGMLLAAAAFMVLG-PQVMNWIAAQI-GMEDFIVTLWTILRWPAIIILLMVAV 195

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+  L+
Sbjct: 196 ALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAIIVLLL 255

Query: 254 FLYMLGVFFILGAELNA 270
           + Y+     +LGAE+NA
Sbjct: 256 YFYISAAVLLLGAEMNA 272


>gi|331010287|gb|EGH90343.1| ribonuclease BN [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 258

 Score = 69.7 bits (169), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 100/197 (50%), Gaps = 8/197 (4%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL +I  + A + +S GV  +  ++N AY VVE R  +    +S
Sbjct: 18  NPVIDQLQQ----SKGGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIWKRLPLS 73

Query: 136 FGYVL-LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGL 193
             Y + +A + L   +F+ +  P  + ++      + + ++ +W   R  A ++ L + +
Sbjct: 74  ILYTVGIAGMLLAAAAFMVLG-PQVMNWIAAQI-GMEDFIVTLWTILRWPAIIILLMVAV 131

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+  L+
Sbjct: 132 ALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAIIVLLL 191

Query: 254 FLYMLGVFFILGAELNA 270
           + Y+     +LGAE+NA
Sbjct: 192 YFYISAAVLLLGAEMNA 208


>gi|226362631|ref|YP_002780409.1| ribonuclease [Rhodococcus opacus B4]
 gi|226241116|dbj|BAH51464.1| putative ribonuclease [Rhodococcus opacus B4]
          Length = 363

 Score = 69.7 bits (169), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 63/267 (23%), Positives = 126/267 (47%), Gaps = 7/267 (2%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV-PTVIDVVFGA 69
           +I      F  ++   +A+ ++  A+LS+FP ++   +L G  G  Q    TV+ +V   
Sbjct: 31  VIRKTAHEFTRDECTDLAAALTYYAVLSLFPALLAMVSLLGVFGQGQRTTDTVLQIVDDL 90

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRS- 127
            P      + D I Q++  P+ G   I  L  A +S++G + A   ++NR Y V E R  
Sbjct: 91  GPSSAVDTLRDPITQLVQTPSAGAALILGLLGAVWSASGYIGAFGRAMNRIYEVEEGRPV 150

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           W +  L     ++   +  +    + ++ P+A +         G+  L +WN   +  +L
Sbjct: 151 WKLRPLQLLVTLVGLVLVALAALMLAISGPVARSVGDAI--GFGDTALTVWNIARWPFIL 208

Query: 188 ALFI-GLIFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
            + I  +  ++   P   + K   +  G +   ++W++ +VLF  Y+  F +Y+  Y  L
Sbjct: 209 GVVIVAVAILYYVTPNVQQPKFRWVSAGALVGIVTWILVSVLFGLYVSNFGSYNKTYGSL 268

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASM 272
           A ++  L++L++  +  + GAEL+A +
Sbjct: 269 AGVIVFLLWLWITNLALLFGAELDAEL 295


>gi|111019911|ref|YP_702883.1| tRNA processing ribonuclease BN [Rhodococcus jostii RHA1]
 gi|110819441|gb|ABG94725.1| tRNA processing ribonuclease BN [Rhodococcus jostii RHA1]
          Length = 346

 Score = 69.3 bits (168), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 63/267 (23%), Positives = 124/267 (46%), Gaps = 7/267 (2%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVIDVVFGA 69
           +I      F  +    +A+ ++  A+LS+FP ++   +L G  G  Q     V+ +V   
Sbjct: 31  VIRKTAHEFTRDQCTDLAAALTYYAVLSLFPALLALVSLLGVFGQGQRTTDAVLQMVDDL 90

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRS- 127
            P      + D I Q++A P  G+  +  L  A +S++G + A   ++NR Y V E R  
Sbjct: 91  GPSSAVDTLRDPIAQLVAAPTAGMALVLGLLGAVWSASGYIGAFGRAMNRMYEVEEGRPV 150

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           W +   +    ++   +     + + ++ P+A +         G+  L +WN   +  +L
Sbjct: 151 WKLRPQMLAVTIVGLVLVAAAAAMLALSGPVARSVGDTI--GFGDTALTVWNIARWPFVL 208

Query: 188 ALFI-GLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
            + +  +  ++   P  K  K   I  G     ++W+V +VLF  Y+  F +Y+  Y  L
Sbjct: 209 GIVVVAVAILYYVTPNVKQPKFRWISAGAFLAIVTWIVASVLFGLYVANFGSYNKTYGSL 268

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASM 272
           A ++  L++L++  +  + GAEL+A +
Sbjct: 269 AGVIVFLLWLWITNLALLFGAELDAEL 295


>gi|104782989|ref|YP_609487.1| ribonuclease BN [Pseudomonas entomophila L48]
 gi|95111976|emb|CAK16703.1| putative ribonuclease BN [Pseudomonas entomophila L48]
          Length = 318

 Score = 69.3 bits (168), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 98/196 (50%), Gaps = 6/196 (3%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL ++  + A + +S GV  +  ++N AY V E R  +    +S
Sbjct: 82  NPVIDQLQQS----KGGLLSVGIVIALWTASAGVRLMMSAMNAAYDVPEGRPVWKRFPLS 137

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGLI 194
             Y +  +  L+  + + V  P  + ++      L   ++++W   R  A ++ + + + 
Sbjct: 138 IIYTVGIAGMLLAAAALMVLGPQVMEWIASQV-GLEEAVVVVWTILRWPAIIILMMVAVA 196

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++  +P  K K   I PG +   + W+V ++ F +Y+ TF+ Y+ MY  + +I+  L++
Sbjct: 197 LIYYVMPDVKQKFRFITPGSVLAVVVWIVASLGFAYYVKTFADYNAMYGSIGAIIVLLLY 256

Query: 255 LYMLGVFFILGAELNA 270
            Y+     +LGAE+NA
Sbjct: 257 FYISAAVLLLGAEMNA 272


>gi|254975207|ref|ZP_05271679.1| putative membrane-associated ribonuclease [Clostridium difficile
           QCD-66c26]
 gi|255092597|ref|ZP_05322075.1| putative membrane-associated ribonuclease [Clostridium difficile
           CIP 107932]
 gi|255100703|ref|ZP_05329680.1| putative membrane-associated ribonuclease [Clostridium difficile
           QCD-63q42]
 gi|255306592|ref|ZP_05350763.1| putative membrane-associated ribonuclease [Clostridium difficile
           ATCC 43255]
 gi|255314334|ref|ZP_05355917.1| putative membrane-associated ribonuclease [Clostridium difficile
           QCD-76w55]
 gi|255517013|ref|ZP_05384689.1| putative membrane-associated ribonuclease [Clostridium difficile
           QCD-97b34]
 gi|255650115|ref|ZP_05397017.1| putative membrane-associated ribonuclease [Clostridium difficile
           QCD-37x79]
 gi|260683242|ref|YP_003214527.1| putative membrane-associated ribonuclease [Clostridium difficile
           CD196]
 gi|260686838|ref|YP_003217971.1| putative membrane-associated ribonuclease [Clostridium difficile
           R20291]
 gi|306520120|ref|ZP_07406467.1| putative membrane-associated ribonuclease [Clostridium difficile
           QCD-32g58]
 gi|260209405|emb|CBA62875.1| putative membrane-associated ribonuclease [Clostridium difficile
           CD196]
 gi|260212854|emb|CBE04061.1| putative membrane-associated ribonuclease [Clostridium difficile
           R20291]
          Length = 279

 Score = 69.3 bits (168), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 135/284 (47%), Gaps = 24/284 (8%)

Query: 8   VFDIIYDAIEHFVEEDGWA----MASHISLSALLSVFPFIVFGANLAGF---LGAHQFVP 60
           +F I    IE+ + +  ++     ++ +S   +LS+FPF++F  +   +   L  ++++ 
Sbjct: 1   MFGIDKKLIEYIIAKSNYSELSSKSAEVSFFLMLSIFPFLIFTISSIAYIPILHLNKYIA 60

Query: 61  TVIDVV----FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISL 116
              +++    F     +I   I +  L+ LAV        S +   +  S  V+AL   +
Sbjct: 61  LFRNMMPEGAFAVLSSIIVSAIDNRNLKFLAV--------SFVLTMWTFSRAVKALIKGM 112

Query: 117 NRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLI 176
           NRAY+V E RS++    ISF + ++  V L+ +S +F+     + Y       L  + + 
Sbjct: 113 NRAYKVKETRSFFKILSISFLFTIMLLV-LIFLSMIFLVYGEKIGYFIFNLVGLDEIFIK 171

Query: 177 IWN-GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF 235
           IW+  R    ++ + +    ++ + P  K  I    PG IF   +W + + L+++Y   +
Sbjct: 172 IWDILRYTVGIITIIVIFTLLYKYTPNKKLTIKESAPGAIFATFAWFLVSFLYSYYTNYY 231

Query: 236 STYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           + Y  +Y  +A I+  + ++Y      ++G E+N+ +   Y+RK
Sbjct: 232 ANYEVIYGSIAEIIVLMTWMYFSSWSIVIGYEVNSRL---YFRK 272


>gi|237798880|ref|ZP_04587341.1| ribonuclease BN [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331021734|gb|EGI01791.1| ribonuclease BN [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 323

 Score = 69.3 bits (168), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 100/197 (50%), Gaps = 8/197 (4%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL +I  + A + +S GV  +  ++N AY VVE R  +    +S
Sbjct: 82  NPVIDQLQQ----SKGGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIWKRFPLS 137

Query: 136 FGYVL-LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGL 193
             Y + +A + L   +F+ +  P  + ++      +  +++ +W   R  A ++ L + +
Sbjct: 138 ILYTVGIAGMLLAAAAFMVLG-PQVMNWIAAQV-GMEEIIVTLWTILRWPAIIILLMVAV 195

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+  L+
Sbjct: 196 ALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAIIVLLL 255

Query: 254 FLYMLGVFFILGAELNA 270
           + Y+     +LGAE+NA
Sbjct: 256 YFYISAAVLLLGAEMNA 272


>gi|255655600|ref|ZP_05401009.1| putative membrane-associated ribonuclease [Clostridium difficile
           QCD-23m63]
 gi|296451602|ref|ZP_06893336.1| probable membrane-associated ribonuclease [Clostridium difficile
           NAP08]
 gi|296878848|ref|ZP_06902848.1| probable membrane-associated ribonuclease [Clostridium difficile
           NAP07]
 gi|296259520|gb|EFH06381.1| probable membrane-associated ribonuclease [Clostridium difficile
           NAP08]
 gi|296430120|gb|EFH15967.1| probable membrane-associated ribonuclease [Clostridium difficile
           NAP07]
          Length = 279

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 135/284 (47%), Gaps = 24/284 (8%)

Query: 8   VFDIIYDAIEHFVEEDGWA----MASHISLSALLSVFPFIVFGANLAGF---LGAHQFVP 60
           +F I    IE+ + +  ++     ++ +S   +LS+FPF++F  +   +   L  ++++ 
Sbjct: 1   MFGIDKKLIEYIIAKSNYSELSSKSAEVSFFLMLSIFPFLIFTISSIAYIPILHLNKYIA 60

Query: 61  TVIDVV----FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISL 116
              +++    F     +I   I +  L+ LAV        S +   +  S  V+AL   +
Sbjct: 61  LFRNMMPEGAFAVLSSIIVSAIDNRNLKFLAV--------SFVLTMWTFSRAVKALIKGM 112

Query: 117 NRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLI 176
           NRAY+V E RS++    ISF + ++  V L+ +S +F+     + Y       L  + + 
Sbjct: 113 NRAYKVKETRSFFKILSISFLFTIMLLV-LIFLSMIFLVYGEKIGYFIFNLIGLDEIFIK 171

Query: 177 IWN-GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF 235
           IW+  R    ++ + +    ++ + P  K  I    PG IF   +W + + L+++Y   +
Sbjct: 172 IWDILRYTVGIITIIVIFTLLYKYTPNKKLTIKESAPGAIFATFAWFLVSFLYSYYTNYY 231

Query: 236 STYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           + Y  +Y  +A I+  + ++Y      ++G E+N+ +   Y+RK
Sbjct: 232 ANYEVIYGSIAEIIVLMTWMYFSSWSIVIGYEVNSRL---YFRK 272


>gi|197116537|ref|YP_002136964.1| ribonuclease BN family protein [Geobacter bemidjiensis Bem]
 gi|197085897|gb|ACH37168.1| ribonuclease BN family protein [Geobacter bemidjiensis Bem]
          Length = 316

 Score = 68.9 bits (167), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 68/275 (24%), Positives = 130/275 (47%), Gaps = 6/275 (2%)

Query: 1   MREYFCI----VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH 56
           +R YF +      ++   A + F EED    A+ ++   L + FPF++F   L  +L   
Sbjct: 4   LRRYFKLGDTSYKELAKRAFKKFSEEDCPEHAAAMAYYFLFASFPFLLFLTTLIAYLPIP 63

Query: 57  QFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISL 116
             +  V+D      P      I D I  +     +GL ++  + A + SSN + ++  ++
Sbjct: 64  HLLDYVLDNASRVLPGETFTLIEDNIQALFTNKKQGLLSMGIVLALWASSNAIVSVMDAM 123

Query: 117 NRAYRVVEMRSWYITRLISFGYVLLASVT-LVIMSFVFVAIPLALAYVRKFFPALGNLLL 175
           N  Y V E R ++  RLI+ G V+  SV  LV M+ +     +   YV       G   +
Sbjct: 124 NNLYDVKEGRPFWKVRLIAIGLVIGLSVLFLVAMAALMFGNQIG-DYVAGLINFGGAFKV 182

Query: 176 IIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF 235
             +   +  T+  L + +  ++ F P  + + + I PG +    SW++ ++ F++YI  F
Sbjct: 183 AWFAALVPVTLFVLVLAVAVIYYFTPDVEHQWVWISPGAVIAIPSWILMSLAFSYYINNF 242

Query: 236 STYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
            +Y   Y  + +++  L++LY+ G+  + GA +N+
Sbjct: 243 GSYDKTYGSIGAVIVLLLWLYLTGLIILAGAVVNS 277


>gi|170723022|ref|YP_001750710.1| ribonuclease BN [Pseudomonas putida W619]
 gi|169761025|gb|ACA74341.1| ribonuclease BN [Pseudomonas putida W619]
          Length = 317

 Score = 68.9 bits (167), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 98/196 (50%), Gaps = 6/196 (3%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL ++  + A + +S GV  +  ++N AY V E R  +    +S
Sbjct: 82  NPVIDQLQQS----KGGLLSVGIVIALWTASAGVRLMMSAMNAAYDVPEGRPVWKRIPLS 137

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGLI 194
             Y +  +  L+  + + V  P  + ++      +  +++ +W   R  A ++ + + + 
Sbjct: 138 IIYTVGIAGMLLAAAALMVLGPQVMEWIAAQI-GMQEVIVTVWTILRWPAIIILMMVAVA 196

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++  +P  K K   I PG +   + W++ ++ F +Y+ TF+ Y+ MY  + +I+  L++
Sbjct: 197 VIYYVMPDVKQKFRFITPGSVLAVVVWIIASLAFAYYVKTFADYNAMYGSIGAIIVLLLY 256

Query: 255 LYMLGVFFILGAELNA 270
            Y+     +LGAE+NA
Sbjct: 257 FYISAAVLLLGAEMNA 272


>gi|218461679|ref|ZP_03501770.1| putative ribonuclease protein [Rhizobium etli Kim 5]
          Length = 88

 Score = 68.9 bits (167), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 43/53 (81%)

Query: 221 WVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
           W+ GA++F +Y+ TF+ Y+  YAGLAS+M  L+FLYM+G  FI+GAE+NA++I
Sbjct: 2   WLAGALIFAYYLATFANYTATYAGLASVMIVLIFLYMVGAIFIIGAEINAALI 54


>gi|89097736|ref|ZP_01170624.1| hypothetical protein B14911_15112 [Bacillus sp. NRRL B-14911]
 gi|89087595|gb|EAR66708.1| hypothetical protein B14911_15112 [Bacillus sp. NRRL B-14911]
          Length = 286

 Score = 68.6 bits (166), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 58/268 (21%), Positives = 124/268 (46%), Gaps = 15/268 (5%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG-----AHQFVPTVIDVVFGAWP 71
           +   ++    +A+  +   +LS+FP ++   ++  +L      A  F+ TV+       P
Sbjct: 13  KEIKDDRATGLAAEQAYYYMLSIFPILILLLSIVPYLNIDPQKAISFLQTVM-------P 65

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
              A    + ++ ++  P+ GL T   +   + +SNG++A   ++N+A+ V E RS+   
Sbjct: 66  SETAAVFEENVVNIVTQPSGGLLTFGIIGTLWSASNGMQAFIRAMNQAFDVEETRSFIKA 125

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
           RLIS G  L    +L++   + V   + L  V+ F      + ++    R    ++ +  
Sbjct: 126 RLISIGLTLGLIFSLIVALVLPVFGNVILDLVQSFINIPDEMQILFSVLRWVVAIIVIAA 185

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
            L  ++   P        ++PG +   + W + ++  + YI  F+ YS  Y  L  ++  
Sbjct: 186 VLSVLYKLAPNKHYPFKHVIPGAVAATVIWQLISLGLSIYIGNFANYSGTYGSLGGVIVL 245

Query: 252 LVFLYMLGVFFILGAELNASMIIYYWRK 279
           +++ Y+ G+  ++G E+NA   IY+  +
Sbjct: 246 MLWFYLTGLTLVVGGEINA---IYHRER 270


>gi|115374664|ref|ZP_01461942.1| ribonuclease BN [Stigmatella aurantiaca DW4/3-1]
 gi|310820812|ref|YP_003953170.1| ribonuclease bn [Stigmatella aurantiaca DW4/3-1]
 gi|115368332|gb|EAU67289.1| ribonuclease BN [Stigmatella aurantiaca DW4/3-1]
 gi|309393884|gb|ADO71343.1| Ribonuclease BN [Stigmatella aurantiaca DW4/3-1]
          Length = 352

 Score = 68.6 bits (166), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 62/273 (22%), Positives = 127/273 (46%), Gaps = 21/273 (7%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFL----GAHQ 57
           +E+F  + D        +  +    +A  ++ SA+L++FPF++F  +LA  +     A Q
Sbjct: 11  KEFFKSLKD-------EYTRDKVGDVAGALTFSAILAIFPFLLFLVSLASVIIDPAQAEQ 63

Query: 58  FVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLN 117
            +  +  V     P+ +   + D +  + A    GL T+  + A + +S G+ AL  +LN
Sbjct: 64  LIQELARVA----PKEVVTILGDRLHALAASNNVGLLTLGGVGAVWAASGGMVALMTALN 119

Query: 118 RAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLII 177
            AY V E R ++  R ++    L+ +   ++ +   V  P     V   FP L     + 
Sbjct: 120 TAYGVEESRPFWKVRGVALLVTLVTAAISILAAAAAVVTPALAEKVGGPFPTL-----VT 174

Query: 178 WNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
           W     A ++ +F+    ++  LP  + +   I PG +   + W++ +  F+ Y+  F +
Sbjct: 175 WLRLPVAGVMMMFV-WALLYYALPDVQQRFRFITPGSVAGVLIWLLASWGFSQYVANFGS 233

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           Y   Y  +  ++  L+++++     ++GAE+NA
Sbjct: 234 YDANYGAIGGVIVLLMWMWISSQVILVGAEINA 266


>gi|328464131|gb|EGF35603.1| ribonuclease BN-like family protein [Lactobacillus rhamnosus MTCC
           5462]
          Length = 215

 Score = 68.6 bits (166), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 63/192 (32%), Positives = 101/192 (52%), Gaps = 14/192 (7%)

Query: 92  GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
           GL  I A+A  + +S GV  L++  N+ Y V   +++ I RL+S    +L + TL+I   
Sbjct: 2   GLLGIGAIATLWAASLGVTGLKMGFNQVYGVEATQNFIIQRLLS----MLMTFTLII--- 54

Query: 152 VFVAIPLALAYVRKFFPALGNLL------LIIWNG-RIYATMLALFIGLIFVHLFLPAAK 204
           V  AI +A A+ R+F   L  LL      L  +N  R   T+ ALFI ++F+  FLP  K
Sbjct: 55  VMGAILIAFAFGRQFLEWLIPLLRLDTSWLRTFNTLRWPITVTALFIIIMFLDYFLPNVK 114

Query: 205 SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFIL 264
            K+ ++LPG  FT I W++ A  F+ Y+  F T    Y  + + +  +++L    +  + 
Sbjct: 115 IKMWTVLPGTAFTVIGWLLIAQAFSLYMHYFGTRYLSYGTIGTFIAIMLWLNFSALVLLW 174

Query: 265 GAELNASMIIYY 276
           GA +NA    Y+
Sbjct: 175 GAVINALTAEYF 186


>gi|86133182|ref|ZP_01051764.1| ribonuclease BN-like family protein [Polaribacter sp. MED152]
 gi|85820045|gb|EAQ41192.1| ribonuclease BN-like family protein [Polaribacter sp. MED152]
          Length = 314

 Score = 68.6 bits (166), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 138/283 (48%), Gaps = 25/283 (8%)

Query: 12  IYDAIEHF----VEEDGWAMASHISLSALLSVFPFIVFGANLAGFL---GAHQFVPTVID 64
           +YD +E +    VE      AS I+ S  +++FPF++F   L  ++   GA + + ++I 
Sbjct: 35  LYDVLEMYLIGIVEGALTTRASGIAYSFFMAIFPFLLFILTLIPYVPIDGAQEGLLSIIS 94

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
            V    P      +   I+ ++     GL +   + + +  +NGV A+      +Y V E
Sbjct: 95  DVL---PPKTFDAVDTVIIDIINNQYGGLLSFGFIGSIFLMTNGVNAIFGGFEFSYHVKE 151

Query: 125 MRS----WYITRLISFGYVLLASVTLVIMSFVFVAIP--LALAYVRKFFPALGNLLLI-I 177
           +R+    ++I   +SF  V    +T+VI+ F  + +   + LA++        NL+ I +
Sbjct: 152 IRNIFRAYFIAMFVSFVIVAFLLITVVIIIFFELILKDYVTLAWLED------NLIWIQL 205

Query: 178 WNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
             G I+  M+ + + +++ +       S+  S  PG +FT +  V+   LF  Y+  F+ 
Sbjct: 206 VRGSIFLAMIFITVSMLYHYGVKEGKYSRFFS--PGAVFTTVLSVLSFYLFGFYVTEFAK 263

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           Y+ +Y  + +++  ++F+++  +  +LG ELNAS+     R K
Sbjct: 264 YNELYGSIGTLLILMLFIWLNAIILLLGFELNASIYSLRVRNK 306


>gi|255027017|ref|ZP_05299003.1| transport protein [Listeria monocytogenes FSL J2-003]
          Length = 141

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 61/105 (58%), Gaps = 4/105 (3%)

Query: 178 WNG-RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFS 236
           WN  R   T++ +F+   F++   P  +S ++S+LPG +F+ I W V ++ F +Y+  F 
Sbjct: 33  WNNLRWTVTLIVIFVVFTFLYWVAPNRRSTLISVLPGALFSTIGWTVASLGFAYYVNNFG 92

Query: 237 TYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
            YS  Y  +  I+  +++ Y+ G+  ++G ELNA++ I   RKK 
Sbjct: 93  NYSATYGSIGVIIILMLWFYLTGIILMIGGELNATLAI---RKKK 134


>gi|148544597|ref|YP_001271967.1| ribonuclease BN [Lactobacillus reuteri DSM 20016]
 gi|184153955|ref|YP_001842296.1| hypothetical protein LAR_1300 [Lactobacillus reuteri JCM 1112]
 gi|227363716|ref|ZP_03847825.1| possible ribonuclease BN [Lactobacillus reuteri MM2-3]
 gi|325682926|ref|ZP_08162442.1| YihY family protein [Lactobacillus reuteri MM4-1A]
 gi|148531631|gb|ABQ83630.1| putative ribonuclease BN [Lactobacillus reuteri DSM 20016]
 gi|183225299|dbj|BAG25816.1| conserved hypothetical protein [Lactobacillus reuteri JCM 1112]
 gi|227071210|gb|EEI09524.1| possible ribonuclease BN [Lactobacillus reuteri MM2-3]
 gi|324977276|gb|EGC14227.1| YihY family protein [Lactobacillus reuteri MM4-1A]
          Length = 296

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 123/257 (47%), Gaps = 2/257 (0%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           I+H       + A+ ++   LLS+FP ++   NL   +G      T++  +  A PE + 
Sbjct: 16  IQHITMAQISSSAAVLAYYTLLSIFPAVMVVGNLLPMIGID--AKTILAYLSTAIPESVY 73

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
             I   I   L   + G+ T  AL A + +S G+ A + S+N AY + E ++  + R++S
Sbjct: 74  DFIQPLIYDFLRRGSGGVLTTGALIALWSTSQGIAAFQRSVNHAYGIAENQNPVMNRIVS 133

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIF 195
           F ++++  V + I+  ++      L  ++  F    + + I  + R   T   LFI L  
Sbjct: 134 FVWMIVLLVIIFIIIILYGFGEQVLKSIQPIFNFRRDYIAIFSSLRWPVTFGVLFIALTL 193

Query: 196 VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFL 255
           ++ F+P AK ++   L G     + W+  + LF+ Y + F      Y  + + +  +V+L
Sbjct: 194 LYYFVPNAKVRLRYALAGSFLASLLWMGLSRLFSFYTLLFGHGVISYKTIGAFIAMMVWL 253

Query: 256 YMLGVFFILGAELNASM 272
              G   +LGA LNA++
Sbjct: 254 DFSGYIIMLGAALNAAL 270


>gi|148273269|ref|YP_001222830.1| hypothetical protein CMM_2087 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147831199|emb|CAN02152.1| conserved hypothetical protein [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 395

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/264 (26%), Positives = 128/264 (48%), Gaps = 7/264 (2%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQF-VPTVIDVVFGAWPEV 73
           A+  F++  G  MA+ ++  + LS+ P  V   +L G +G  +  V  V+ V+     + 
Sbjct: 42  AVYGFMKHRGIDMAASLTFYSTLSLVPAAVAVLSLIGVVGDTRAGVEGVLGVLTAVLGDS 101

Query: 74  IAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
               I D + Q+   P  G+ FT+S L A + S+  V A   ++NR     E R     R
Sbjct: 102 AVDVIRDPVEQLADGPRSGIAFTVSFLGALWTSAAYVTAFGRAMNRVQETEEGRPLVKYR 161

Query: 133 LISFG-YVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
            +  G  V L  V++V++  + +    A A  ++    LG+  L++W    +  + AL  
Sbjct: 162 ALMLGVTVALLVVSVVMVGMLLLTDDGARALGQQL--GLGDTTLVVWAIVKWPLLAALLT 219

Query: 192 GLIFV-HLFLPAAKSKIMSILP-GVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           G+I V +   P  + + + +L  G +   ++W +G   F  Y+ T +TY + Y  L +++
Sbjct: 220 GIIGVLYAATPNLRRRRVDLLTWGSLVAIVAWGLGTAGFVWYVTTIATYESTYGVLGAVI 279

Query: 250 TCLVFLYMLGVFFILGAELNASMI 273
             L++LY+  +  +LG EL+  +I
Sbjct: 280 VLLLWLYIGNLSLVLGGELDVEII 303


>gi|167035062|ref|YP_001670293.1| ribonuclease BN [Pseudomonas putida GB-1]
 gi|166861550|gb|ABY99957.1| ribonuclease BN [Pseudomonas putida GB-1]
          Length = 319

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 96/196 (48%), Gaps = 6/196 (3%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL ++  + A + +S GV  +  ++N AY V E R  +    +S
Sbjct: 82  NPVIDQLQQS----KGGLLSVGIVIALWTASAGVRLMMSAMNAAYDVPEGRPVWKRIPLS 137

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGLI 194
             Y +  +  L+  + + V  P  + ++      +   ++ +W   R    ++ L + + 
Sbjct: 138 IFYTVGLAGMLLAAAALMVLGPQVMEWIAAQI-GMQEFIVTLWTILRWPVIIILLMVAVA 196

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++  +P  K K   I PG +   + W+V ++ F +Y+ TF+ Y+ MY  + +I+  L++
Sbjct: 197 LIYYVMPDVKQKFRFITPGSVLAVVVWIVASLGFAYYVKTFADYNAMYGSIGAIIVLLLY 256

Query: 255 LYMLGVFFILGAELNA 270
            Y+     +LGAE+NA
Sbjct: 257 FYISAAVLLLGAEMNA 272


>gi|126699181|ref|YP_001088078.1| putative membrane-associated ribonuclease [Clostridium difficile
           630]
 gi|115250618|emb|CAJ68442.1| putative membrane-associated ribonuclease BN-like (Rbn)
           [Clostridium difficile]
          Length = 279

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/284 (22%), Positives = 135/284 (47%), Gaps = 24/284 (8%)

Query: 8   VFDIIYDAIEHFVEEDGWA----MASHISLSALLSVFPFIVFGANLAGF---LGAHQFVP 60
           +F I    IE+ + +  ++     ++ +S   +LS+FPF++F  +   +   L  ++++ 
Sbjct: 1   MFGIDKKLIEYIIAKSNYSELSSKSAEVSFFLMLSIFPFLIFTISSIAYIPILHLNKYIA 60

Query: 61  TVIDVV----FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISL 116
              +++    F     +I   I +  L+ LAV        S +   +  S  V+A+   +
Sbjct: 61  LFRNMMPEGAFAVLSSIIVSAIDNRNLKFLAV--------SFVLTMWTFSRAVKAIIKGM 112

Query: 117 NRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLI 176
           NRAY+V E RS++    ISF + ++  V L+ +S +F+     + Y       L  + + 
Sbjct: 113 NRAYKVKETRSFFKILSISFLFTIMLLV-LIFLSMIFLVYGEKIGYFIFNLVGLDEIFIK 171

Query: 177 IWN-GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF 235
           IW+  R    ++ + +    ++ + P  K  I    PG IF   +W + + L+++Y   +
Sbjct: 172 IWDILRYTVGIITIIVIFTLLYKYTPNKKLTIKESAPGAIFATFAWFLVSFLYSYYTNYY 231

Query: 236 STYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           + Y  +Y  +A I+  + ++Y      ++G E+N+ +   Y+RK
Sbjct: 232 ANYEVIYGSIAEIIVLMTWMYFSSWSIVIGYEVNSRL---YFRK 272


>gi|89891451|ref|ZP_01202956.1| ribonuclease BN family [Flavobacteria bacterium BBFL7]
 gi|89516225|gb|EAS18887.1| ribonuclease BN family [Flavobacteria bacterium BBFL7]
          Length = 309

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 124/256 (48%), Gaps = 17/256 (6%)

Query: 26  AMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQV 85
           A AS IS S  +++FPF++F  NL  F+    F    ++ V    P   A  I D+I + 
Sbjct: 52  ARASAISYSFFMAIFPFLLFVLNLIPFIPIENFQNEFLEFVIELLPAQ-AVSIFDQIFKE 110

Query: 86  LAVPAK-GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASV 144
           +A+    GL TI+ +++  F SNGV A+     R++     R ++    IS    +L ++
Sbjct: 111 IALQGNTGLLTIAFVSSLIFMSNGVNAVFNGFERSFHTDFNRGFFRQYAISLAVSVLLTI 170

Query: 145 TLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR--------IYATMLALFIGLIFV 196
            L+IM  V   +   L  +RK      N++     G         I   +  +F+ +++ 
Sbjct: 171 FLLIMVIVTGYVEYLLEELRK-----SNIMSETGQGETLVFVRYLIVIILTYIFVAVLYY 225

Query: 197 HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
                  +++  SI  G   T +  V+ +VL+  YI  F++Y+ +Y  + +++  +++++
Sbjct: 226 FGTRDGRQTRFFSI--GASVTTVLIVLLSVLYGVYIDNFTSYNEIYGSIGALLILMIYIW 283

Query: 257 MLGVFFILGAELNASM 272
           +     +LG ELNAS+
Sbjct: 284 LNSNILLLGFELNASL 299


>gi|304386338|ref|ZP_07368671.1| YihY family protein [Pediococcus acidilactici DSM 20284]
 gi|304327695|gb|EFL94922.1| YihY family protein [Pediococcus acidilactici DSM 20284]
          Length = 304

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 116/237 (48%), Gaps = 4/237 (1%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKG-LF 94
           LLS FP ++    L         V TV++ +  A PE I   IT+ I++       G LF
Sbjct: 42  LLSFFPLVMLLGTLLPLFQIR--VNTVLEYIETAVPETIYN-ITEPIVKDFLGSGNGELF 98

Query: 95  TISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFV 154
           + S +   + +S  V A + ++NRAY V + ++  I R++SF   ++    + ++ F+F 
Sbjct: 99  SFSLVMTVFSASQAVAAFQRTVNRAYGVAKYQNPIINRVVSFFLTVVIIAIMAVLVFLFS 158

Query: 155 AIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGV 214
                ++Y+        +L  ++   +   T++ LF+GL  ++  +P AK +   ++PG 
Sbjct: 159 FGQTLVSYLTPILNLPTHLFALVGQLKWPVTIVGLFVGLSLLYYLVPNAKIRFKYVIPGT 218

Query: 215 IFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNAS 271
           +F  I  +V + +F+ Y+  F+   T Y  L + +  + +L    +  + G  LNA+
Sbjct: 219 VFATIGTMVLSQVFSFYLRIFARSVTSYKTLGTFIAIMFWLNFSAMIIMFGGVLNAT 275


>gi|301383365|ref|ZP_07231783.1| ribonuclease BN, putative [Pseudomonas syringae pv. tomato Max13]
          Length = 323

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 99/197 (50%), Gaps = 8/197 (4%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL +I  + A + +S GV  +  ++N AY VVE R  +    +S
Sbjct: 82  NPVIDQLQQ----SKGGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIWKRFPLS 137

Query: 136 FGYVL-LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGL 193
             Y + +A + L   +F+ +  P  + ++      + + ++ +W   R  A +L L + +
Sbjct: 138 ILYTVGIAGMLLAAAAFMVLG-PQVMNWIAAQI-GMEDFIVTLWTILRWPAIILLLMVAV 195

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++  +P  K +   I PG +   + W+  ++ F  Y+ TF+ Y+ MY  + +I+  L+
Sbjct: 196 ALIYYVMPDVKQEFRFITPGSVLAVVVWIFASLAFGFYVKTFADYNAMYGSIGAIIVLLL 255

Query: 254 FLYMLGVFFILGAELNA 270
           + Y+     +LGAE+NA
Sbjct: 256 YFYISAAVLLLGAEMNA 272


>gi|270290818|ref|ZP_06197042.1| ribonuclease BN family enzyme [Pediococcus acidilactici 7_4]
 gi|270280878|gb|EFA26712.1| ribonuclease BN family enzyme [Pediococcus acidilactici 7_4]
          Length = 300

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 116/237 (48%), Gaps = 4/237 (1%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKG-LF 94
           LLS FP ++    L         V TV++ +  A PE I   IT+ I++       G LF
Sbjct: 38  LLSFFPLVMLLGTLLPLFQIR--VNTVLEYIETAVPETIYN-ITEPIVKDFLGSGNGELF 94

Query: 95  TISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFV 154
           + S +   + +S  V A + ++NRAY V + ++  I R++SF   ++    + ++ F+F 
Sbjct: 95  SFSLVMTVFSASQAVAAFQRTVNRAYGVAKYQNPIINRVVSFFLTVVIIAIMAVLVFLFS 154

Query: 155 AIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGV 214
                ++Y+        +L  ++   +   T++ LF+GL  ++  +P AK +   ++PG 
Sbjct: 155 FGQTLVSYLTPILNLPTHLFALVGQLKWPVTIVGLFVGLSLLYYLVPNAKIRFKYVIPGT 214

Query: 215 IFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNAS 271
           +F  I  +V + +F+ Y+  F+   T Y  L + +  + +L    +  + G  LNA+
Sbjct: 215 VFATIGTMVLSQVFSFYLRIFARSVTSYKTLGTFIAIMFWLNFSAMIIMFGGVLNAT 271


>gi|229494654|ref|ZP_04388414.1| tRNA processing ribonuclease BN [Rhodococcus erythropolis SK121]
 gi|229318447|gb|EEN84308.1| tRNA processing ribonuclease BN [Rhodococcus erythropolis SK121]
          Length = 321

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 116/242 (47%), Gaps = 5/242 (2%)

Query: 35  ALLSVFPFIVFGANLAGFLGAHQ-FVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL 93
           ++LS+FP ++   +L G  G  Q  V  V+ +V    P    + + + + Q +  PA G 
Sbjct: 5   SVLSLFPAVLAVVSLLGVFGQGQSTVDAVLQIVSDLGPSSAVETLKEPVQQHVEAPAAGF 64

Query: 94  FTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFV 152
             I+ +A A +S++G + A   +LNR Y V E R  +  R      V + ++ L+  + V
Sbjct: 65  ALIAGIAGALWSASGYLVAFGRALNRMYEVEEGRPVWKLRPTML-LVTVTALALIGCAAV 123

Query: 153 FVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPA--AKSKIMSI 210
            +A+   +A         G+  L +WN   +  +L   +  + +  + P    + K   I
Sbjct: 124 MLAVSGPVARAIGDASGAGDTALTVWNIARWPVVLVFVVLAVAILYYAPPNIQQPKFRWI 183

Query: 211 LPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
             G     + W++ +V+F  Y+  FS+Y+  Y  LA  +  L++L++  +  + GAEL++
Sbjct: 184 SGGAALAIVVWILASVIFGFYVANFSSYNKTYGSLAGAIVFLLWLWITNLALLFGAELDS 243

Query: 271 SM 272
            +
Sbjct: 244 EL 245


>gi|330977867|gb|EGH77770.1| ribonuclease BN [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 283

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 99/197 (50%), Gaps = 8/197 (4%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL +I  + A + +S GV  +  ++N AY VVE R  +    +S
Sbjct: 44  NPVIDQLQQ----SKGGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIWKRLPLS 99

Query: 136 FGYVL-LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGL 193
             Y + +A + L   +F+ +  P  + ++      + + ++ +W   R  A ++ L + +
Sbjct: 100 ILYTVGIAGMLLAAAAFMVLG-PQVMNWIAAQI-GMEDFIVTLWTILRWPAIIILLMVAV 157

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++  +P  K +   I PG +   + W+  ++ F  Y+ TF+ Y+ MY  + +I+  L+
Sbjct: 158 ALIYYVMPDVKQEFRFITPGSVLAVVVWIFASLAFGFYVKTFADYNAMYGSIGAIIVLLL 217

Query: 254 FLYMLGVFFILGAELNA 270
           + Y+     +LGAE+NA
Sbjct: 218 YFYISAAVLLLGAEMNA 234


>gi|313675805|ref|YP_004053801.1| ribonuclease bn [Marivirga tractuosa DSM 4126]
 gi|312942503|gb|ADR21693.1| ribonuclease BN [Marivirga tractuosa DSM 4126]
          Length = 311

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/258 (21%), Positives = 117/258 (45%), Gaps = 1/258 (0%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           I+   + +    A++++    L++FP I+F   L  +L        V+ ++    P  + 
Sbjct: 42  IQELSDHNLIERANNVAFQFTLAIFPTIIFLFTLIPYLPIDNLQQEVMSLLEETMPGSVY 101

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
           +     I+ +L+     L ++  + A YF++NG  AL  + N+ YR  + R +   + I+
Sbjct: 102 EVAQSTIVDILSKSRGDLLSVGFIFALYFATNGTSALMTAFNQTYRTKDSRGFVKAKAIA 161

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF-IGLI 194
            G   L +  LV    + +     + ++  F     +  + I+ G  +  +  LF I + 
Sbjct: 162 IGLTFLLAFVLVTSIVLLIVAQQVIYFLEDFGIISDSFEVYIFIGLRFLVIFFLFQIAIS 221

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++ + PA   +     PG I      +  +  F+ YI  F TY+ +Y  + +++  +++
Sbjct: 222 VIYYWAPAIHKRWHFFNPGSILATFLCLAVSFGFSFYINNFGTYNKLYGSIGALIAIMIW 281

Query: 255 LYMLGVFFILGAELNASM 272
              L +F I+G +LN S+
Sbjct: 282 FSFLSLFLIVGLQLNVSL 299


>gi|325289968|ref|YP_004266149.1| ribonuclease BN [Syntrophobotulus glycolicus DSM 8271]
 gi|324965369|gb|ADY56148.1| ribonuclease BN [Syntrophobotulus glycolicus DSM 8271]
          Length = 289

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 121/247 (48%), Gaps = 7/247 (2%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVL 86
           + + I+   +L+ FPF++F   L  ++        ++D +    P+   + I D + +++
Sbjct: 31  LGAQITYYVILAFFPFLIFLLTLTSYINLADV--NILDDLSHIVPQESYQIIADTLKEIM 88

Query: 87  AVPAKG-LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVT 145
           +V     L ++  LA+ + + NG+ AL   +N AY   E RS+ + +  S  ++++  + 
Sbjct: 89  SVRRNTTLLSLGFLASLWSALNGIHALMTGMNSAYGKKETRSFLLQKFTSLNFLIVFFLA 148

Query: 146 LVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKS 205
            +++SF+ + +   L    +      N++  +W  +++     +F+ L F++L   A   
Sbjct: 149 -IVLSFLLLVLGRELEEFLQILLGNLNMITFLWQ-KLHIVFQFVFLILTFLYLNKLATGK 206

Query: 206 KIM--SILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFI 263
                 +LPG +F  I WVV ++ F+ Y+  F+ YS  Y  +  I+  L++LY      +
Sbjct: 207 AFTYGQLLPGSLFAAIGWVVISMGFSLYLKYFNNYSPAYGSIGGIIILLLWLYWSSEMIL 266

Query: 264 LGAELNA 270
            G  LN+
Sbjct: 267 FGCVLNS 273


>gi|58698244|ref|ZP_00373163.1| ribonuclease BN, probable , putative [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58535216|gb|EAL59296.1| ribonuclease BN, probable , putative [Wolbachia endosymbiont of
           Drosophila ananassae]
          Length = 241

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 95/204 (46%), Gaps = 19/204 (9%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+ I   +   I ++++ P + L T++ + A + +S+ +E LR  LN+AY+V     + +
Sbjct: 42  PQDILSSLMPRIREIISGPPQSLLTLAIVGAVWTASSTIEGLRTILNKAYKVPVSPPYIL 101

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML--- 187
            R++S            I+ F+ + + + L  V  F   +  L+   + G  Y   L   
Sbjct: 102 RRVLS------------ILQFLVITLIITLTIV--FSTLVPMLIDFSYQGLSYTRYLLIE 147

Query: 188 -ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYI-VTFSTYSTMYAGL 245
             LF  + +++  LP  K  +  + PG     I W + A  F  Y+  +F     +Y  L
Sbjct: 148 FVLFTVVSWLYFMLPNIKQNLSDVFPGSCVAVILWTISASAFKQYLKASFDQLDLIYGSL 207

Query: 246 ASIMTCLVFLYMLGVFFILGAELN 269
             ++  L+F YML + FI GA+ N
Sbjct: 208 GGVVVSLLFFYMLSLIFIYGAKFN 231


>gi|260587882|ref|ZP_05853795.1| YihY family protein [Blautia hansenii DSM 20583]
 gi|331083883|ref|ZP_08332992.1| hypothetical protein HMPREF0992_01916 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|260542147|gb|EEX22716.1| YihY family protein [Blautia hansenii DSM 20583]
 gi|330403308|gb|EGG82868.1| hypothetical protein HMPREF0992_01916 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 303

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 103/198 (52%), Gaps = 4/198 (2%)

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
           E   + I +E+ +     + G+  +SA+ A + +  G++AL    N  Y+V E R++ ++
Sbjct: 70  ETFIQSIVNEVYE----KSLGVVPVSAVIAMWSAGKGIQALTRGFNSIYQVKETRNFLMS 125

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
           R+ +  Y L+  +++++   + V        +   FP +  ++ +I + R+  T+ AL +
Sbjct: 126 RIRAVFYTLVFVISIILTLTLQVFGNSLQRELSSHFPFMEKIVTMIISMRVVITLSALCV 185

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
             + ++ F+P  K+   S  PG +   + W   +  F+ YI  ++  + MY  + +I+  
Sbjct: 186 VFLMMYKFIPNRKATFRSQFPGALLCAVCWSAFSFGFSLYIDFYNGAANMYGSMTTIVLV 245

Query: 252 LVFLYMLGVFFILGAELN 269
           L++LY   +F +LGA++N
Sbjct: 246 LLWLYFCMMFVMLGAQVN 263


>gi|153956022|ref|YP_001396787.1| hypothetical protein CKL_3414 [Clostridium kluyveri DSM 555]
 gi|219856362|ref|YP_002473484.1| hypothetical protein CKR_3019 [Clostridium kluyveri NBRC 12016]
 gi|146348880|gb|EDK35416.1| Hypothetical protein CKL_3414 [Clostridium kluyveri DSM 555]
 gi|219570086|dbj|BAH08070.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 275

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/270 (24%), Positives = 129/270 (47%), Gaps = 26/270 (9%)

Query: 18  HFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKP 77
            F+E+D  A+AS ++ S + S FPF++F  ++ G+                  PE I + 
Sbjct: 17  RFIEDDVLALASQLAYSLIFSFFPFLIFIISIIGYSDISSSNILSSLSYI--LPENILQL 74

Query: 78  ITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS----WYITRL 133
           I   I+++       L   S     + SS G  ++   LN+AY   E RS    + I+ +
Sbjct: 75  IKTTIIRITDTRDIKLLFSSLALTIWSSSGGFHSVIKGLNKAYNKKESRSVLKIYAISMV 134

Query: 134 ISFGYVLLASVTLVIMSF-----VFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
            + G  ++  +T++++ F      F+A  L  +    F          +WN  I+  ++ 
Sbjct: 135 CTLGITVIIIITILLLVFGQIIGSFLAFNLGFSKEFNF----------MWN--IFRYLMI 182

Query: 189 LFIGL-IF--VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           LF  + IF  V+ + P  K +   ++PG  F+ +  V+ ++ F  Y+  F++YS +Y  +
Sbjct: 183 LFSTIFIFSAVYRYTPNVKLRWREVMPGAFFSTVGIVIASMGFAFYVNNFASYSIIYGSI 242

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            + +  + +L++L V  ILG E+N+ + I+
Sbjct: 243 GAAIMLMTWLFILSVITILGGEINSVLFIH 272


>gi|225389046|ref|ZP_03758770.1| hypothetical protein CLOSTASPAR_02791 [Clostridium asparagiforme
           DSM 15981]
 gi|225044891|gb|EEG55137.1| hypothetical protein CLOSTASPAR_02791 [Clostridium asparagiforme
           DSM 15981]
          Length = 280

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/272 (27%), Positives = 130/272 (47%), Gaps = 30/272 (11%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV--------- 62
           IYD    F  ++    A+  S   +++ FPFI+        L   Q VP+V         
Sbjct: 11  IYD---KFAADEMTVYAAQASFFTIIAAFPFIML------LLTVVQIVPSVSQGELMEFI 61

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
           + +V   +  V  + I+D  L+    PA  + +++A+ A + SS G+ ++   LNR    
Sbjct: 62  LALVPVGYKSVAFRVISDLSLKS---PAT-MISVTAVTALWSSSRGMMSIAKGLNRVQGK 117

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
           VE R + + RLI  GY ++  +  V+   + V       +V + FP +  +   I + R 
Sbjct: 118 VEKRWYIVKRLICAGYTIVFILVCVLSLGLLVFGTTIQNFVLRQFPLIARVTQHIISLR- 176

Query: 183 YATMLAL-FIGLIF--VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF--ST 237
             T+LAL F   +F  ++ ++P  K  + S LPG +FT   W++ ++ F+ Y   F  S 
Sbjct: 177 --TLLALAFFMFVFAGIYTYVPDRKLSLKSQLPGAMFTTAGWILFSMAFSLYFKLFGGSN 234

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
           +S MY  L +I+  +++LY        GAELN
Sbjct: 235 FSYMYGSLTAIVLLMLWLYGCICVLFFGAELN 266


>gi|124007383|ref|ZP_01692090.1| ribonuclease BN [Microscilla marina ATCC 23134]
 gi|123987216|gb|EAY26956.1| ribonuclease BN [Microscilla marina ATCC 23134]
          Length = 370

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 124/280 (44%), Gaps = 39/280 (13%)

Query: 26  AMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI----DVVFGAW----------- 70
             A  I+ S  LS+FP I+F   L  F     FVP ++    D+V               
Sbjct: 52  QQARAIAFSFTLSLFPAIIFLFTLIPF-----FVPYIVTYIPDIVTTGQDIDMKQQIDAL 106

Query: 71  -----PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
                P  I K   D I+ +L  P   L +   L A Y ++NGV  +  + NR Y+  E 
Sbjct: 107 LLEFMPGEIYKYTHDTIVNILTQPRTNLLSFGVLLALYTATNGVIEMMDTFNRNYKFAEK 166

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFF------------PALGNL 173
           R++   RL++ G  +L +  LVI+  V V    A+ +V ++               LG  
Sbjct: 167 RNFLRKRLLAAGLAILFAFILVIVVIVLVVTEFAVEFVLEYLYEWTSWAMLHKDQVLGYY 226

Query: 174 LLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIV 233
           LL  +  +++    A  +G+  ++   PA K +      G I   I  ++    F+ Y+ 
Sbjct: 227 LLTGF--KVFVLFSAFLLGIALIYNLAPARKKEWRFFSLGAISASILAMLSTTGFSFYLS 284

Query: 234 TFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
            F+ Y+ +Y  + +++  + +LY++   F+LG E+N SM+
Sbjct: 285 NFANYNKLYGSIGTLIALMFWLYLIAWVFLLGFEINVSMV 324


>gi|108803594|ref|YP_643531.1| ribonuclease BN [Rubrobacter xylanophilus DSM 9941]
 gi|108764837|gb|ABG03719.1| ribonuclease BN, putative [Rubrobacter xylanophilus DSM 9941]
          Length = 328

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 117/260 (45%), Gaps = 4/260 (1%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           +E    +D   MA+ ++   +L++FPF++   +L G   + +    V+       P+ + 
Sbjct: 45  VEKLQRDDAAGMAAQLAYYLILALFPFMLVLVSLMGTFSSPELAEEVLAYFRQVLPQQVY 104

Query: 76  KPITDEILQVL--AVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
             I      V+    PA GL +   L   + +S    AL  +LN AY V E R ++  R 
Sbjct: 105 ALIATYTGDVIRGEHPAPGLLSFGILLTLWSASGAFNALIKALNAAYEVQETRPFWKVRA 164

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIG 192
           ++ G  L  S  + +   + V  P     + +FF  LG +    WN  R    +L L + 
Sbjct: 165 LAVGMTLGLSGLIFLGVLLMVFGPPIGEAIARFF-GLGTVFEAAWNVARWPVALLFLVVT 223

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
           +  ++   PA       I PG +   + WVV +  F+ Y+  F +Y+  Y  +   +  L
Sbjct: 224 VALIYYLAPAVDQPFRWITPGGLVAVLLWVVASAAFSFYVNNFGSYNKTYGSIGVAIVLL 283

Query: 253 VFLYMLGVFFILGAELNASM 272
           ++LY+  +  + GA LNA++
Sbjct: 284 LYLYISSLTILFGAALNATL 303


>gi|319650226|ref|ZP_08004372.1| hypothetical protein HMPREF1013_00977 [Bacillus sp. 2_A_57_CT2]
 gi|317398057|gb|EFV78749.1| hypothetical protein HMPREF1013_00977 [Bacillus sp. 2_A_57_CT2]
          Length = 300

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/254 (20%), Positives = 112/254 (44%), Gaps = 2/254 (0%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAK 76
           + F ++    +A+  +   +LS+FP ++   ++  +L         +  +    P     
Sbjct: 13  KEFKKDRATGLAAEQAYYYMLSIFPLLILLISIVPYLSLDP--QKALSYLQSVMPSDSFN 70

Query: 77  PITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISF 136
            I D ++ ++  P  GL T   +   + +SNG++A   ++N A+ V E RS+  +RLIS 
Sbjct: 71  VIEDNVVDIITKPNGGLLTFGIIGTLWSASNGMQAFIRAMNDAFDVEETRSFIKSRLISI 130

Query: 137 GYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFV 196
           G  L      +I   + V   + + +V  F      + ++I   R     + +   L  +
Sbjct: 131 GLTLGLLAAFIIAMVLPVFGKVIMNFVENFINIPDGMQILINVLRWAIAFVIMVTVLAIL 190

Query: 197 HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
           +   P        +LPG I   + W + +   + Y+  F  YS  Y  L  ++  +++ +
Sbjct: 191 YKVAPNKHFPFKQVLPGAIAATVMWQLISFGLSFYVSNFGNYSATYGSLGGVIVLMLWFF 250

Query: 257 MLGVFFILGAELNA 270
           + G+  ++G E++A
Sbjct: 251 LTGLALVIGGEISA 264


>gi|229492024|ref|ZP_04385838.1| tRNA processing ribonuclease BN [Rhodococcus erythropolis SK121]
 gi|229321048|gb|EEN86855.1| tRNA processing ribonuclease BN [Rhodococcus erythropolis SK121]
          Length = 516

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 125/266 (46%), Gaps = 5/266 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVIDVVFGA 69
           ++      F  +    +A+ ++  A+LS+FP I+   +L G  G  Q  V  V+ +V   
Sbjct: 33  VLRSTARQFSRDQCTDLAAALTYYAVLSLFPAILAVVSLLGVFGQGQSTVDAVLQIVGAL 92

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSW 128
            P      +   I Q++  PA G   I+ +A A +S++G V A   ++NR Y V E R  
Sbjct: 93  GPSSAVDTLRGPIQQLVQAPAAGFALIAGIAGALWSASGYVGAFGRAMNRMYEVDEGRPV 152

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATML 187
           +  R +    V + ++TL+  +   +AI   +A         G+  L +WN  R    ++
Sbjct: 153 WKLRPVML-LVTIVALTLIGCAAAMLAISGPVARAIGDVIGAGDTALTVWNIARWPVVLV 211

Query: 188 ALFIGLIFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
            + + +  ++   P   + K   I  G     + W++ +V F  Y+  FS+Y+  Y  LA
Sbjct: 212 FVVLAVAILYYATPNIQQPKFRWISGGAALAIVVWILASVGFGFYVANFSSYNKTYGSLA 271

Query: 247 SIMTCLVFLYMLGVFFILGAELNASM 272
             +  L++L++  +  + GAEL++ +
Sbjct: 272 GAIVFLLWLWITNLALLFGAELDSEL 297


>gi|148546571|ref|YP_001266673.1| putative ribonuclease BN [Pseudomonas putida F1]
 gi|148510629|gb|ABQ77489.1| putative ribonuclease BN [Pseudomonas putida F1]
          Length = 318

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 96/196 (48%), Gaps = 6/196 (3%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL ++  + A + +S GV  +  ++N AY V E R  +    +S
Sbjct: 82  NPVIDQLQQS----KGGLLSVGIVIALWTASAGVRLMMSAMNAAYDVPEGRPVWKRIPLS 137

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGLI 194
             Y +  +  L+  + + V  P  + ++      +   ++ +W   R    ++ L + + 
Sbjct: 138 IFYTVGLAGMLLAAAALMVLGPQVMEWIAAQI-GMQEFIVTLWTILRWPVIIILLMVAVA 196

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++  +P  K +   I PG +   + W+V ++ F +Y+ TF+ Y+ MY  + +I+  L++
Sbjct: 197 LIYYVMPDVKQQFRFITPGSVLAVVVWIVASLGFAYYVKTFADYNAMYGSIGAIIVLLLY 256

Query: 255 LYMLGVFFILGAELNA 270
            Y+     +LGAE+NA
Sbjct: 257 FYISAAVLLLGAEMNA 272


>gi|26991244|ref|NP_746669.1| ribonuclease BN, putative [Pseudomonas putida KT2440]
 gi|24986297|gb|AAN70133.1|AE016653_4 ribonuclease BN, putative [Pseudomonas putida KT2440]
          Length = 318

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 96/196 (48%), Gaps = 6/196 (3%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL ++  + A + +S GV  +  ++N AY V E R  +    +S
Sbjct: 82  NPVIDQLQQS----KGGLLSVGIVIALWTASAGVRLMMSAMNAAYDVSEGRPVWKRIPLS 137

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGLI 194
             Y +  +  L+  + + V  P  + ++      +   ++ +W   R    ++ L + + 
Sbjct: 138 IFYTVGLAGMLLAAAALMVLGPQVMEWIAAQI-GMQEFIVTLWTILRWPVIIILLMVAVA 196

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++  +P  K +   I PG +   + W+V ++ F +Y+ TF+ Y+ MY  + +I+  L++
Sbjct: 197 LIYYVMPDVKQQFRFITPGSVLAVVVWIVASLGFAYYVKTFADYNAMYGSIGAIIVLLLY 256

Query: 255 LYMLGVFFILGAELNA 270
            Y+     +LGAE+NA
Sbjct: 257 FYISAAVLLLGAEMNA 272


>gi|326800466|ref|YP_004318285.1| ribonuclease BN [Sphingobacterium sp. 21]
 gi|326551230|gb|ADZ79615.1| ribonuclease BN [Sphingobacterium sp. 21]
          Length = 329

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/263 (22%), Positives = 118/263 (44%), Gaps = 11/263 (4%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA--HQFVPTVIDVVFGAWPEVI 74
           +    E     AS ++ S +L++FP I+F   L  ++      F   +++ +    PE  
Sbjct: 43  QEIARESLLNKASSLAYSFMLAIFPGIIFLFTLIPYIKVFIDDFQEQLLEFMQMILPENA 102

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
            K I   +L ++     GL +   L A  F++NG+ +L  + N++  V+E RS+   RL+
Sbjct: 103 YKTIESTLLDIVTNQNSGLLSFGFLMAMIFATNGIHSLMRAFNKSSLVLESRSFVKQRLV 162

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLI 194
           +    ++  + L I   +       + +++      G      W   I  T   + +G+ 
Sbjct: 163 ALALAIMIIMALTIGMGIVTLASFIINHLKNTIEITGGF----WTWLIGITRWIILLGIY 218

Query: 195 FVHL-----FLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           F  L     + P++  K     PG     +   +    F  YI  F+TY+ +Y  + +++
Sbjct: 219 FFTLSILYKYGPSSSRKWSFFSPGATLATVLAALTFWGFAFYINNFNTYNKLYGSIGTLI 278

Query: 250 TCLVFLYMLGVFFILGAELNASM 272
             +++LY+  +  ++G ELNAS+
Sbjct: 279 VIMIWLYLNSLILLIGFELNASI 301


>gi|229918098|ref|YP_002886744.1| ribonuclease BN [Exiguobacterium sp. AT1b]
 gi|229469527|gb|ACQ71299.1| ribonuclease BN [Exiguobacterium sp. AT1b]
          Length = 317

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/269 (23%), Positives = 123/269 (45%), Gaps = 10/269 (3%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ--FVPTVIDVVFGAWPEVI 74
             F E D     + ++    LS+FP I+F   L  F    Q  F   + D+     P   
Sbjct: 21  RRFQEHDVQDYGATLAFFWFLSIFPGIIFILALLSFFDVSQDSFQNQLNDLA----PGSA 76

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
           A      I + +  P  GL ++ A+ A + ++ GV+ L  +   AY     R++++ + +
Sbjct: 77  ASGFLTGIFEAIGEPRGGLLSLGAILAIWSAAKGVDRLITTSLHAYGEDNERNFFVKKGL 136

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPA--LGNLLLIIWNGRIYATMLALFIG 192
           + G  +L  + ++++    V     +++V ++ P    G   ++I   R   T + L + 
Sbjct: 137 ALGLTILLGIGMLLLILSNVFGSQIISFVTEYLPVNITGAEEMMINVFRYVLTTVVLILT 196

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
           L   +   P       S +PG IF  I W + +  F+ Y+  F +Y + Y  L  I+  L
Sbjct: 197 LSIFYKVSPQQHVFWKSTIPGAIFGVIGWQIVSFGFSLYVSNFGSYDSTYGSLGGIIVTL 256

Query: 253 VFLYMLGVFFILGAELNASMIIYYWRKKP 281
           ++L + G+  ++G+E+NA+ + ++  K P
Sbjct: 257 LWLQLTGMIILIGSEINATWMRFF--KTP 283


>gi|329569816|gb|EGG51575.1| YihY family protein [Enterococcus faecalis TX1467]
          Length = 302

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 115/225 (51%), Gaps = 4/225 (1%)

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           +V+  +  A P+ + K +   I  +L   + GL ++SALAA   +S  + AL+ ++N+A+
Sbjct: 64  SVLPYIAEAIPKDVYKNLEPAIRSLLTQRSGGLLSVSALAAFCSASQSINALQNAMNKAF 123

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
            V + +++ + R++SF  +LL  V +V ++ +       +  ++  F    +++      
Sbjct: 124 GVEQRKNFILVRVVSFLVILLFMVAIVGVAVILGLGQYIIELLQHLFHYSTSVIDTFQAL 183

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           +   T + L + +  ++  +P  K  + SILPG IF+ + W++ + +F  Y+  FS+   
Sbjct: 184 KWPLTTVVLLVIMCLIYAVVPNRKLSLRSILPGAIFSTVGWMLLSQIFGLYVKYFSSRIA 243

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY----YWRKKP 281
            Y  + S +  +++L       ILGA +NA +  Y      +K+P
Sbjct: 244 SYQIIGSFIILMLWLNFAATIIILGAIVNAVVDEYLSGDKEKKQP 288


>gi|284036533|ref|YP_003386463.1| ribonuclease BN [Spirosoma linguale DSM 74]
 gi|283815826|gb|ADB37664.1| ribonuclease BN [Spirosoma linguale DSM 74]
          Length = 318

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 61/272 (22%), Positives = 134/272 (49%), Gaps = 10/272 (3%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           ++   + +    A+ +S S +L+VFP ++F   L  F+    F+P + + + G + EV+ 
Sbjct: 38  LDQITDNNTSERAASVSYSLILAVFPTVIFFFTLIPFI---TFIPNLEEQIMGFFREVLP 94

Query: 76  ----KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
                 +   I  +++ P  G+ +   L A Y +++G+ AL  + N +Y   E R ++  
Sbjct: 95  GNTFSSVDTTIRDIVSRPRSGVLSFGFLLALYSATSGLVALMQAFNSSYHSDERRGFFKV 154

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLI-IWNGRIYATMLALF 190
           RL++ G     +  L++   V +   +   Y+  F   L N L I +     Y  + A+F
Sbjct: 155 RLVAIGLTFTLAFALILAIVVLIIGGIISDYLLHF-GLLNNALFINLLAITRYLVVFAVF 213

Query: 191 IGLIFV-HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           +G + V + + P  + K + I PG +   +  V+  + F++Y+  F +Y+ +Y  + +++
Sbjct: 214 VGTVSVIYRYGPDVRMKWVFITPGAVTASLLIVLTTLGFSYYVSNFGSYNKVYGSIGTLI 273

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
             ++++ ++ +  ILG E+N ++      + P
Sbjct: 274 ALMIWINLISLLLILGFEMNVALYNLEGDRSP 305


>gi|210616176|ref|ZP_03290977.1| hypothetical protein CLONEX_03196 [Clostridium nexile DSM 1787]
 gi|210149905|gb|EEA80914.1| hypothetical protein CLONEX_03196 [Clostridium nexile DSM 1787]
          Length = 273

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 102/209 (48%), Gaps = 3/209 (1%)

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           V+  V+  +P+ I   +   + +V    ++ +  ++AL   + +  GV A+   LN  + 
Sbjct: 56  VMTAVYEVFPKTIRATMISIVNEVYN-QSRAVIPLTALMTMWSAGRGVLAITNGLNCIHE 114

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALA-YVRKFFPALGNLLLIIWNG 180
            +E R++   R+ +  Y +L  + +V +S V +    +++ +V +  P    +   I   
Sbjct: 115 EIETRNYIFLRIRAAFYTVLFIIAIV-LSLVLLGFGNSISMFVNEHVPIFRYVTDFIIEI 173

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R   T+L L +    ++ FLP  K KI    PG +FT   W + + +F+ Y+  F  +S 
Sbjct: 174 RTVTTLLVLIVFSTCIYRFLPNHKGKIKYQFPGAVFTAFGWTLASFIFSVYMDIFKGFSN 233

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELN 269
           MY  L +I+  +++LY      +LG E+N
Sbjct: 234 MYGSLTTIVLIMLWLYFCMYVMLLGGEIN 262


>gi|299143561|ref|ZP_07036641.1| YihY family protein [Peptoniphilus sp. oral taxon 386 str. F0131]
 gi|298518046|gb|EFI41785.1| YihY family protein [Peptoniphilus sp. oral taxon 386 str. F0131]
          Length = 311

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 77/282 (27%), Positives = 142/282 (50%), Gaps = 21/282 (7%)

Query: 1   MREYFCIVFD-IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV 59
           + + + I FD  +Y   EH + E   ++A  +    +LS+FPF++   N+  F     + 
Sbjct: 13  LNKNYVIFFDKFLYRFAEHRIVEISASLAYFL----ILSIFPFLIALLNIINFTN-FLYS 67

Query: 60  PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +I+ +    PE I K   + I ++ +  +  LF+IS L   + +SNG + +  ++N A
Sbjct: 68  DNIIEAL-SYLPEDITKIAMNFIKEIYSGSSGSLFSISVLLGLWSASNGFKKIIKNINLA 126

Query: 120 YRVVEMRSWYITRLIS--FGYVLLASVTLVIMSFVF--VAIPLALAYVRKFFPALGNLLL 175
           Y   E R    T+L+S  F   L+  + L++++ VF    I + + YV      LG  + 
Sbjct: 127 YGFSEKRGILKTKLLSLLFTIALIIMILLLLLTQVFGETIINMLINYV-----GLGEDIT 181

Query: 176 IIWNGRIYAT-MLALFIGLIFVHLFLPAAKS----KIMSILPGVIFTWISWVVGAVLFTH 230
            +W+   +    + +FI  + V+ + P   +    K   ILPG IF+ IS V    LF +
Sbjct: 182 YLWHILSFIIPFIYMFITFLLVYKYSPGTDTRDLLKFSLILPGAIFSTISSVFATNLFGY 241

Query: 231 YIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           Y+  F+ YS  Y  L  I+  L++L+++ +  ++G E+NA++
Sbjct: 242 YVGNFAKYSVTYGSLGGIIILLIWLWLMSMIILMGGEINATL 283


>gi|269125476|ref|YP_003298846.1| ribonuclease BN [Thermomonospora curvata DSM 43183]
 gi|268310434|gb|ACY96808.1| ribonuclease BN [Thermomonospora curvata DSM 43183]
          Length = 445

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 82/271 (30%), Positives = 133/271 (49%), Gaps = 15/271 (5%)

Query: 10  DIIYDAIEHFVEED--GWAMASHISLSALLSVFPFIVFGANLAGFLGA---HQFVPTVID 64
           D++      F E++   WA A  ++  A+LS+FP ++   +L G  GA      +  V D
Sbjct: 140 DLLKRTFREFKEDNLTDWAAA--LTYYAVLSIFPAMLVIISLIGLGGASLSESIIRNVGD 197

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVV 123
           +  GA  +V+A  +T+  LQ  A  A GL  +  L AA +S++G V A   + N  Y + 
Sbjct: 198 LAPGAVRDVLATALTE--LQRGAG-AAGLVAVIGLVAAVWSASGYVAAFMRASNAIYDLP 254

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R  + T  I    V L S+TL+  S + V I   LA        LG+  + +WN   +
Sbjct: 255 EGRPIWKTLPIRIA-VTLVSLTLLSASAIAVVISGPLARKAGDLLGLGDAAVTVWNIAKW 313

Query: 184 ATMLALFIGLIFVHLF--LPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
             +L + I  +F  L+   P AK     + PG +     W++ +V F  Y+  F +Y+  
Sbjct: 314 PVLL-VAIAFLFALLYWASPNAKRGFTWVTPGGLLALAVWLLASVGFAFYVANFGSYNKT 372

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           Y  LA ++  LV+L++  +  +LG ELNA +
Sbjct: 373 YGSLAGVIIFLVWLWISNIALLLGVELNAEL 403


>gi|115525638|ref|YP_782549.1| putative ribonuclease BN [Rhodopseudomonas palustris BisA53]
 gi|115519585|gb|ABJ07569.1| putative ribonuclease BN [Rhodopseudomonas palustris BisA53]
          Length = 370

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 69/272 (25%), Positives = 130/272 (47%), Gaps = 18/272 (6%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DII+   E   ++   A+A+ +    LL++FP I    +    +   Q +   +  + G 
Sbjct: 76  DIIWRTYEQINDDRLLAVAAGVVFYGLLALFPAITALVSSYALVADPQTIRDHLSFLAGV 135

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISA-----LAAAYFSSNG-VEALRISLNRAYRVV 123
            P      + D+I +VLA   KG   + A      A A +S+NG ++A+  +LN  Y   
Sbjct: 136 LPAGTFSVVEDQIARVLA---KGEVKLGAAFLFSFALALWSANGGMKAIIDALNVVYDEE 192

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R +     +S  + L   + ++    + VA P+ L+ V      +G+LLL    GR  
Sbjct: 193 EKRGFIKLNAVSLAFTLGGLLAVLAAIGLVVAAPILLSMV--GLGTIGDLLLRF--GRWP 248

Query: 184 ATMLALFIGLIFVHLFLPAAKS---KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           A  + +  GL  ++ F P+ +S   K +S+  G +   + W+VG+   ++Y+  +  Y  
Sbjct: 249 ALAVMILAGLAVLYRFAPSRRSPQWKWISV--GSVSATVIWLVGSAALSYYLANYGAYDA 306

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
            Y  L + +  +++++M  +  +LGAELN+ +
Sbjct: 307 TYGSLGAAIGLMIWMWMSTIVVLLGAELNSEI 338


>gi|325277884|ref|ZP_08143430.1| ribonuclease BN [Pseudomonas sp. TJI-51]
 gi|324096987|gb|EGB95287.1| ribonuclease BN [Pseudomonas sp. TJI-51]
          Length = 319

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 95/196 (48%), Gaps = 6/196 (3%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL ++  + A + +S GV  +  ++N AY V E R  +    +S
Sbjct: 82  NPVIDQLQQS----KGGLLSVGIVIALWTASAGVRLMMSAMNAAYDVPEGRPVWKRIPLS 137

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLI 194
             Y +  +  L+  + + V  P  + ++      +   ++ +W   R    +  L + + 
Sbjct: 138 IFYTVGLAGMLLAAAALMVLGPQVMEWIAAQI-GMQEFIVTLWTVLRWPVIVFLLMVAVA 196

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++  +P  K K   I PG +   + W++ ++ F +Y+ TF+ Y+ MY  + +I+  L++
Sbjct: 197 LIYYVMPDVKQKFRFITPGSVLAVVVWIIASLGFAYYVKTFADYNAMYGSIGAIIVLLLY 256

Query: 255 LYMLGVFFILGAELNA 270
            Y+     +LGAE+NA
Sbjct: 257 FYISAAVLLLGAEMNA 272


>gi|88803358|ref|ZP_01118884.1| Ribonuclease BN [Polaribacter irgensii 23-P]
 gi|88780924|gb|EAR12103.1| Ribonuclease BN [Polaribacter irgensii 23-P]
          Length = 313

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/283 (23%), Positives = 135/283 (47%), Gaps = 25/283 (8%)

Query: 12  IYDAIEHF----VEEDGWAMASHISLSALLSVFPFIVFGANLAGFL---GAHQFVPTVID 64
           +YD +E +    VE      A  I+ S  +++FPF++F   L  FL   GA + + ++I 
Sbjct: 35  LYDILEMYFIGIVEGALSTRAGGIAYSFFMAIFPFLLFVLTLIPFLPIEGAQEGLLSIIS 94

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
            V    P      +   +L ++     GL +   + + +  SNGV A+      +Y + E
Sbjct: 95  DVL---PPKTFDAVHAVLLDIIKNQYGGLLSFGFIGSIFLMSNGVNAIFGGFEYSYHIKE 151

Query: 125 MRSWYITRLISF------GYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL-LII 177
            R+ +    I+          ++ ++TL+I   +F+   ++L ++        NL+ L +
Sbjct: 152 ARNIFKAYFIAMLVSVVIVIFVIVAITLIIFFDLFLLDMVSLGWLND------NLIWLQL 205

Query: 178 WNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
             G I+  ML L + +++ +      +S   S  PG +FT I  ++   LF +Y+  F+ 
Sbjct: 206 GRGLIFLIMLHLTVSMLYHYGVKEGKQSGFFS--PGAVFTTILSILTFYLFGYYVTEFAK 263

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           Y+ +Y  + +++  ++F+++  +  +LG ELNA++     R K
Sbjct: 264 YNELYGSIGTLLILMLFIWLNAIILLLGFELNAAIYALRGRNK 306


>gi|291522420|emb|CBK80713.1| Predicted membrane protein [Coprococcus catus GD/7]
          Length = 282

 Score = 66.6 bits (161), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 112/257 (43%), Gaps = 18/257 (7%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           E+   A AS  +   +LS FPF +F       L   ++ P   + +      +  K   D
Sbjct: 17  EDHLGAYASQAAFFIVLSAFPFCIF------LLTLLRYSPLTYEDLLNILQMLSPKMAND 70

Query: 81  EILQVLAVPAKGLFTISALAAAYFS--------SNGVEALRISLNRAYRVVEMRSWYITR 132
            I  V+    K ++  S +A   F+          G+ ++   +N  Y + E R+++  R
Sbjct: 71  VIRLVM----KEVYEQSTIAITSFTIIFVLWSAGRGILSITRGINEIYHINETRNYFYIR 126

Query: 133 LISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIG 192
            IS  Y L  +V L++   + V   +    V K  P L      + + R+      L + 
Sbjct: 127 FISAVYTLWLAVALIVTLGLLVFGNVFYRKVIKLLPVLHEFAAFVISIRMLIIFGLLTMF 186

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
            IFV+  LP  K+ ++ +LPG I   I W++ + +F  Y     ++  MY  LA IM  +
Sbjct: 187 FIFVYKVLPNKKTPLLYVLPGAISCSIGWMITSSIFAIYFNYSHSFIYMYGSLAGIMMIM 246

Query: 253 VFLYMLGVFFILGAELN 269
           ++LY       LGAELN
Sbjct: 247 LWLYTCMYQLFLGAELN 263


>gi|307303461|ref|ZP_07583215.1| ribonuclease BN [Sinorhizobium meliloti BL225C]
 gi|306902852|gb|EFN33444.1| ribonuclease BN [Sinorhizobium meliloti BL225C]
          Length = 328

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 61/267 (22%), Positives = 125/267 (46%), Gaps = 10/267 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D+ +  +    E+    +A+ ++   LLSVFP +    ++ G +     +     ++   
Sbjct: 36  DVFWRVVSQISEDRISLIAAGVTFYVLLSVFPALASLVSIYGLVSDPATIAEQATLLAAV 95

Query: 70  WPEVIAKPITDEILQVLAVPAKGL---FTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P    + +TD++  + +     L   F    L A + + NGV AL  ++N AY   E R
Sbjct: 96  LPAQSLQMMTDQLETLSSQKTSSLSFGFIAGLLFALWSARNGVGALFEAMNIAYDETEKR 155

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+    L+S G+ L   +   ++      +P  LA++      L  L  + W       +
Sbjct: 156 SFIRLTLLSIGFTLAGLILTAVLIAAIAVLPAVLAFLHLELEGL--LRFVRWP----VML 209

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILP-GVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           L +  G+  ++ + P+ +   +S L  G   + I W+V ++ F++YI  F+ Y+  Y  L
Sbjct: 210 LLIAAGITLIYRYGPSREPAKLSWLTWGAALSTICWLVASLAFSYYIDNFANYNATYGAL 269

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASM 272
            +++  ++++++  +  I+GAELNA +
Sbjct: 270 GALIGFMLWIWISTMIVIIGAELNAEL 296


>gi|260662842|ref|ZP_05863736.1| ribonuclease BN [Lactobacillus fermentum 28-3-CHN]
 gi|260552923|gb|EEX25922.1| ribonuclease BN [Lactobacillus fermentum 28-3-CHN]
          Length = 299

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 69/258 (26%), Positives = 128/258 (49%), Gaps = 8/258 (3%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAK 76
           EHF        A+ ++   LLS+FP ++   NL   LG      TV+  +  A P  + +
Sbjct: 18  EHFQMAQVTTSAAVLAYYTLLSIFPAVLVVGNLLPMLGLD--AKTVLPYLQSAIPSSVYQ 75

Query: 77  PITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISF 136
            I   I   L   + G+ T  AL A + +S G+ A + S+N AY V + ++  I R++SF
Sbjct: 76  FIRPIIFDFLRRGSGGILTTGALVALWSTSQGIAAFQRSVNGAYGVAKNQNPIINRVLSF 135

Query: 137 GYVLLASV---TLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGL 193
            ++++  +    LVIM  +   +  AL  +  F P   N + +  + R   T   LFI L
Sbjct: 136 IWMIIVIMIIFALVIMYGLGEQVLEALQPILHF-PI--NYVTLFSSLRWPVTFGGLFIFL 192

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++ F+P A+ ++  ++ G +   + W+  + LF++Y V F+     Y  + + +  ++
Sbjct: 193 TLLYYFVPNARVRLRYVVIGALVATLLWMGLSRLFSYYAVVFAQRLNSYKTIGAFILMMM 252

Query: 254 FLYMLGVFFILGAELNAS 271
           +L   G+  ++GA +NA+
Sbjct: 253 WLDFSGMIVMIGAIVNAT 270


>gi|319948212|ref|ZP_08022371.1| TRNA processing ribonuclease BN [Dietzia cinnamea P4]
 gi|319438147|gb|EFV93108.1| TRNA processing ribonuclease BN [Dietzia cinnamea P4]
          Length = 357

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 70/266 (26%), Positives = 126/266 (47%), Gaps = 7/266 (2%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVIDVVFGAW 70
           I  A+  F  +    +A+ ++  A+LS+FP ++   +L G  G  Q  V  V++++ GA 
Sbjct: 38  IKRALSEFSRDKCTDLAASLTYFAVLSLFPALLAVVSLLGVFGQGQATVDAVMELLEGAA 97

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRS-W 128
           PE     +   I  V+  PA G+  I+ LA A +S++G V A   ++NR Y + E R  W
Sbjct: 98  PEETLAALRGPIESVVNTPAAGIALITGLAGALWSASGYVGAFGRAMNRIYEIEEGRPFW 157

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATML 187
            +  +      +L  +  +    + V+ P+A  +       LG   + +W   +    +L
Sbjct: 158 KLKPVTVLLTAVLLLLVCLAGLILVVSGPIA-EWAGNLI-GLGETAVTVWGIAKWPVLVL 215

Query: 188 ALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
            + + L  ++ F P  K  K   I  G +   I W V    F  Y+  FS+Y+  Y  LA
Sbjct: 216 VVVVILAVLYGFAPNVKQPKFRWISIGAVIALIVWAVATGGFVFYVTNFSSYNATYGSLA 275

Query: 247 SIMTCLVFLYMLGVFFILGAELNASM 272
            ++  L++L++     + GAE++A +
Sbjct: 276 GVIIFLLWLWITNNALLFGAEVDAEV 301


>gi|256961436|ref|ZP_05565607.1| ribonuclease BN [Enterococcus faecalis Merz96]
 gi|257084723|ref|ZP_05579084.1| ribonuclease BN [Enterococcus faecalis Fly1]
 gi|256951932|gb|EEU68564.1| ribonuclease BN [Enterococcus faecalis Merz96]
 gi|256992753|gb|EEU80055.1| ribonuclease BN [Enterococcus faecalis Fly1]
          Length = 304

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 109/210 (51%)

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           +V+  +  A P+ + K +   I  +L   + GL ++SALAA + +S  + AL+ ++N+A+
Sbjct: 65  SVLPYIAEAIPKDVYKNLEPAIRSLLTQRSGGLLSVSALAAFWSASQSINALQNAMNKAF 124

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
            V + +++ + R++SF  +LL  V +V +  +       +  ++  F    +++      
Sbjct: 125 GVEQRKNFILVRVVSFLVILLFMVAIVGVVVILGLGQYIIELLQPIFHYSTSVIDTFQAL 184

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           +   T + L + +  ++  +P  K  + SILPG IF+ + W++ + +F  Y+  FS+   
Sbjct: 185 KWPLTTVVLLVIMCLIYAVVPNRKLSLRSILPGAIFSTVGWMLLSQIFGLYVKYFSSRIA 244

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNA 270
            Y  + S +  +++L       ILGA +NA
Sbjct: 245 SYQIIGSFIILMLWLNFAATIIILGAIVNA 274


>gi|3608389|gb|AAC35915.1| Orfde2 [Enterococcus faecalis OG1RF]
          Length = 302

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 109/210 (51%)

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           +V+  +  A P+ + K +   I  +L   + GL ++SALAA + +S  + AL+ ++N+A+
Sbjct: 64  SVLPYIAEAIPKDVYKNLEPAIRSLLTQRSGGLLSVSALAAFWSASQSINALQNAMNKAF 123

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
            V + +++ + R++SF  +LL  V +V +  +       +  ++  F    +++      
Sbjct: 124 GVEQRKNFILVRVVSFLVILLFMVAIVGVVVILGLGQYIIELLQPIFHYSTSVIDTFQAL 183

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           +   T + L + +  ++  +P  K  + SILPG IF+ + W++ + +F  Y+  FS+   
Sbjct: 184 KWPLTTVVLLVIMCLIYAVVPNRKLSLRSILPGAIFSTVGWMLLSQIFGLYVKYFSSRIA 243

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNA 270
            Y  + S +  +++L       ILGA +NA
Sbjct: 244 SYQIIGSFIILMLWLNFAATIIILGAIVNA 273


>gi|255972225|ref|ZP_05422811.1| ribonuclease BN [Enterococcus faecalis T1]
 gi|255975337|ref|ZP_05425923.1| ribonuclease BN [Enterococcus faecalis T2]
 gi|256617227|ref|ZP_05474073.1| ribonuclease BN [Enterococcus faecalis ATCC 4200]
 gi|256763001|ref|ZP_05503581.1| ribonuclease BN [Enterococcus faecalis T3]
 gi|256853649|ref|ZP_05559014.1| conserved hypothetical protein [Enterococcus faecalis T8]
 gi|256956586|ref|ZP_05560757.1| ribonuclease BN [Enterococcus faecalis DS5]
 gi|256963474|ref|ZP_05567645.1| ribonuclease BN [Enterococcus faecalis HIP11704]
 gi|257079512|ref|ZP_05573873.1| ribonuclease BN [Enterococcus faecalis JH1]
 gi|257082108|ref|ZP_05576469.1| ribonuclease BN [Enterococcus faecalis E1Sol]
 gi|257087331|ref|ZP_05581692.1| ribonuclease BN [Enterococcus faecalis D6]
 gi|257090465|ref|ZP_05584826.1| ribonuclease BN [Enterococcus faecalis CH188]
 gi|257416512|ref|ZP_05593506.1| ribonuclease BN [Enterococcus faecalis AR01/DG]
 gi|257419753|ref|ZP_05596747.1| ribonuclease BN [Enterococcus faecalis T11]
 gi|257422087|ref|ZP_05599077.1| ribonuclease BN [Enterococcus faecalis X98]
 gi|255963243|gb|EET95719.1| ribonuclease BN [Enterococcus faecalis T1]
 gi|255968209|gb|EET98831.1| ribonuclease BN [Enterococcus faecalis T2]
 gi|256596754|gb|EEU15930.1| ribonuclease BN [Enterococcus faecalis ATCC 4200]
 gi|256684252|gb|EEU23947.1| ribonuclease BN [Enterococcus faecalis T3]
 gi|256710592|gb|EEU25635.1| conserved hypothetical protein [Enterococcus faecalis T8]
 gi|256947082|gb|EEU63714.1| ribonuclease BN [Enterococcus faecalis DS5]
 gi|256953970|gb|EEU70602.1| ribonuclease BN [Enterococcus faecalis HIP11704]
 gi|256987542|gb|EEU74844.1| ribonuclease BN [Enterococcus faecalis JH1]
 gi|256990138|gb|EEU77440.1| ribonuclease BN [Enterococcus faecalis E1Sol]
 gi|256995361|gb|EEU82663.1| ribonuclease BN [Enterococcus faecalis D6]
 gi|256999277|gb|EEU85797.1| ribonuclease BN [Enterococcus faecalis CH188]
 gi|257158340|gb|EEU88300.1| ribonuclease BN [Enterococcus faecalis ARO1/DG]
 gi|257161581|gb|EEU91541.1| ribonuclease BN [Enterococcus faecalis T11]
 gi|257163911|gb|EEU93871.1| ribonuclease BN [Enterococcus faecalis X98]
          Length = 303

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 109/210 (51%)

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           +V+  +  A P+ + K +   I  +L   + GL ++SALAA + +S  + AL+ ++N+A+
Sbjct: 65  SVLPYIAEAIPKDVYKNLEPAIRSLLTQRSGGLLSVSALAAFWSASQSINALQNAMNKAF 124

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
            V + +++ + R++SF  +LL  V +V +  +       +  ++  F    +++      
Sbjct: 125 GVEQRKNFILVRVVSFLVILLFMVAIVGVVVILGLGQYIIELLQPIFHYSTSVIDTFQAL 184

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           +   T + L + +  ++  +P  K  + SILPG IF+ + W++ + +F  Y+  FS+   
Sbjct: 185 KWPLTTVVLLVIMCLIYAVVPNRKLSLRSILPGAIFSTVGWMLLSQIFGLYVKYFSSRIA 244

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNA 270
            Y  + S +  +++L       ILGA +NA
Sbjct: 245 SYQIIGSFIILMLWLNFAATIIILGAIVNA 274


>gi|229545287|ref|ZP_04434012.1| ribonuclease BN [Enterococcus faecalis TX1322]
 gi|293382826|ref|ZP_06628747.1| YihY family protein [Enterococcus faecalis R712]
 gi|293387965|ref|ZP_06632498.1| YihY family protein [Enterococcus faecalis S613]
 gi|312901455|ref|ZP_07760730.1| YihY family protein [Enterococcus faecalis TX0470]
 gi|312905909|ref|ZP_07764923.1| YihY family protein [Enterococcus faecalis DAPTO 512]
 gi|312908943|ref|ZP_07767806.1| YihY family protein [Enterococcus faecalis DAPTO 516]
 gi|229309637|gb|EEN75624.1| ribonuclease BN [Enterococcus faecalis TX1322]
 gi|291079817|gb|EFE17181.1| YihY family protein [Enterococcus faecalis R712]
 gi|291082621|gb|EFE19584.1| YihY family protein [Enterococcus faecalis S613]
 gi|310628076|gb|EFQ11359.1| YihY family protein [Enterococcus faecalis DAPTO 512]
 gi|311290727|gb|EFQ69283.1| YihY family protein [Enterococcus faecalis DAPTO 516]
 gi|311291444|gb|EFQ70000.1| YihY family protein [Enterococcus faecalis TX0470]
 gi|315161842|gb|EFU05859.1| YihY family protein [Enterococcus faecalis TX0645]
 gi|315173054|gb|EFU17071.1| YihY family protein [Enterococcus faecalis TX1346]
          Length = 303

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 109/210 (51%)

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           +V+  +  A P+ + K +   I  +L   + GL ++SALAA + +S  + AL+ ++N+A+
Sbjct: 64  SVLPYIAEAIPKDVYKNLEPAIRSLLTQRSGGLLSVSALAAFWSASQSINALQNAMNKAF 123

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
            V + +++ + R++SF  +LL  V +V +  +       +  ++  F    +++      
Sbjct: 124 GVEQRKNFILVRVVSFLVILLFMVAIVGVVVILGLGQYIIELLQPIFHYSTSVIDTFQAL 183

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           +   T + L + +  ++  +P  K  + SILPG IF+ + W++ + +F  Y+  FS+   
Sbjct: 184 KWPLTTVVLLVIMCLIYAVVPNRKLSLRSILPGAIFSTVGWMLLSQIFGLYVKYFSSRIA 243

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNA 270
            Y  + S +  +++L       ILGA +NA
Sbjct: 244 SYQIIGSFIILMLWLNFAATIIILGAIVNA 273


>gi|29376707|ref|NP_815861.1| ribonuclease BN, putative [Enterococcus faecalis V583]
 gi|227520254|ref|ZP_03950303.1| ribonuclease BN [Enterococcus faecalis TX0104]
 gi|227555312|ref|ZP_03985359.1| ribonuclease BN [Enterococcus faecalis HH22]
 gi|229549522|ref|ZP_04438247.1| ribonuclease BN [Enterococcus faecalis ATCC 29200]
 gi|294779051|ref|ZP_06744464.1| YihY family protein [Enterococcus faecalis PC1.1]
 gi|300861102|ref|ZP_07107189.1| YihY family protein [Enterococcus faecalis TUSoD Ef11]
 gi|307270373|ref|ZP_07551678.1| YihY family protein [Enterococcus faecalis TX4248]
 gi|307272381|ref|ZP_07553637.1| YihY family protein [Enterococcus faecalis TX0855]
 gi|307277271|ref|ZP_07558375.1| YihY family protein [Enterococcus faecalis TX2134]
 gi|307281885|ref|ZP_07562100.1| YihY family protein [Enterococcus faecalis TX0860]
 gi|307292424|ref|ZP_07572280.1| YihY family protein [Enterococcus faecalis TX0411]
 gi|312903787|ref|ZP_07762960.1| YihY family protein [Enterococcus faecalis TX0635]
 gi|312953341|ref|ZP_07772183.1| YihY family protein [Enterococcus faecalis TX0102]
 gi|29344171|gb|AAO81931.1| ribonuclease BN, putative [Enterococcus faecalis V583]
 gi|227072333|gb|EEI10296.1| ribonuclease BN [Enterococcus faecalis TX0104]
 gi|227175523|gb|EEI56495.1| ribonuclease BN [Enterococcus faecalis HH22]
 gi|229305340|gb|EEN71336.1| ribonuclease BN [Enterococcus faecalis ATCC 29200]
 gi|294453881|gb|EFG22270.1| YihY family protein [Enterococcus faecalis PC1.1]
 gi|295113362|emb|CBL31999.1| Predicted membrane protein [Enterococcus sp. 7L76]
 gi|300850141|gb|EFK77891.1| YihY family protein [Enterococcus faecalis TUSoD Ef11]
 gi|306496553|gb|EFM66114.1| YihY family protein [Enterococcus faecalis TX0411]
 gi|306503839|gb|EFM73061.1| YihY family protein [Enterococcus faecalis TX0860]
 gi|306506201|gb|EFM75367.1| YihY family protein [Enterococcus faecalis TX2134]
 gi|306510935|gb|EFM79949.1| YihY family protein [Enterococcus faecalis TX0855]
 gi|306513281|gb|EFM81908.1| YihY family protein [Enterococcus faecalis TX4248]
 gi|310628729|gb|EFQ12012.1| YihY family protein [Enterococcus faecalis TX0102]
 gi|310632861|gb|EFQ16144.1| YihY family protein [Enterococcus faecalis TX0635]
 gi|315025881|gb|EFT37813.1| YihY family protein [Enterococcus faecalis TX2137]
 gi|315028196|gb|EFT40128.1| YihY family protein [Enterococcus faecalis TX4000]
 gi|315035714|gb|EFT47646.1| YihY family protein [Enterococcus faecalis TX0027]
 gi|315146132|gb|EFT90148.1| YihY family protein [Enterococcus faecalis TX2141]
 gi|315146331|gb|EFT90347.1| YihY family protein [Enterococcus faecalis TX4244]
 gi|315154461|gb|EFT98477.1| YihY family protein [Enterococcus faecalis TX0031]
 gi|315157121|gb|EFU01138.1| YihY family protein [Enterococcus faecalis TX0043]
 gi|315160169|gb|EFU04186.1| YihY family protein [Enterococcus faecalis TX0312]
 gi|315164314|gb|EFU08331.1| YihY family protein [Enterococcus faecalis TX1302]
 gi|315166495|gb|EFU10512.1| YihY family protein [Enterococcus faecalis TX1341]
 gi|315171501|gb|EFU15518.1| YihY family protein [Enterococcus faecalis TX1342]
 gi|315575186|gb|EFU87377.1| YihY family protein [Enterococcus faecalis TX0309B]
 gi|315578172|gb|EFU90363.1| YihY family protein [Enterococcus faecalis TX0630]
 gi|315582613|gb|EFU94804.1| YihY family protein [Enterococcus faecalis TX0309A]
 gi|323481264|gb|ADX80703.1| ribonuclease BN [Enterococcus faecalis 62]
 gi|327535592|gb|AEA94426.1| YihY family protein [Enterococcus faecalis OG1RF]
          Length = 302

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 109/210 (51%)

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           +V+  +  A P+ + K +   I  +L   + GL ++SALAA + +S  + AL+ ++N+A+
Sbjct: 64  SVLPYIAEAIPKDVYKNLEPAIRSLLTQRSGGLLSVSALAAFWSASQSINALQNAMNKAF 123

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
            V + +++ + R++SF  +LL  V +V +  +       +  ++  F    +++      
Sbjct: 124 GVEQRKNFILVRVVSFLVILLFMVAIVGVVVILGLGQYIIELLQPIFHYSTSVIDTFQAL 183

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           +   T + L + +  ++  +P  K  + SILPG IF+ + W++ + +F  Y+  FS+   
Sbjct: 184 KWPLTTVVLLVIMCLIYAVVPNRKLSLRSILPGAIFSTVGWMLLSQIFGLYVKYFSSRIA 243

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNA 270
            Y  + S +  +++L       ILGA +NA
Sbjct: 244 SYQIIGSFIILMLWLNFAATIIILGAIVNA 273


>gi|299783492|gb|ADJ41490.1| Ribonuclease BN [Lactobacillus fermentum CECT 5716]
          Length = 298

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 69/258 (26%), Positives = 128/258 (49%), Gaps = 8/258 (3%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAK 76
           EHF        A+ ++   LLS+FP ++   NL   LG      TV+  +  A P  + +
Sbjct: 17  EHFQMAQVTTSAAVLAYYTLLSIFPAVLVVGNLLPMLGLD--AKTVLPYLQSAIPSSVYQ 74

Query: 77  PITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISF 136
            I   I   L   + G+ T  AL A + +S G+ A + S+N AY V + ++  I R++SF
Sbjct: 75  FIRPIIFDFLRRGSGGILTTGALVALWSTSQGIAAFQRSVNGAYGVAKNQNPIINRVLSF 134

Query: 137 GYVLLASV---TLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGL 193
            ++++  +    LVIM  +   +  AL  +  F P   N + +  + R   T   LFI L
Sbjct: 135 IWMIIVIMIIFALVIMYGLGEQVLEALQPILHF-PI--NYVTLFSSLRWPVTFGGLFIFL 191

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++ F+P A+ ++  ++ G +   + W+  + LF++Y V F+     Y  + + +  ++
Sbjct: 192 TLLYYFVPNARVRLRYVVIGALVATLLWMGLSRLFSYYAVVFAQRLNSYKTIGAFILMMM 251

Query: 254 FLYMLGVFFILGAELNAS 271
           +L   G+  ++GA +NA+
Sbjct: 252 WLDFSGMIVMIGAIVNAT 269


>gi|114705037|ref|ZP_01437945.1| Ribonuclease BN family protein [Fulvimarina pelagi HTCC2506]
 gi|114539822|gb|EAU42942.1| Ribonuclease BN family protein [Fulvimarina pelagi HTCC2506]
          Length = 321

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 131/268 (48%), Gaps = 10/268 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D++    + F E     +A+ I+   LL++FP I     + G +   Q +   +  + G 
Sbjct: 25  DVLMRVKDRFDEHSVTLVAAGITFYILLALFPAITALVAIYGLVADPQTIQAQLSNLEGI 84

Query: 70  WPEVIAKPITDEILQVLAVPAKGL---FTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P      I  ++ ++ +     L   F +S L + Y S+ GV+AL  ++N AY+  + R
Sbjct: 85  VPAGALGIIHSQLERLTSQTESSLSIAFAVSILLSIYSSTKGVKALFKAMNIAYQEKDER 144

Query: 127 SWYITRLISFGYVLLASVTLVIMSFV-FVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
            +    LIS  +V+ AS+ LVI++ V  V IP  L+ +    PA   +L+++    + A 
Sbjct: 145 GFIKQNLISMAFVV-ASIVLVILAIVTLVVIPSVLSLLP--LPAGVTILVLVVPPLVLAL 201

Query: 186 MLALFIGLIFVHLFLPAAKSKIMS-ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
           +   +I  +F   F P  +S     + PG + T + WV+ ++ F+ Y      +   Y  
Sbjct: 202 LAMAWIAGLF--RFGPHRRSPTFKWLTPGAVLTILGWVIASIAFSFYASNVKNFDATYGS 259

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASM 272
           +ASI+  L++ +++ +  + GAELNA +
Sbjct: 260 MASIIVFLMWTWIMMIILLAGAELNAQL 287


>gi|315033446|gb|EFT45378.1| YihY family protein [Enterococcus faecalis TX0017]
          Length = 302

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 109/210 (51%)

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           +V+  +  A P+ + K +   I  +L   + GL ++SALAA + +S  + AL+ ++N+A+
Sbjct: 64  SVLPYIAEAIPKDVYKNLEPAIRSLLTQRSGGLLSVSALAAFWSASQSINALQNAMNKAF 123

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
            V + +++ + R++SF  +LL  V +V +  +       +  ++  F    +++      
Sbjct: 124 GVEQRKNFILVRVVSFLVILLFMVAIVGVVVILGLGQYIIELLQPIFHYSTSVIDTFQAL 183

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           +   T + L + +  ++  +P  K  + SILPG IF+ + W++ + +F  Y+  FS+   
Sbjct: 184 KWPLTTVVLLVIMCLIYAVVPNRKLSLRSILPGAIFSTVGWMLLSQIFGLYVKYFSSRIA 243

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNA 270
            Y  + S +  +++L       ILGA +NA
Sbjct: 244 SYQIIGSFIILMLWLNFAATIIILGAIVNA 273


>gi|282881919|ref|ZP_06290564.1| T-RNA-processing ribonuclease BN [Peptoniphilus lacrimalis 315-B]
 gi|281298194|gb|EFA90645.1| T-RNA-processing ribonuclease BN [Peptoniphilus lacrimalis 315-B]
          Length = 299

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 64/267 (23%), Positives = 137/267 (51%), Gaps = 15/267 (5%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           E D  +  + ++   +LS+FPF++   N+  FL     V  +++++   +P  + + + +
Sbjct: 26  ENDITSYGAGLAFFLILSIFPFLIALINIVNFLDIIN-VDNILNLM-QYFPNSVKEIVKN 83

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS--FGY 138
             +++    +  L +IS LA  + +S+ +  L   +N +Y   + R++++ R+++  F  
Sbjct: 84  FFIELNITSSTELLSISVLAGLFSASSAINKLIKFINNSYGFEDNRNFFLNRVLAIIFTL 143

Query: 139 VLLASVTLVIMSFVFVAIPLALAYVRKFF--PALGNLLLIIWNGRIYATMLALFIGLIFV 196
           + +  + L+I+S VF  I +   ++  F     +   L II N  I   ++ LF+    V
Sbjct: 144 LFIFMILLLIVSQVFGKI-IFYKFISIFHIDSKIIYFLWIIANSLI--PLIYLFLTFSAV 200

Query: 197 HLFLPA----AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
           + F P      K K  +++PG +F+  + ++  V+F  Y+  F  YS  Y  L  I+  L
Sbjct: 201 YRFAPCPPKNDKIKYKTVIPGSLFSTFAVIIATVIFAFYVNNFGKYSITYGSLGGIIVFL 260

Query: 253 VFLYMLGVFFILGAELNASMIIYYWRK 279
           ++L++L    ++GAE+N  +++Y  +K
Sbjct: 261 IWLFLLSTLILIGAEIN--IVLYSLKK 285


>gi|227513933|ref|ZP_03943982.1| ribonuclease BN [Lactobacillus fermentum ATCC 14931]
 gi|227087692|gb|EEI23004.1| ribonuclease BN [Lactobacillus fermentum ATCC 14931]
          Length = 308

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 69/258 (26%), Positives = 128/258 (49%), Gaps = 8/258 (3%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAK 76
           EHF        A+ ++   LLS+FP ++   NL   LG      TV+  +  A P  + +
Sbjct: 27  EHFQMAQVTTSAAVLAYYTLLSIFPAVLVVGNLLPMLGLD--AKTVLPYLQSAIPSSVYQ 84

Query: 77  PITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISF 136
            I   I   L   + G+ T  AL A + +S G+ A + S+N AY V + ++  I R++SF
Sbjct: 85  FIRPIIFDFLRRGSGGILTTGALVALWSTSQGIAAFQRSVNGAYGVAKNQNPIINRVLSF 144

Query: 137 GYVLLASV---TLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGL 193
            ++++  +    LVIM  +   +  AL  +  F P   N + +  + R   T   LFI L
Sbjct: 145 IWMIIVIMIIFALVIMYGLGEQVLEALQPILHF-PI--NYVTLFSSLRWPVTFGGLFIFL 201

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++ F+P A+ ++  ++ G +   + W+  + LF++Y V F+     Y  + + +  ++
Sbjct: 202 TLLYYFVPNARVRLRYVVIGALVATLLWMGLSRLFSYYAVVFAQRLNSYKTIGAFILMMM 261

Query: 254 FLYMLGVFFILGAELNAS 271
           +L   G+  ++GA +NA+
Sbjct: 262 WLDFSGMIVMIGAIVNAT 279


>gi|225569108|ref|ZP_03778133.1| hypothetical protein CLOHYLEM_05188 [Clostridium hylemonae DSM
           15053]
 gi|225161907|gb|EEG74526.1| hypothetical protein CLOHYLEM_05188 [Clostridium hylemonae DSM
           15053]
          Length = 283

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 104/220 (47%), Gaps = 5/220 (2%)

Query: 57  QFVP----TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEAL 112
           Q+ P     V+  V   +P  +   IT  + QV    + G+  ++ + A + +  GV A+
Sbjct: 50  QYTPVTKADVMTAVIRVFPSSVDSLITSIVNQVYN-QSSGIIPVTVIVALWSAGKGVLAM 108

Query: 113 RISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGN 172
              LN  Y   E R++ + R+ +  Y ++  + ++ +  + V       ++ +  P L  
Sbjct: 109 TGGLNCVYNCRETRNYLVLRIRATLYTVMFILVIIFLLVLSVFGNTLNIFIAEHIPILSG 168

Query: 173 LLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYI 232
           L   +   R+Y   + L +  + ++ FLP  K  +   +PG +F  I W++ + +F+ Y+
Sbjct: 169 LADWLIRTRVYIMPVVLVVFSLLIYKFLPNRKDSLKKQIPGAVFAAIGWMIVSWIFSVYV 228

Query: 233 VTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
             F  +S MY  L +I+  ++++Y      +LG E+N  M
Sbjct: 229 DIFKGFSDMYGSLTTIVLIMLWMYFCMYSILLGGEINILM 268


>gi|169825899|ref|YP_001696057.1| transport protein [Lysinibacillus sphaericus C3-41]
 gi|168990387|gb|ACA37927.1| possible transport protein [Lysinibacillus sphaericus C3-41]
          Length = 305

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 107/208 (51%), Gaps = 11/208 (5%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+ + K I + + ++L      L +I  L   + +S G+ AL  +LN+AY   E R+  +
Sbjct: 92  PDEVYKLIENTLNEILTNRNSSLLSIGVLGTIWSASKGINALIRALNKAYDT-EGRAGIL 150

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKF-FPALG--NLLLIIW-NGRIYATM 186
            R    G  L+ +V LV++  V + +P+    +  F F  +G       +W N R     
Sbjct: 151 DR----GLSLVFTVALVVVMAVALLLPVFGQQIGHFLFSIVGIEEQFESVWHNLRWSIPP 206

Query: 187 LALFIGLIFVHLFLP--AAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
           + +FI L+ ++ F+P  + + KI+ + PG +F  ++W+V    F+ YI  F+ YS  Y  
Sbjct: 207 ILIFIVLMGIYWFVPNTSPRLKILGVWPGAMFATLAWLVVTYAFSFYINNFANYSATYGS 266

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASM 272
           +  ++  +++LY  G+  I G  LNA+M
Sbjct: 267 IGGVIILMLWLYFTGIILIFGGVLNATM 294


>gi|184155905|ref|YP_001844245.1| hypothetical protein LAF_1429 [Lactobacillus fermentum IFO 3956]
 gi|183227249|dbj|BAG27765.1| conserved hypothetical protein [Lactobacillus fermentum IFO 3956]
          Length = 308

 Score = 65.9 bits (159), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 69/258 (26%), Positives = 128/258 (49%), Gaps = 8/258 (3%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAK 76
           EHF        A+ ++   LLS+FP ++   NL   LG      TV+  +  A P  + +
Sbjct: 27  EHFQMAQVTTSAAVLAYYTLLSIFPAVLVVGNLLPMLGLD--AKTVLPYLQSAIPSSVYQ 84

Query: 77  PITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISF 136
            I   I   L   + G+ T  AL A + +S G+ A + S+N AY V + ++  I R++SF
Sbjct: 85  FIRPIIFDFLRRGSGGILTTGALVALWSTSQGIAAFQRSVNGAYGVAKNQNPIINRVLSF 144

Query: 137 GYVLLASV---TLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGL 193
            ++++  +    LVIM  +   +  AL  +  F P   N + +  + R   T   LFI L
Sbjct: 145 IWMIIVIMIIFALVIMYGLGEQVLEALQPILHF-PI--NYVTLFSSLRWPVTFGGLFIFL 201

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++ F+P A+ ++  ++ G +   + W+  + LF++Y V F+     Y  + + +  ++
Sbjct: 202 TLLYYFVPNARVRLRYVVIGALVATLLWMGLSRLFSYYAVVFAQRLNSYKTIGAFILMMM 261

Query: 254 FLYMLGVFFILGAELNAS 271
           +L   G+  ++GA +NA+
Sbjct: 262 WLDFSGMIVMIGAIVNAT 279


>gi|313497651|gb|ADR59017.1| Putative ribonuclease BN [Pseudomonas putida BIRD-1]
          Length = 318

 Score = 65.9 bits (159), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 45/196 (22%), Positives = 96/196 (48%), Gaps = 6/196 (3%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL ++  + A + +S GV  +  ++N AY V E R  +    +S
Sbjct: 82  NPVIDQLQQS----KGGLLSVGIVIALWTASAGVRLMMSAMNAAYDVPEGRPVWKRIPLS 137

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGLI 194
             Y +  +  L+  + + V  P  + ++      +   ++ +W   R    ++ L + + 
Sbjct: 138 IFYTVGLAGMLLAAAALMVLGPQVMEWIAAQI-GMQEFIVTLWTILRWPVIIILLMVAVA 196

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++  +P  + +   I PG +   + W+V ++ F +Y+ TF+ Y+ MY  + +I+  L++
Sbjct: 197 LIYYVMPDVEQQFRFITPGSVLAVVVWIVASLGFAYYVKTFADYNAMYGSIGAIIVLLLY 256

Query: 255 LYMLGVFFILGAELNA 270
            Y+     +LGAE+NA
Sbjct: 257 FYISAAVLLLGAEMNA 272


>gi|297563154|ref|YP_003682128.1| ribonuclease BN [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
 gi|296847602|gb|ADH69622.1| ribonuclease BN [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
          Length = 330

 Score = 65.9 bits (159), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 68/263 (25%), Positives = 130/263 (49%), Gaps = 11/263 (4%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           +  F E+    +A+ ++  A+LS+FP ++   +L G  G      T+ D +    P   A
Sbjct: 38  VGEFKEDALADLAAGLTYYAILSLFPALLVLVSLLGLAGPSA-TQTLTDNISATMPADAA 96

Query: 76  KPITDEILQVLA-VPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITRL 133
           + +T  I  +     A G+F + +LA A +S++G + A   + N  Y V E R  + T  
Sbjct: 97  RLVTTAIENLQGNQTAAGVFGLVSLAIALWSASGYIAAFMRASNVVYDVPEGRPIWKTLP 156

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPL---ALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
           I  G  LL    +V++S   V + L   A A+V +    LG+ ++ +WN   +  +L + 
Sbjct: 157 IRVGVTLL---MVVLLSLTVVGVALTGSAAAWVGQLL-GLGSTVVTVWNIAKWPVLLLIV 212

Query: 191 IGLI-FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           + +I  ++   P A+     + PG +   + W++ +  F  Y+  F++Y   Y  +A+++
Sbjct: 213 VFMIALLYWASPNARRGFRWVSPGSVLAVVLWLLASAAFAFYVANFASYGRTYGTMATVV 272

Query: 250 TCLVFLYMLGVFFILGAELNASM 272
             LV+L++  +  +LG E NA +
Sbjct: 273 VFLVWLWITNIAILLGEEFNAEI 295


>gi|70726074|ref|YP_252988.1| hypothetical protein SH1073 [Staphylococcus haemolyticus JCSC1435]
 gi|68446798|dbj|BAE04382.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 403

 Score = 65.5 bits (158), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 99/198 (50%), Gaps = 18/198 (9%)

Query: 82  ILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS------ 135
           I  V    + GL +I  + A + +SNG+ A+  S N AY V + R+  + +++S      
Sbjct: 135 ISDVTKNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDNRNGILLKILSVIFTIV 194

Query: 136 FGYVLLASVTLVIMSFV---FVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIG 192
            G V L ++ L  M  V   F+  PL L    K+        LI    R+   ++ + I 
Sbjct: 195 LGVVFLVAMALPTMGSVIAHFLFGPLGLDSQVKWI-----FSLI----RVVLPLIIILIL 245

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
              ++   P  K+K+ S+LPG IFT + W++G+  F  YI  F  YS  Y  +A I+  L
Sbjct: 246 FTILYSVAPNVKTKLKSVLPGAIFTSVIWLLGSFAFGFYISNFGNYSKTYGSIAGIIILL 305

Query: 253 VFLYMLGVFFILGAELNA 270
           ++LY+     I+GAE+NA
Sbjct: 306 IWLYLTSFIIIIGAEINA 323


>gi|145224451|ref|YP_001135129.1| putative ribonuclease BN [Mycobacterium gilvum PYR-GCK]
 gi|145216937|gb|ABP46341.1| putative ribonuclease BN [Mycobacterium gilvum PYR-GCK]
          Length = 401

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/270 (22%), Positives = 127/270 (47%), Gaps = 13/270 (4%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI-----DV 65
           ++      F  +    +A+ ++  A+LS+FP +V   +L G +G  +     +     DV
Sbjct: 78  VLRKTAREFTHDQCTDLAAALTYYAVLSLFPALVVVMSLLGVIGQSERTADAVLGIVDDV 137

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVE 124
             GA  +V+ +PI     Q++  P+ GL  +  +  A +S++G V A   ++NR Y V E
Sbjct: 138 SPGAAVDVLREPIQ----QLVNAPSAGLTLVLGIVGALWSASGFVGAFGRAMNRIYEVEE 193

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIY 183
            R  +  RL    ++ L  + +   + + +A+   +A     +  +G   L +WN  R  
Sbjct: 194 GRPGWKLRLQQL-FLTLVGLIVAATAALLLAVSGPVAEAVGGYLGVGATGLTVWNIARWP 252

Query: 184 ATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
             ++ +  G+  ++   P  +  K   I  G     ++WV  ++ F  Y+  F  Y+  +
Sbjct: 253 LLLVLVVFGVAMLYYVSPNVRQPKFRWISVGAAIAIVTWVCASLGFGFYVANFGNYNKTF 312

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASM 272
             LA ++  L++L++  +  + GAE++A +
Sbjct: 313 GTLAGVIVFLLWLWLTNLALLFGAEVDAEL 342


>gi|319653355|ref|ZP_08007455.1| hypothetical protein HMPREF1013_04072 [Bacillus sp. 2_A_57_CT2]
 gi|317394839|gb|EFV75577.1| hypothetical protein HMPREF1013_04072 [Bacillus sp. 2_A_57_CT2]
          Length = 274

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 119/243 (48%), Gaps = 17/243 (6%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           E+D + +A+ ++   LLS+FP ++F   L  +L   Q    +++VV    P    K I  
Sbjct: 18  EDDVFGLAAQLAYFFLLSLFPLLIFLVTLVPYLPITQ--QDILNVVRDFAPGETMKLIES 75

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
            I ++     K L +   +A  + +SNG+ A+  + N+AY V E R + I R    G  +
Sbjct: 76  NIYEITQRNGK-LLSFGIIATLWSASNGINAVVKAFNKAYDVKETRHFIIAR----GMAI 130

Query: 141 LASVTLVIMSFVFVAIPLALAYVRK---FFPA---LGNLLLIIWNG-RIYATMLALFIGL 193
           L +  ++   FVFV   L   + R+   F  +   L    L IWN  R   +   LF+  
Sbjct: 131 LLTFAMI---FVFVLALLLPVFGRQIGLFISSEFGLSGQFLAIWNMVRWLVSPFILFVVF 187

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++   P  K K +S++PG IF    WV+ ++ F++Y+ +F  +S  Y  + +I+  ++
Sbjct: 188 TGLYWIAPNKKLKCISVVPGAIFATAGWVLSSLAFSYYVSSFGNFSATYGSIGAIIVLMI 247

Query: 254 FLY 256
           + Y
Sbjct: 248 WFY 250


>gi|296282984|ref|ZP_06860982.1| hypothetical protein CbatJ_05158 [Citromicrobium bathyomarinum
           JL354]
          Length = 344

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 118/258 (45%), Gaps = 13/258 (5%)

Query: 22  EDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDE 81
            DG+  A +++  A+L++FPF + GA +    G        I+ +  A P V+A+ I   
Sbjct: 62  NDGFLYAGNLAYLAMLAIFPFFITGAAIFAAFGESSERAASINALLLAMPPVVAEVIEPV 121

Query: 82  ILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLL 141
              V+      L     L   +   + +E +R  L R+Y     ++++  RL S G ++ 
Sbjct: 122 ARNVIDARQGWLLWAGGLLGLWTVGSLIETIRDLLRRSYGTEATQAFWRYRLASTGIIIA 181

Query: 142 ASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR------IYATMLALFIGLIF 195
           A + L++     V I  A   +  +FP L + L  +   R      ++ +  ALF     
Sbjct: 182 AVIVLMLSLIAQVMIGTAQQIIAAYFPPLSDALGKLALARFVPGFGLFGSFYALF----- 236

Query: 196 VHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++  P   + K     PG +   + WV   V     + +F +Y+  Y  LA I+  L+F
Sbjct: 237 -YVLTPGQYRKKRYPKWPGALAVTLWWVGVTVALPQVLRSFFSYNLTYGSLAGIIITLLF 295

Query: 255 LYMLGVFFILGAELNASM 272
            +++G+  ++GA+LNA++
Sbjct: 296 FWLVGLGVVIGAQLNAAL 313


>gi|220923045|ref|YP_002498347.1| ribonuclease BN [Methylobacterium nodulans ORS 2060]
 gi|219947652|gb|ACL58044.1| ribonuclease BN [Methylobacterium nodulans ORS 2060]
          Length = 347

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 70/272 (25%), Positives = 133/272 (48%), Gaps = 18/272 (6%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI++       ++   A A  ++  ALL+VFP +    +L G +     +   + ++ G 
Sbjct: 53  DIVWRVFWSLPQDRVLATAGGVAFFALLAVFPGLATIVSLYGLVADPSVIYQHLSLLTGV 112

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAA--AYFSSN-GVEALRISLNRAYRVVEMR 126
            P  +   +  E+ ++    A  L T S L+   A++S+N GV AL  +LN  Y+  E R
Sbjct: 113 LPSGVLDLLASELTRITKQGAGTLSTTSVLSLLIAFWSANSGVSALFDALNVIYKEREKR 172

Query: 127 SWYITRLISF-GYVLLASVTLVIMSFV----FVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           +     L+ F G  LL +++ V+ + +     VA+P+ L  +     A   L L+ W   
Sbjct: 173 T-----LVRFYGTTLLFTLSSVVFALIATGMVVAMPIILNQIGLRSSADAALRLVRWP-- 225

Query: 182 IYATMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
             A ++ + +GL  ++ + P+ + +K   +  G     + WV  + LF+ Y+ +F +Y+ 
Sbjct: 226 --ALLVVVSLGLSAIYRYGPSRREAKWRWVTWGSSVAALLWVCASALFSWYVASFDSYNR 283

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
            Y  L + +  + ++++  V  +LGAELNA M
Sbjct: 284 TYGSLGAGVGFMTWIWLSVVIVLLGAELNAEM 315


>gi|315444784|ref|YP_004077663.1| hypothetical protein Mspyr1_32120 [Mycobacterium sp. Spyr1]
 gi|315263087|gb|ADT99828.1| predicted membrane protein [Mycobacterium sp. Spyr1]
          Length = 401

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/270 (22%), Positives = 127/270 (47%), Gaps = 13/270 (4%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI-----DV 65
           ++      F  +    +A+ ++  A+LS+FP +V   +L G +G  +     +     DV
Sbjct: 78  VLRKTAREFTHDQCTDLAAALTYYAVLSLFPALVVVMSLLGVIGQSERTADAVLGIVDDV 137

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVE 124
             GA  +V+ +PI     Q++  P+ GL  +  +  A +S++G V A   ++NR Y V E
Sbjct: 138 SPGAAVDVLREPIQ----QLVNAPSAGLTLVLGIVGALWSASGFVGAFGRAMNRIYEVEE 193

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIY 183
            R  +  RL    ++ L  + +   + + +A+   +A     +  +G   L +WN  R  
Sbjct: 194 GRPGWKLRLQQL-FLTLVGLIVAATAALLLAVSGPVAEAVGGYLGVGATGLTVWNITRWP 252

Query: 184 ATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
             ++ +  G+  ++   P  +  K   I  G     ++WV  ++ F  Y+  F  Y+  +
Sbjct: 253 LLLVLVVFGVAMLYYVSPNVRQPKFRWISVGAAIAIVTWVCASLGFGFYVANFGNYNKTF 312

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASM 272
             LA ++  L++L++  +  + GAE++A +
Sbjct: 313 GTLAGVIVFLLWLWLTNLALLFGAEVDAEL 342


>gi|325961896|ref|YP_004239802.1| YihY family protein [Arthrobacter phenanthrenivorans Sphe3]
 gi|323467983|gb|ADX71668.1| YihY family protein [Arthrobacter phenanthrenivorans Sphe3]
          Length = 404

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 75/269 (27%), Positives = 129/269 (47%), Gaps = 11/269 (4%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVIDVVFGA 69
           I+   +  F ++    +A+ ++  A+LS+FP I+   +L G  G  Q     ++ +V G 
Sbjct: 40  ILKKTLREFNKDQCPDLAAALTYYAVLSLFPAILALVSLIGLFGDPQKTTDALLQIVRGF 99

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSW 128
            P   A  +   +  + + PA GL  I  LA A +S++G V A   ++NR Y V E R +
Sbjct: 100 VPAETADTVGGVVSDLASAPAAGLTLIIGLATALWSASGYVGAFGRAMNRIYEVDEGRPF 159

Query: 129 YITRLISFGYVLLASVTLVIMSFVFV-AIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
              R       LLA V + I++ + V + P+A A        L  + L IW+   +  M+
Sbjct: 160 VKLRGTMLVVTLLAVVIVAILAGMLVLSGPVAEAV--GGLIGLSGVFLAIWDIAKWPVMV 217

Query: 188 ALFIGLIFV-HLFLPAAKS---KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            L I +I V +   P  K    K MS+  G+      ++V ++ F  Y+  F  Y+  Y 
Sbjct: 218 GLIIVIIAVLYYATPNVKQPKFKWMSMGSGIAL--FVFLVASLGFGFYVGNFGNYNKTYG 275

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASM 272
            L  ++  L++L++L +  + GAE +A M
Sbjct: 276 TLGGVIVMLLWLWILNMSLLFGAEFDAEM 304


>gi|154505816|ref|ZP_02042554.1| hypothetical protein RUMGNA_03356 [Ruminococcus gnavus ATCC 29149]
 gi|153793834|gb|EDN76254.1| hypothetical protein RUMGNA_03356 [Ruminococcus gnavus ATCC 29149]
          Length = 289

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 113/246 (45%), Gaps = 20/246 (8%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVP----TVIDVVFGAWPEVIAKPITDEILQVLAVPAK 91
           +LS+ P I+        L A QF P     VID V   +P  +   I   + QV    + 
Sbjct: 36  VLSMIPIILL------LLTAVQFTPATYANVIDAVEQVFPTSVQGFIRSIVTQVYFSQSA 89

Query: 92  GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYV---LLASVTLVI 148
            +  I+ L A + +  GV ++   LN  Y   E R++   RL +  Y    +LA V  ++
Sbjct: 90  KIIPITILVALWSAGRGVLSVTAGLNCIYGNTETRNYVYLRLRASLYTVIFILAIVLSLV 149

Query: 149 MSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLP----AAK 204
           +S    +I    A + K  P    L+  I   R   T+  L +    V+ +LP      K
Sbjct: 150 LSVFGNSIS---AMIYKHAPFWSTLMQYIIKIRTVMTLAVLTVFWDLVYKYLPNRRATQK 206

Query: 205 SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFIL 264
           + +   LPG +FT   W++ + +F+ Y+  F  +S MY  + +I+  +++LY+     +L
Sbjct: 207 TTLRKQLPGAVFTACGWLLISFIFSIYLDIFEGFSDMYGSMTTIVLIMLWLYLCMYVILL 266

Query: 265 GAELNA 270
           G E+NA
Sbjct: 267 GGEVNA 272


>gi|300813395|ref|ZP_07093746.1| YihY family protein [Peptoniphilus sp. oral taxon 836 str. F0141]
 gi|300512538|gb|EFK39687.1| YihY family protein [Peptoniphilus sp. oral taxon 836 str. F0141]
          Length = 299

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/267 (23%), Positives = 136/267 (50%), Gaps = 15/267 (5%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           E D  +  + ++   +LS+FPF++   N+  FL     +  +++++   +P  + + + +
Sbjct: 26  ENDITSYGAGLAFFLILSIFPFLIALINIVNFLDIIN-IDNILNLM-QYFPNSVKEIVKN 83

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS--FGY 138
             +++    +  L +IS LA  + +S+ +  L   +N +Y   + R+++  R+++  F  
Sbjct: 84  FFIELNITSSTELLSISVLAGLFSASSAINKLIKFINNSYGFEDNRNFFFNRVLAIIFTL 143

Query: 139 VLLASVTLVIMSFVFVAIPLALAYVRKFF--PALGNLLLIIWNGRIYATMLALFIGLIFV 196
           + +  + L+I+S VF  I +   ++  F     +   L II N  I   ++ LF+    V
Sbjct: 144 LFIFMILLLIVSQVFGKI-IFYKFISIFHIDSKIIYFLWIIANSLI--PLIYLFLTFSAV 200

Query: 197 HLFLPA----AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
           + F P      K K  +++PG +F+  + ++  V+F  Y+  F  YS  Y  L  I+  L
Sbjct: 201 YRFAPCPPKNDKIKYKTVIPGSLFSTFAVIIATVIFAFYVNNFGKYSITYGSLGGIIVFL 260

Query: 253 VFLYMLGVFFILGAELNASMIIYYWRK 279
           ++L++L    ++GAE+N  +++Y  +K
Sbjct: 261 IWLFLLSTLILIGAEIN--IVLYSIKK 285


>gi|170781551|ref|YP_001709883.1| putative integral membrane protein [Clavibacter michiganensis
           subsp. sepedonicus]
 gi|169156119|emb|CAQ01258.1| putative integral membrane protein [Clavibacter michiganensis
           subsp. sepedonicus]
          Length = 394

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/264 (25%), Positives = 127/264 (48%), Gaps = 7/264 (2%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQF-VPTVIDVVFGAWPEV 73
           A+  F++  G  M + ++  + LS+ P  V   +L G +G  +  V  V+ V+     + 
Sbjct: 42  AVYGFMKHRGIDMTASLTFYSTLSLVPAAVAVLSLIGVVGDTRAGVEGVLAVLTSVLGDS 101

Query: 74  IAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
               I D + Q+   P  G+ FT+S L A + S+  V A   ++NR     E R     R
Sbjct: 102 AVDVIRDPVEQLADGPRSGVAFTVSFLGALWTSAAYVTAFGRAMNRVQETEEGRPLVKYR 161

Query: 133 LISFGYVL-LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
            +  G  + L  V++V++  + +    A A  ++    LG+  L++W    +  ++AL  
Sbjct: 162 ALMLGVTIALLVVSVVMVGMLLLTDEGARALGQQL--GLGDTTLVVWAVVKWPLLVALLT 219

Query: 192 GLIFV-HLFLPAAKSKIMSILP-GVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           G+I V +   P  + + + +L  G +   ++W +G   F  Y+   +TY + Y  L +++
Sbjct: 220 GIIGVLYAATPNLRRRRVDLLTWGSLVAIVAWGLGTAGFVAYVTHVATYESTYGVLGAVI 279

Query: 250 TCLVFLYMLGVFFILGAELNASMI 273
             L++LY+  +  +LG EL+  +I
Sbjct: 280 VLLLWLYIGNLSLVLGGELDVEII 303


>gi|284991775|ref|YP_003410329.1| ribonuclease BN [Geodermatophilus obscurus DSM 43160]
 gi|284065020|gb|ADB75958.1| ribonuclease BN [Geodermatophilus obscurus DSM 43160]
          Length = 374

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 114/240 (47%), Gaps = 10/240 (4%)

Query: 37  LSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL--- 93
           L++FP ++   N+ G + + + V   ++ +    PE  A  I D++  ++      L   
Sbjct: 98  LAIFPALIAMMNIYGLVASPETVARQVEDLSAQLPESAADLIGDQLNAIVTNSGGALSFG 157

Query: 94  FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVF 153
              S L A + +S GV  L  ++N AY  VE R +   + IS G + L ++  V+++F  
Sbjct: 158 LAASVLGALWSASGGVGNLVTAVNLAYDEVETRGFVKRKAISLG-LTLGAIVFVLITFTL 216

Query: 154 VAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIG-LIFVHLFLPAAKSKIMS-IL 211
           VA+   +  V    P LG    ++     +  +L +F G L  ++   P   +  +  + 
Sbjct: 217 VAV---VPNVLDALP-LGPFATVLAQVVRWVVLLGIFAGSLAVLYRVAPDRDAPQLRWVS 272

Query: 212 PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNAS 271
            G I   + W V ++ F+ Y+  F +Y   Y  +A ++  +++LY+     +LGAE+N+ 
Sbjct: 273 LGAIVVTVIWAVVSLGFSIYVDNFGSYDKTYGAIAGVIVLMLWLYLTCYLILLGAEINSE 332


>gi|16264688|ref|NP_437480.1| hypothetical protein SM_b21363 [Sinorhizobium meliloti 1021]
 gi|15140826|emb|CAC49340.1| conserved hypothetical membrane protein [Sinorhizobium meliloti
           1021]
          Length = 364

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/267 (22%), Positives = 126/267 (47%), Gaps = 10/267 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D+ +  +    E+    +A+ ++   LLSVFP +    ++ G +     +     ++   
Sbjct: 72  DVFWRVVSQISEDRISLIAAGVTFYVLLSVFPALASLVSIYGLVSDPATIAEQATLLAAV 131

Query: 70  WPEVIAKPITDEILQVLAVPAKGL---FTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P    + +TD++  + +     L   F    L A + + NGV AL  ++N AY   E R
Sbjct: 132 LPAQSLQMMTDQLETLSSQKTSSLSFGFIAGLLFALWSARNGVGALFEAMNIAYDETEKR 191

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+    L+S G+ L   +   ++      +P  LA++      L  L  + W       +
Sbjct: 192 SFIRLTLLSIGFTLAGLILTAVLIAAIAVLPAVLAFLHLELEGL--LRFVRWP----VML 245

Query: 187 LALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           L +  G+  ++ + P+ + +K+  +  G   + I W+V ++ F++YI  F+ Y+  Y  L
Sbjct: 246 LLIAAGITLIYRYGPSREPAKLRWLTWGAALSTICWLVASLAFSYYIDNFANYNATYGAL 305

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASM 272
            +++  ++++++  +  I+GAELNA +
Sbjct: 306 GALIGFMLWIWISTMIVIIGAELNAEL 332


>gi|154484798|ref|ZP_02027246.1| hypothetical protein EUBVEN_02516 [Eubacterium ventriosum ATCC
           27560]
 gi|149734646|gb|EDM50563.1| hypothetical protein EUBVEN_02516 [Eubacterium ventriosum ATCC
           27560]
          Length = 282

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/261 (22%), Positives = 124/261 (47%), Gaps = 10/261 (3%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPE 72
           YD I+   ++      +  S   +LS+FPFI+   NL G    +Q   T+I ++    P+
Sbjct: 13  YDFIDTIGQDKVGIYTAQASFFIILSIFPFILLFFNLIGHASINQ--NTIIYLIHSYAPD 70

Query: 73  VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
            +       + ++    +    +I+A+AA + +S GV ++   L    ++ + R+++I+R
Sbjct: 71  SLKPLFIQVVSEIYEHVSSTAVSITAIAAIWSASKGVLSVMFGLYEIAKIHQKRNYFISR 130

Query: 133 LISFGYVLLASV----TLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
            +S  Y ++ +V    T+V++ F      LA++      P L  + ++    R     L 
Sbjct: 131 FVSMLYTIIFTVALASTMVLLVFGNKLFNLAISLA----PWLRQISIVTLMLRYLLVFLL 186

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           L +    ++       +    + PG  F+ + WVV + +F+ Y+ +FS  S MY    ++
Sbjct: 187 LVLFFSLIYRLANFKLATFGKVFPGAFFSALGWVVFSYIFSIYVDSFSGMSYMYGSFTAV 246

Query: 249 MTCLVFLYMLGVFFILGAELN 269
           +  ++++Y L     +GAE+N
Sbjct: 247 IVFMLWIYFLIYIMFIGAEIN 267


>gi|251799250|ref|YP_003013981.1| ribonuclease BN [Paenibacillus sp. JDR-2]
 gi|247546876|gb|ACT03895.1| ribonuclease BN [Paenibacillus sp. JDR-2]
          Length = 296

 Score = 63.9 bits (154), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 129/259 (49%), Gaps = 10/259 (3%)

Query: 18  HFVEEDGWAMASHISLSALLSVFPFIVFGANLAGF--LGAHQFVPTVIDVVFGAWPEVIA 75
            F ++D  A+ + ++   +LS FPF++F  +L  F  L     V  +I ++    PE   
Sbjct: 17  RFRDDDVPALGAQLTYYFILSFFPFLIFVVSLMSFVQLSGDSVVAELIRLL----PEQTG 72

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
           + I   +  V+      L +I  +A  + +SNGV A+   +N+AY V E R ++  R IS
Sbjct: 73  EAIQSILQDVMNNSRVTLLSIGMIATLWSASNGVNAIIKGVNKAYDVEENRPFWKVRAIS 132

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIF 195
               L+ ++ +++   + +   +   ++  +F +  +  LI W    Y   ++ F+ ++F
Sbjct: 133 LAATLVLALAILLAIVLLIFGEVIGEFLFDWFDSPVSFELI-WGILKYVFPIS-FMLVVF 190

Query: 196 VHLF--LPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             L+  +P  K +  ++ PG +F    W+  ++LF  YI  F  YS  Y  +  I+  L+
Sbjct: 191 SLLYWIVPNHKIRFKTVFPGALFATFGWIASSLLFQFYINNFGNYSKTYGSIGGIIILLI 250

Query: 254 FLYMLGVFFILGAELNASM 272
           +LY+     ILG E+NA++
Sbjct: 251 WLYISSNIIILGGEVNATL 269


>gi|229592220|ref|YP_002874339.1| putative ribonuclease [Pseudomonas fluorescens SBW25]
 gi|229364086|emb|CAY51687.1| putative ribonuclease [Pseudomonas fluorescens SBW25]
          Length = 316

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 96/196 (48%), Gaps = 6/196 (3%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL ++  + A + +S GV  +  ++N AY VVE R  +    +S
Sbjct: 82  NPVIDQLQQ----SKGGLLSVGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIWKRFPLS 137

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGLI 194
             Y +  +  L+  + + V  P  + ++      +   ++ +W   R    ++ L   + 
Sbjct: 138 IFYTVGIAGMLLAAAALMVLGPQVMEWLAGQI-GMQEFVVTLWTIVRWPLIVILLMFAVA 196

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++  +P  + K   I PG +   + W+V ++ F +Y+ TF+ Y+ MY  + +I+  L++
Sbjct: 197 LMYYVMPDVEQKFRFITPGSVLAVVVWIVASLGFGYYVKTFADYNAMYGSIGAIIVLLLY 256

Query: 255 LYMLGVFFILGAELNA 270
            Y+     +LGAE+NA
Sbjct: 257 FYISAAVLLLGAEMNA 272


>gi|253698774|ref|YP_003019963.1| ribonuclease BN [Geobacter sp. M21]
 gi|251773624|gb|ACT16205.1| ribonuclease BN [Geobacter sp. M21]
          Length = 316

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 119/257 (46%), Gaps = 2/257 (0%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVI 74
           A + F EED    A+ ++   L + FPF++F   L  +L     +  V++      P   
Sbjct: 22  AYKKFSEEDCPEHAAAMAYYFLFASFPFLLFLTTLIAYLPVPHLLDYVLENASRLLPGET 81

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
              I D I  +     +GL ++  + A + SSN + ++  ++N  Y V E R ++  RLI
Sbjct: 82  FTLIKDNIQALFTNKKEGLLSMGIVLALWASSNAIVSVMDAMNNLYDVKEGRPFWKVRLI 141

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA-TMLALFIGL 193
           + G V+  SV  ++     +       YV       G    ++W   +   T+  L + +
Sbjct: 142 AIGLVVGLSVLFLLAMAALMFGNQIGDYVAGLI-HFGEAFKVVWFAALVPITLFVLILAV 200

Query: 194 IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
             ++ F P  + + + I PG +    SW+  ++ F+ YI  F +Y   Y  + +++  L+
Sbjct: 201 AVIYYFTPDVEHQWVWISPGAVIAIPSWIFMSLGFSAYINNFGSYDKTYGSIGAVIVLLL 260

Query: 254 FLYMLGVFFILGAELNA 270
           +LY+ G+  + GA +N+
Sbjct: 261 WLYLTGLIILAGAVINS 277


>gi|295426440|ref|ZP_06819090.1| possible ribonuclease BN [Lactobacillus amylolyticus DSM 11664]
 gi|295063808|gb|EFG54766.1| possible ribonuclease BN [Lactobacillus amylolyticus DSM 11664]
          Length = 305

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 123/247 (49%), Gaps = 16/247 (6%)

Query: 36  LLSVFPFIVFGAN-LAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLF 94
           L S+FP I+   N L  F    + +   +D++F   P+ ++K I   I  +L   + G  
Sbjct: 40  LFSIFPIIIIVGNVLPLFHINTEPIADYLDLIF---PDQVSKYIMPIINTLLKNNSTGYI 96

Query: 95  TISALAAAYFSSNGVEALRISLNRAYRV--VEMRSWYITRLISFGYVLLASVTLVIMSFV 152
           +   + A +  SN V A+R+ +NR Y V  VE++  ++  L +  + +L +  ++I   V
Sbjct: 97  SFGIILAIWSFSNMVNAIRVGMNRLYGVHAVELKLSFLNFLWTRSFTILLTALMII---V 153

Query: 153 FVAIPLALAYVRKFFPALGNLLLI-------IWNGRIYATMLALFIGLIFVHLFLPAAKS 205
           F AI L + + ++    L  ++ I       I++ R    +L + + + +++  LP  K 
Sbjct: 154 FTAIALVMIFGQQVLEFLRPIMSISVGEIKKIFSYRYPVIILMMVVAVAYLNYVLPNIKL 213

Query: 206 KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILG 265
           +   I PGVIFT +SW   + LF  Y+  F      Y  + + +  +++L ++ + F+ G
Sbjct: 214 RKRIIWPGVIFTVLSWSALSYLFGFYLHHFPISWENYGIIGTFIIFMLWLNIISLLFLFG 273

Query: 266 AELNASM 272
             +NA++
Sbjct: 274 TSINATI 280


>gi|323489179|ref|ZP_08094411.1| putative ribonuclease BN [Planococcus donghaensis MPA1U2]
 gi|323397066|gb|EGA89880.1| putative ribonuclease BN [Planococcus donghaensis MPA1U2]
          Length = 298

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 95/202 (47%), Gaps = 4/202 (1%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P  +A    D I+ V+  P+ GL T   L   + +SN + A   + N+AY + E RS++ 
Sbjct: 65  PGEVANTFQDTIVSVVTTPSGGLLTFGILGTLWSASNALTAFINATNQAYGIKETRSFFK 124

Query: 131 TRLISFGYV--LLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
            + I+ G    +L +V + ++  +F    + +       P    ++  +    I   +++
Sbjct: 125 LKAIAIGLTIGMLVAVIIALVLPIFGGTIIEIIKSTLNLPEQTEIIFQVLRWVISVAVMS 184

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           L + L++     P        +L G +   + W V +  F+ Y+  F +YS  Y  L  +
Sbjct: 185 LVLALMYK--LAPNKSFPFKEVLIGAVIATVLWQVVSFGFSIYVSNFGSYSATYGSLGGL 242

Query: 249 MTCLVFLYMLGVFFILGAELNA 270
           +  +++ ++ G+  ++GAE+NA
Sbjct: 243 IVLMLWFFLTGLILVIGAEINA 264


>gi|307243532|ref|ZP_07525680.1| YihY family protein [Peptostreptococcus stomatis DSM 17678]
 gi|306493088|gb|EFM65093.1| YihY family protein [Peptostreptococcus stomatis DSM 17678]
          Length = 283

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 76/279 (27%), Positives = 127/279 (45%), Gaps = 34/279 (12%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVF----GANLAGFLGAHQFVPTVIDVVFGAWP 71
           +  F   D ++ ++ ++    LS+FP ++F     A +   +G   FV T I        
Sbjct: 15  VNQFNIADMYSRSAGVAYYLTLSIFPSLMFLMCAFAYMPPIIG--NFVETAIRTNVPTGA 72

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
             I   I D  +   ++    L  I+ L A +  S  V++L    N AY   E RS+   
Sbjct: 73  SNILLTIVDSAINNRSI---RLLVITFLIAVWTFSKAVKSLIAGQNSAYNFEETRSFIRL 129

Query: 132 RLISFGYVLLASVTL---VIMSFVFVAIPLALAYVRKFFPALGN------LLLIIWNGRI 182
            L    YV L +V     VI + VF      L Y  KF   + +      LL +I+N  I
Sbjct: 130 NL----YVYLYAVAFFLAVIFAVVF------LVYGGKFADIIRDRLDEFYLLTLIYNF-I 178

Query: 183 YATMLALFIGLIFVHLFL--PAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
              +   FI L+F++ F+  P    KI   LPG  FT + WV+ ++ ++ YI  FS Y  
Sbjct: 179 RFVIPIFFILLMFLNFFIFGPCKPIKIRQALPGACFTTVLWVILSIAYSFYIDKFSDYKE 238

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           +Y  +++I+  + ++Y+  +   +G ++NA   + YWR 
Sbjct: 239 IYGNISTIIVLMTWIYLCSISITIGYKVNA---LNYWRD 274


>gi|315149181|gb|EFT93197.1| YihY family protein [Enterococcus faecalis TX0012]
          Length = 302

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 108/210 (51%)

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           +V+  +  A P+ +   +   I  +L   + GL ++SALAA + +S  + AL+ ++N+A+
Sbjct: 64  SVLPYIAEAIPKDVYMNLEPAIRSLLTQRSGGLLSVSALAAFWSASQSINALQNAMNKAF 123

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
            V + +++ + R++SF  +LL  V +V +  +       +  ++  F    +++      
Sbjct: 124 GVEQRKNFILVRVVSFLVILLFMVAIVGVVVILGLGQYIIELLQPIFHYSTSVIDTFQAL 183

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           +   T + L + +  ++  +P  K  + SILPG IF+ + W++ + +F  Y+  FS+   
Sbjct: 184 KWPLTTVVLLVIMCLIYAVVPNRKLSLRSILPGAIFSTVGWMLLSQIFGLYVKYFSSRIA 243

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNA 270
            Y  + S +  +++L       ILGA +NA
Sbjct: 244 SYQIIGSFIILMLWLNFAATIIILGAIVNA 273


>gi|255527896|ref|ZP_05394741.1| ribonuclease BN [Clostridium carboxidivorans P7]
 gi|296184663|ref|ZP_06853074.1| YihY family protein [Clostridium carboxidivorans P7]
 gi|255508423|gb|EET84818.1| ribonuclease BN [Clostridium carboxidivorans P7]
 gi|296050445|gb|EFG89868.1| YihY family protein [Clostridium carboxidivorans P7]
          Length = 282

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 56/269 (20%), Positives = 126/269 (46%), Gaps = 30/269 (11%)

Query: 18  HFVEEDGWAMASHISLSALLSVFPFIVFGANLAGF--LGAHQFVPTVIDVVFGAWPEVIA 75
            F E+D  +++S ++ S + + FPF++F   + G+  + +   +  +  ++    P    
Sbjct: 15  RFNEDDVLSLSSQLAYSLIFAFFPFLIFLMTVLGYSSINSQDVLAGLNRII----PRSAL 70

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
           + I + I++V+      L + S +   + +S+G   +   LN+AY  +E RS+   + I+
Sbjct: 71  ELIKNTIIEVVDYKNPHLMSFSLIFTIWSASSGFNGVIKGLNKAYDELEHRSFLKVQFIA 130

Query: 136 FGYVLLASVTLVIMSFVFV-----------AIPLALAYVRKFFPALGNLLLIIWN-GRIY 183
               +L ++ LVI  F  +           ++ L L +  +F         I+W+  R  
Sbjct: 131 ----VLCTIGLVIAIFTMIFLLVFGQIIGNSLALNLGFSEEF--------KIMWHIVRYI 178

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
             ++     L  ++ + P  +     +  G IF  I  ++ ++ F  Y+  F  YS +Y 
Sbjct: 179 IIIVLTIFILAALYHYTPCRRLTWREVSSGAIFATIGLILVSIGFAFYVNNFGNYSKIYG 238

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASM 272
            + +++  L +L+++ +  ++G ELNA++
Sbjct: 239 SIGAVIILLTWLFLVSITVVMGGELNATL 267


>gi|295110194|emb|CBL24147.1| Predicted membrane protein [Ruminococcus obeum A2-162]
          Length = 300

 Score = 63.2 bits (152), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 65/259 (25%), Positives = 122/259 (47%), Gaps = 11/259 (4%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP----TVIDVVFGAWP 71
           I+   E+   A A+  +   ++S  PF++    L       Q+ P     +  V+ G  P
Sbjct: 17  IKRMQEDHIGAYAAQAAYFLIMSFIPFVLVLTALV------QYTPLTYRMLRQVIIGFVP 70

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
           + +   +   I +V +  A  +  IS L A + S  G+++L   LN  Y V E R+W   
Sbjct: 71  DNLQDFVLKIIAEVFSKSA-AVVPISGLFALWSSGKGMQSLIAGLNVIYHVKETRNWLTN 129

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
           RL S  Y+ L  + ++    + V      A +    P LG ++  I + + +   + LF+
Sbjct: 130 RLYSMLYMFLFIIAIITSLLLLVMGNRIHAELIVHMPLLGKVVGRILSAKTFLVFVVLFL 189

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
             + ++ +LP  K+ + S +PG     ++W + +  F+ Y   F  +S MY  L++++  
Sbjct: 190 VFLVLYRYLPNRKASLKSQVPGAFIIAVAWSLFSYFFSFYFTFFPNFSNMYGSLSALIMV 249

Query: 252 LVFLYMLGVFFILGAELNA 270
           +++LY+     + GAELNA
Sbjct: 250 MLWLYVCMNLLLYGAELNA 268


>gi|256424888|ref|YP_003125541.1| ribonuclease BN [Chitinophaga pinensis DSM 2588]
 gi|256039796|gb|ACU63340.1| ribonuclease BN [Chitinophaga pinensis DSM 2588]
          Length = 323

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 125/277 (45%), Gaps = 22/277 (7%)

Query: 12  IYDAIEHFVEE----DGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +YD I+ F++E         A+ IS + LL++ PF +F   L  ++       T+ ++  
Sbjct: 35  LYDVIKFFLKEMRNQSLGERAAAISFNFLLAIPPFFIFLFTLVPYIPMQNVEATLYELAE 94

Query: 68  GAWPEVIAK-PITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
              P       I D I   L     GL +++ +   + SSN V  +  S N+       R
Sbjct: 95  DVTPNYNTYIIIRDMIHDFLYTHHNGLLSLAFIMGFFTSSNAVMGIARSFNKKLPGFRRR 154

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            W+  RL++    L+  + L++   + +A    L Y+   F  LG     I + RI +  
Sbjct: 155 KWWQKRLMALKLTLILIILLLLTIILIIAQGTVLGYI---FNYLG-----ITDKRILSLA 206

Query: 187 LA---LFIGLIF------VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
                + IGL+F      ++ F+PA   K   I  G  F  I  ++  +LF++++  F  
Sbjct: 207 DVARWILIGLLFFSMLSVIYRFVPATVKKWKFITAGSTFAAILMILVTILFSYFVNNFGN 266

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMII 274
           Y+ +Y  + +I+  ++ +Y      ++G ELNAS+ I
Sbjct: 267 YNKIYGSVGTILILMLSVYFYSFILLIGFELNASIRI 303


>gi|192289850|ref|YP_001990455.1| ribonuclease BN [Rhodopseudomonas palustris TIE-1]
 gi|192283599|gb|ACE99979.1| ribonuclease BN [Rhodopseudomonas palustris TIE-1]
          Length = 317

 Score = 62.8 bits (151), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 104/202 (51%), Gaps = 14/202 (6%)

Query: 78  ITDEILQVLAV-PAK-GLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITRLI 134
           I +++ +VLA   AK GL  + +L+ A +S+NG V+A+  +LN  Y V E R ++  +L 
Sbjct: 109 IEEQVGRVLANGEAKLGLAFLISLSLALWSANGGVKAIIDALNAVYDVEEQRGFF--KLN 166

Query: 135 SFGYVLLASVTLVIMSFV--FVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFI 191
            F  +L       +++ +   +A P+ LA +      LGNL+ +  + GR     L  F 
Sbjct: 167 GFSLLLTLGALGAVLAAIGLVIAAPIVLARI-----GLGNLVAVAIDYGRWPVLALMTFG 221

Query: 192 GLIFVHLFLPAAKSKIMS-ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           GL  ++   P   S     + PG I   +SW+ G+   ++Y+  F+ Y+  Y  L + + 
Sbjct: 222 GLSLLYRIAPNRPSPPWRWVAPGSIVAALSWLAGSAALSYYLANFADYNATYGSLGAAIG 281

Query: 251 CLVFLYMLGVFFILGAELNASM 272
            +++++M  +  + G ELNA +
Sbjct: 282 LMIWMWMTAIVVLAGGELNAEI 303


>gi|307286598|ref|ZP_07566690.1| YihY family protein [Enterococcus faecalis TX0109]
 gi|306502309|gb|EFM71590.1| YihY family protein [Enterococcus faecalis TX0109]
          Length = 302

 Score = 62.8 bits (151), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 108/210 (51%)

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           +V+  +  A P+ + K +   I  +L   + GL ++SALAA + +S  + AL+ ++N+A+
Sbjct: 64  SVLPYIAEAIPKDVYKNLEPAIRSLLTQRSGGLLSVSALAAFWSASQSINALQNAMNKAF 123

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
            V + +++ + R++SF  +LL  V +V +  +       +  ++  F    +++      
Sbjct: 124 GVEQRKNFILVRVVSFLVILLFMVAIVGVVVILGLGQYIIELLQPIFHYSTSVIDTFQAL 183

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           +   T + L + +  ++  +P  K  + SIL G IF+ + W++ + +F  Y+  FS+   
Sbjct: 184 KWPLTTVVLLVIMCLIYAVVPNRKLSLRSILSGAIFSTVGWMLLSQIFGLYVKYFSSRIA 243

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNA 270
            Y  + S +  +++L       ILGA +NA
Sbjct: 244 SYQIIGSFIILMLWLNFAATIIILGAIVNA 273


>gi|307318689|ref|ZP_07598122.1| ribonuclease BN [Sinorhizobium meliloti AK83]
 gi|306895716|gb|EFN26469.1| ribonuclease BN [Sinorhizobium meliloti AK83]
          Length = 328

 Score = 62.8 bits (151), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 59/267 (22%), Positives = 125/267 (46%), Gaps = 10/267 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D+ +  +    E+    +A+ ++   LLSVFP +    ++ G +     +     ++   
Sbjct: 36  DVFWRVVSQISEDRISLIAAGVTFYVLLSVFPALASLVSIYGLVSDPATIAEQATLLAAV 95

Query: 70  WPEVIAKPITDEILQVLAVPAKGL---FTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P    + +TD++  + +     L   F    L A + + NGV AL  ++N AY   E R
Sbjct: 96  LPAQSLQMMTDQLETLSSQKTSSLSFGFIAGLLFALWSARNGVGALFEAMNIAYDETEKR 155

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+    L+S G+ L   +   ++      +P  LA++      L  L  + W       +
Sbjct: 156 SFIRLTLLSIGFTLAGLILTAVLIAAIAVLPAVLAFLHLELEGL--LRFVRWP----VML 209

Query: 187 LALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           L +  G+  ++ + P+ + +K+  +  G   + I W+  ++ F++YI  F+ Y+  Y  L
Sbjct: 210 LLIAAGITLIYRYGPSREPAKLRWLTWGAALSTICWLGASLAFSYYIDNFANYNATYGAL 269

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASM 272
            +++  ++++++  +  I+GAELNA +
Sbjct: 270 GALIGFMLWIWISTMIVIIGAELNAEL 296


>gi|254560152|ref|YP_003067247.1| hypothetical protein METDI1672 [Methylobacterium extorquens DM4]
 gi|254267430|emb|CAX23269.1| conserved hypothetical protein; putative Ribonuclease BN domain
           [Methylobacterium extorquens DM4]
          Length = 347

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 137/270 (50%), Gaps = 14/270 (5%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI++  +     +   A A  ++  ALL+VFP +V   +L G     + +   + ++ G 
Sbjct: 53  DILWRVVLSLQRDRVLATAGGVAFFALLAVFPALVTIVSLYGLFSDPKAIGQHLSLLAGV 112

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAA--AYFSSN-GVEALRISLNRAYRVVEMR 126
            P  +   ++++++++       L T S L+   A++S+N GV AL  +LN  YR  E R
Sbjct: 113 LPNGVLDLLSEQLVRIARQSTGALSTASLLSMIIAFWSANSGVSALFDALNVIYREREKR 172

Query: 127 S---WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           S   +Y+T   +F + L   V ++  + + V +P+ L  +     A   L ++ W     
Sbjct: 173 SLVGFYVT---TFLFTLTGIVFVLASTGMVVILPIVLNRIGLGGLADTALRILRWP---- 225

Query: 184 ATMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
           A +L + + L   + + P+ + +K   +  G +   +SWV  +VLF+ Y+ +F +Y+ +Y
Sbjct: 226 ALLLLVSMSLSLTYRYGPSRREAKWRWVSWGSVAASLSWVCTSVLFSWYVASFDSYNRVY 285

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASM 272
             L + +  + ++++  V  +LGAELNA M
Sbjct: 286 GSLGAGVGFMTWIWLSVVIVLLGAELNAEM 315


>gi|172056386|ref|YP_001812846.1| ribonuclease BN [Exiguobacterium sibiricum 255-15]
 gi|171988907|gb|ACB59829.1| ribonuclease BN [Exiguobacterium sibiricum 255-15]
          Length = 285

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 124/266 (46%), Gaps = 20/266 (7%)

Query: 18  HFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKP 77
            F  E  +  ++ ++   +LS+FPF++F   L  FL        V+D++    P      
Sbjct: 10  RFFGEAFFDKSAQLAYYLMLSLFPFLLFVVGLVSFLPFTS--GDVLDLIRPFAPAETYDL 67

Query: 78  ITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFG 137
           I   ++ +       L +IS LAA + +S  V++L  SLN A  V     ++   L  FG
Sbjct: 68  IRKNVVGIFDNGGLKLASISFLAAFWLASMSVQSLVRSLNDALEVTRKVPFWRGLLQDFG 127

Query: 138 YVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI-GL--- 193
           +    +V ++I+  + + +P+A    R+F      +  ++ N   Y+ +  LF  GL   
Sbjct: 128 F----TVGMMIILPMSLLVPVAEKLTRRFITHFAIVNDVVTN---YSWIWFLFRWGLGSL 180

Query: 194 ------IFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
                 I ++  LP+ +  +  +LPG +F  I+W   +  F++Y   F +Y  +Y  LA 
Sbjct: 181 FLLVFFILLYRVLPSVRLTVRQVLPGALFATIAWQAVSEFFSYY-AEFGSYDRLYGQLAG 239

Query: 248 IMTCLVFLYMLGVFFILGAELNASMI 273
           I+  + + Y+  V  +LG  +NA  +
Sbjct: 240 IIVLMTWFYLSSVVLMLGGLMNAERM 265


>gi|197303125|ref|ZP_03168170.1| hypothetical protein RUMLAC_01849 [Ruminococcus lactaris ATCC
           29176]
 gi|197297780|gb|EDY32335.1| hypothetical protein RUMLAC_01849 [Ruminococcus lactaris ATCC
           29176]
          Length = 293

 Score = 62.4 bits (150), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 107/223 (47%), Gaps = 11/223 (4%)

Query: 57  QFVP----TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEAL 112
           Q+ P     V+++V   +P+ +A  I   I+QV    + G    + L A + +  GV ++
Sbjct: 50  QYTPVTMNDVMELVLPVFPDTVAPLIRSVIVQVYT-KSNGFIPFTLLVALWSAGKGVLSV 108

Query: 113 RISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLAL-AYVRKFFPALG 171
              LN  Y  +E R+++  R  +  Y +L  +  +++S V      +L A V +  P + 
Sbjct: 109 TYGLNCIYDNIETRNYFYLRFRACFYTVLFLIA-IMLSLVLSVFGNSLSAVVYEHIPFMS 167

Query: 172 NLLLIIWNGRIYATMLALFIGLIFVHLFLPA----AKSKIMSILPGVIFTWISWVVGAVL 227
            ++  I   R   T++ L      V+ FLP      K+ +   LPG  FT   W++ +  
Sbjct: 168 KVMNFIIRIRTCLTLVVLTFFWDLVYKFLPNRSNRGKTTLRKQLPGAFFTASGWLLLSFF 227

Query: 228 FTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           F+ Y+  F+ +++MY    +I+  +++LY      +LG E+NA
Sbjct: 228 FSVYLDIFTGFTSMYGSFTTIILIMLWLYGCMYIILLGGEINA 270


>gi|148557661|ref|YP_001265243.1| ribonuclease BN [Sphingomonas wittichii RW1]
 gi|148502851|gb|ABQ71105.1| ribonuclease BN [Sphingomonas wittichii RW1]
          Length = 307

 Score = 62.4 bits (150), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 73/264 (27%), Positives = 125/264 (47%), Gaps = 20/264 (7%)

Query: 20  VEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG-------AWPE 72
           V  DG+  A +I+  ALL++FPF +  A LA   G     P V   V+G       +  +
Sbjct: 38  VYADGFIHAGNIAYLALLTMFPFFIVMAALAQLFGR---TPDVQHAVYGFLATVPPSVRQ 94

Query: 73  VIAKPITDEILQVLAVPAKG-LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
           ++A+PI+D    VLA   KG L  + AL   +   + +E +R  L RAY     +S++  
Sbjct: 95  LVAQPISD----VLAANNKGALLWLGALVGLWTVGSFIETIRDILYRAYGTRPSKSFWHY 150

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYV-RKFFPALGNLLLIIWNGRIYATMLALF 190
           R  +   +++ SV L + +F    +   +  V  +  P    L  +I   R+ A +L L 
Sbjct: 151 RAGAI-LIIVVSVILAMAAFSAQVVLTGVEQVIWRLLPFADELQPLINLSRL-APLLMLA 208

Query: 191 IGLIFVHLFLPAAKSKIMSIL--PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
             L  + + L  A+ ++      PG +FT   W+   +L    +  F  Y   Y  LA +
Sbjct: 209 GALYAMFVTLTPARYRLSDCPKWPGALFTAGWWMAVTMLLPIVVGAFGGYGRTYGSLAGV 268

Query: 249 MTCLVFLYMLGVFFILGAELNASM 272
           +  L+F +++G+  + GA LNA++
Sbjct: 269 IVTLLFFWLVGLGLVFGAHLNAAL 292


>gi|323340240|ref|ZP_08080504.1| ribonuclease BN [Lactobacillus ruminis ATCC 25644]
 gi|323092431|gb|EFZ35039.1| ribonuclease BN [Lactobacillus ruminis ATCC 25644]
          Length = 309

 Score = 62.4 bits (150), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 117/260 (45%), Gaps = 3/260 (1%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
            A   F + +    A  IS  ALL++ P ++F  NL   L  H    TV+  +  A P  
Sbjct: 21  SAASRFNQANVSNEAIVISYYALLAIIPLMIFIGNLLPLL--HLKASTVLAYIEMAIPRS 78

Query: 74  IAKPITDEILQVLAVPAKG-LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
           I + +   I+Q L   + G   +IS L + + +S G  A++ SLN AY V   +     R
Sbjct: 79  IYQTLKPFIIQYLENGSSGGAASISGLISIWAASRGFNAMKRSLNVAYGVENSQGMLARR 138

Query: 133 LISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIG 192
           L +F +     V  V++  ++      L Y+   F    +++      +    M+ +F  
Sbjct: 139 LFAFLFTAFLGVAFVLLFIIYSFGQAVLEYLAPLFNLPMDMIDTFNQVKWPTIMVGIFWI 198

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
           ++ ++ F+P AK  +  I PG +F    W+V    F+ Y+  F+     Y  + +++  L
Sbjct: 199 MVLLYAFIPNAKLHLRFIWPGALFATCGWMVLTQGFSVYVKYFARTVLSYGTIGTVIVVL 258

Query: 253 VFLYMLGVFFILGAELNASM 272
            +L       ++G  +NA++
Sbjct: 259 FWLNFTCWVIMVGGIINATL 278


>gi|332686297|ref|YP_004456071.1| ribonuclease BN [Melissococcus plutonius ATCC 35311]
 gi|332370306|dbj|BAK21262.1| ribonuclease BN [Melissococcus plutonius ATCC 35311]
          Length = 304

 Score = 62.4 bits (150), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 104/210 (49%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           PE I   +    L +L   + GL ++SAL A + +S  + AL+I++N+AY V   +++ I
Sbjct: 74  PESIYHDLEPAFLSLLTRRSGGLLSVSALTALWSASQSINALQIAMNKAYGVKSRKNFII 133

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            R++S   +LL  + LV +  +       L +++       + ++     +   T+  L 
Sbjct: 134 VRIVSLTVILLLLLALVGVVIILGLGKNILDFLQPILKVPTSFIVTFQTLKWPVTLFVLL 193

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           I +  + L +P AK  I S++PG +F+ I W++ + +F  YI  F++    Y  + S + 
Sbjct: 194 IIMCLIFLVVPNAKLTIRSVIPGAVFSTIGWMLLSQVFGIYIKYFNSKVAGYQIIGSFIV 253

Query: 251 CLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            +++L       I G  +NA +  Y   K+
Sbjct: 254 LILWLNFAATIIIFGGIINAVVEEYSSEKR 283


>gi|116668913|ref|YP_829846.1| putative ribonuclease BN [Arthrobacter sp. FB24]
 gi|116609022|gb|ABK01746.1| putative ribonuclease BN [Arthrobacter sp. FB24]
          Length = 377

 Score = 62.4 bits (150), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 65/263 (24%), Positives = 128/263 (48%), Gaps = 11/263 (4%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG-AHQFVPTVIDVVFGAWPEVIA 75
             F ++    +A+ ++  ++LS+FP ++   +L G  G A +    ++D+V G  P    
Sbjct: 59  REFTKDQCPDLAAALTYYSVLSIFPALLALVSLLGIFGDAQKTTSGLLDIVQGIAPGDTV 118

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITRLI 134
             I   +  + + PA G   +  L  A +S++G V A   ++NR Y V E R +   R  
Sbjct: 119 NTIRPVVEDLSSSPAAGFTLVIGLLTALWSASGYVGAFGRAMNRVYEVDEGRPFLKLRGT 178

Query: 135 SFGYVLLASVTLVIMSFVFV-AIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGL 193
             G  ++  + +V+++ + V + P+A +        LG+  L +WN   +  ML L I  
Sbjct: 179 MLGVTVVNLLIVVVLAAMLVLSGPVAESVGNVI--GLGDAFLAVWNIAKWPVMLVLVIAA 236

Query: 194 IFVHLF-LPAAKS---KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           I V  +  P  K    + MS+  G     + +++ ++ F  Y+  F++Y+  Y  +  ++
Sbjct: 237 IAVLFYATPNVKQPKFRWMSM--GSAIALVVFLLASLAFGFYVANFNSYNKTYGAIGGVI 294

Query: 250 TCLVFLYMLGVFFILGAELNASM 272
             L++L++L +  + GAE +A M
Sbjct: 295 IALLWLWILNMSLLFGAEFDAEM 317


>gi|312962672|ref|ZP_07777161.1| ribonuclease BN [Pseudomonas fluorescens WH6]
 gi|311283047|gb|EFQ61639.1| ribonuclease BN [Pseudomonas fluorescens WH6]
          Length = 314

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 96/196 (48%), Gaps = 6/196 (3%)

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
            P+ D++ Q       GL ++  + A + +S GV  +  ++N AY VVE R  +    +S
Sbjct: 82  NPVIDQLQQ----SKGGLLSVGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIWKRFPLS 137

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGLI 194
             Y +  +  L+  + + V  P  + ++      +   ++ +W   R    ++ L   + 
Sbjct: 138 IFYTVGIAGMLLAAAALMVLGPQVMEWLAGQI-GMQEFVVTLWTIVRWPLIVILLMFAVA 196

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++  +P  + +   I PG +   + W+V ++ F +Y+ TF+ Y+ MY  + +I+  L++
Sbjct: 197 LMYYVMPDVEQEFRFITPGSVLAVVVWIVASLGFGYYVKTFADYNAMYGSIGAIIVLLLY 256

Query: 255 LYMLGVFFILGAELNA 270
            Y+     +LGAE+NA
Sbjct: 257 FYISAAVLLLGAEMNA 272


>gi|206890928|ref|YP_002249079.1| YihY family protein [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206742866|gb|ACI21923.1| YihY family protein [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 265

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 66/258 (25%), Positives = 125/258 (48%), Gaps = 15/258 (5%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGAN-LAGFLGAHQFVPTVIDVVFGAWPEV 73
           +++ F  ++G  ++S ++  ++LS+ P  +F  N L   L   + V  V   +   +P  
Sbjct: 12  SLKDFYNDEGVFLSSSLAFFSILSIIPLSMFIVNILMNILQEERVVKFVYSKLITFFP-A 70

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
           I   +  E+ ++LA  +K + +IS +    FS     A+  SLN+ ++  + R + ++ L
Sbjct: 71  IELHMIKELRKILA--SKEISSISLILYGVFSLQLFTAIEFSLNKIFKTAKKRHFIMSLL 128

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAY-VRKFFPALGNLLLIIWNG--RIYATMLALF 190
           +SF  +LL + T        VA   A  Y +R F P + + L I+     +     + +F
Sbjct: 129 MSFFIILLITFT--------VAASFAFTYLIRIFQPMIFSELSILLGFFLKYLLPFVLMF 180

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           +    ++  LP  K K+ SIL G + T +   +   +F  Y+V     +T+Y  L++ + 
Sbjct: 181 VITTLLYKILPNKKIKLSSILIGALITTVLIEIAKYVFAFYVVKIIKINTLYGSLSTFLA 240

Query: 251 CLVFLYMLGVFFILGAEL 268
            L++L+     FI GAEL
Sbjct: 241 LLMWLFYGWAVFIYGAEL 258


>gi|291548889|emb|CBL25151.1| Predicted membrane protein [Ruminococcus torques L2-14]
          Length = 280

 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 106/223 (47%), Gaps = 11/223 (4%)

Query: 57  QFVP----TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEAL 112
           QF P     V++ V   +P  ++ P+ + I+  + + +  +  ++ L A + +  GV ++
Sbjct: 50  QFTPVTKADVMEAVLPVFPSTVS-PMIESIVNQVYMTSSSIIPVTILVALWSAGKGVLSV 108

Query: 113 RISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAY-VRKFFPALG 171
              LN  Y   E R+++  R  +  Y  L  V  +++S V      +++  V +  P L 
Sbjct: 109 TYGLNCIYENTETRNYFYLRARACLYTFLFLVA-IMLSLVLSVFGNSISVIVYEHAPFLS 167

Query: 172 NLLLIIWNGRIYATMLALFIGLIFVHLFLP----AAKSKIMSILPGVIFTWISWVVGAVL 227
            ++  +   RIY T+  L      V+ FLP    A K+ +   LPG  FT   W+  + +
Sbjct: 168 KVIHKVVQLRIYFTLPLLTFFWDLVYKFLPNRGAAGKTTLRKQLPGAFFTACGWMALSFI 227

Query: 228 FTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           F+ Y+  F  ++ MY    +I+  +++LY      +LG E+NA
Sbjct: 228 FSIYLDIFKGFTNMYGSFTTIILVMLWLYGCMYIILLGGEINA 270


>gi|255283321|ref|ZP_05347876.1| YihY family protein [Bryantella formatexigens DSM 14469]
 gi|255266175|gb|EET59380.1| YihY family protein [Bryantella formatexigens DSM 14469]
          Length = 310

 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 113/248 (45%), Gaps = 9/248 (3%)

Query: 26  AMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD---EI 82
           A A+  +L  ++  FPF +        L   Q+ P   D+V     E++     D    I
Sbjct: 55  AFAAQSALFIIMGFFPFFML------LLTLIQYTPLTSDMVMDLLMEILPSSFYDLIAGI 108

Query: 83  LQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLA 142
           ++ L   +  L + + +AA + ++  V A+   LN    V E R++   RL S  Y+L  
Sbjct: 109 VEELFSSSTALLSGTVIAALWAAARSVLAITNGLNSVRGVEENRNYVFMRLRSGLYILFL 168

Query: 143 SVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPA 202
              +V+   + +   L      ++FP LG+   +I   R   +ML L +  + ++  LP 
Sbjct: 169 IFAIVLACILLLFGNLLQNTAFQYFPVLGSFTGMIVLVRAVISMLVLSLVFLAMYCSLPN 228

Query: 203 AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFF 262
            K KI+  +PG +F   +W + +  F+ Y    S  +++Y  L +++  +++LY      
Sbjct: 229 CKIKIIRQIPGAVFAASAWAIYSYGFSLYFDYASHSTSIYGSLTTVVMIMLWLYFCMWLL 288

Query: 263 ILGAELNA 270
             GAE+N 
Sbjct: 289 FAGAEVNC 296


>gi|331091481|ref|ZP_08340319.1| hypothetical protein HMPREF9477_00962 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330404037|gb|EGG83587.1| hypothetical protein HMPREF9477_00962 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 271

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 105/227 (46%), Gaps = 34/227 (14%)

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAV---PAKGLFTISALAAAYFSSNGVEALRISLN 117
           T +DV+  A  +V+   IT  IL ++      +  +  I+ L A + +  GV A+   LN
Sbjct: 52  TKVDVM-SAVAQVVPDSITPTILAIVNQVYNQSAAVIPITILVALWSAGRGVLAVTSGLN 110

Query: 118 RAYRVVEMRSWYITRLISFGYVLL---------------ASVTLVIMSFVFVAIPLALAY 162
             Y   E R+++  R+ +  Y +L                S++L    FV   IPLA ++
Sbjct: 111 WIYDSRETRNYFYLRIRATFYTVLFIVVIVLTLVVLGFGNSISL----FVEAHIPLA-SH 165

Query: 163 VRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWV 222
           + KF   +          R  A   AL +  + ++ FLP  + K +S LPG +FT + W+
Sbjct: 166 ITKFMIEI----------RTIAAFFALLVFSLCIYKFLPNRRDKFLSQLPGSLFTSVGWL 215

Query: 223 VGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
           + +   + Y+  F  +  MY  L +I+  +++LY      +LG ++N
Sbjct: 216 LTSFFVSKYMEIFKGFEDMYGSLTTIVLIMLWLYFSMYIMLLGGKVN 262


>gi|291302773|ref|YP_003514051.1| ribonuclease BN [Stackebrandtia nassauensis DSM 44728]
 gi|290571993|gb|ADD44958.1| ribonuclease BN [Stackebrandtia nassauensis DSM 44728]
          Length = 301

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 120/262 (45%), Gaps = 9/262 (3%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           I+ F  ++    A+ ++   +LS+FP ++  A+L G  G  Q   T +  V    P  + 
Sbjct: 15  IKEFNADNLTDAAAALTYYGVLSIFPGLLVLASLMGLFG--QSATTSMKDVTAVAPGPVR 72

Query: 76  KPITDEILQVLAVPAK-GLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITRL 133
             +TD    V A PA  G+  I  L AA ++++G + A   + N  Y V E R  + T  
Sbjct: 73  DILTDATTGVAAQPATAGVMAIVGLLAALWAASGYIGAFMRASNVVYDVPEGRPIWKTLP 132

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGL 193
           +     +   V LV  + + V        V +    +G   + +W+   +  +L + + L
Sbjct: 133 LRLAVTICVGVLLVASALIVVLTGQLAGTVGELL-GVGATAVTVWDIAKW-PVLVVLVAL 190

Query: 194 IFVHLFLPAAKSKIMSIL---PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           IF  L+  +  +K+   L   PG +     W+V +  F  Y+  F++Y+  Y  L  I+ 
Sbjct: 191 IFSILYWASPNAKVGGPLRQAPGGLVAVGLWLVASAGFAFYVANFASYNKTYGTLGGIIV 250

Query: 251 CLVFLYMLGVFFILGAELNASM 272
             ++L++  +  + GAELNA +
Sbjct: 251 FFIWLWVSNLAILFGAELNAEL 272


>gi|15672595|ref|NP_266769.1| hypothetical protein L1778 [Lactococcus lactis subsp. lactis
           Il1403]
 gi|12723510|gb|AAK04711.1|AE006294_6 hypothetical protein L1778 [Lactococcus lactis subsp. lactis
           Il1403]
          Length = 297

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 72/261 (27%), Positives = 126/261 (48%), Gaps = 28/261 (10%)

Query: 28  ASHISLSA-------LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           +S +SLS+       LL++FP  +   N+  FL  H     ++  +    P  + K I  
Sbjct: 21  SSEMSLSSIAVAYYLLLAIFPLGLIVGNILPFL--HINTTALLSFLSEQLPSDVYKGIEP 78

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI----SF 136
            I  +L     GL ++S LA  +  S  + AL++S+N+AY V   R + ++R+I     F
Sbjct: 79  VINNLLNQRNTGLLSLSVLAGFWTFSRALSALQMSMNKAYEVFNHRDFIVSRIIGLAAGF 138

Query: 137 GYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFV 196
             +L    ++V+ +F      L L  V + FP   +L   + N  + A  +A F+ L+ +
Sbjct: 139 AILLFLYFSIVLSTFG----QLILEQVHRLFPFDDHLYRTLHNMTLPAIAVATFLSLMML 194

Query: 197 HLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS-TMYAGLASIMTCLVF 254
           +  LP  K  K+   +PG IF+  ++V+  V  T++I  + +++      L  I + +VF
Sbjct: 195 YFILPNVKIRKLRYTMPGTIFS--TFVL--VFLTNWIAKYVSFALQRLDDLKLIGSLVVF 250

Query: 255 LYMLGVFF-----ILGAELNA 270
             M+   F     I+GA LNA
Sbjct: 251 ALMIWFIFIARVLIIGAILNA 271


>gi|115372473|ref|ZP_01459781.1| ribonuclease BN [Stigmatella aurantiaca DW4/3-1]
 gi|310819113|ref|YP_003951471.1| ribonuclease bn-related protein [Stigmatella aurantiaca DW4/3-1]
 gi|115370435|gb|EAU69362.1| ribonuclease BN [Stigmatella aurantiaca DW4/3-1]
 gi|309392185|gb|ADO69644.1| Ribonuclease BN-related protein [Stigmatella aurantiaca DW4/3-1]
          Length = 307

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/264 (26%), Positives = 127/264 (48%), Gaps = 12/264 (4%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI+ +    +        A+ ++   +LS+FPF++F   LAG +   + V  +I  +   
Sbjct: 35  DILGNLRREWKRNKLSDAAAALTFYGVLSLFPFLLFIVALAGLVIQPEQVQALIGELGRE 94

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR-SW 128
            P   ++  + ++ Q+ + P+ GL T SALAA + ++ GV +L  +LN AY V E R  W
Sbjct: 95  VPPAFSQIPSAQLAQLTSGPSTGLLTFSALAAVWSAAAGVVSLMTALNTAYGVTESRPRW 154

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
            +  +     +  A + L+       A  LA    + +   +G L L          + A
Sbjct: 155 KVYGIALGMMLGGALLALLAGLVAVAAPALATRLGQPWMALVGWLRL---------PLAA 205

Query: 189 LFIGLIFVHLF--LPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           L +  ++  L+  LP  + K   I PG +   + W+  ++ F+ Y+  FST+   Y  L 
Sbjct: 206 LLMMSLWATLYSVLPDVRQKFKFITPGSVAGVLVWLAASLGFSFYVSHFSTFGITYGALG 265

Query: 247 SIMTCLVFLYMLGVFFILGAELNA 270
            I+  L+++++  +  +LGAE+NA
Sbjct: 266 GIIVLLLWMWISSLALMLGAEINA 289


>gi|295133960|ref|YP_003584636.1| ribonuclease BN [Zunongwangia profunda SM-A87]
 gi|294981975|gb|ADF52440.1| ribonuclease BN [Zunongwangia profunda SM-A87]
          Length = 310

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 122/261 (46%), Gaps = 27/261 (10%)

Query: 28  ASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV-------IDVVFGAWPEVIAKPITD 80
           AS I+ S  +++FPF++F  NL  ++     +          ID +    P    + ++D
Sbjct: 55  ASAIAFSFFMALFPFLLFIFNLIPYVEETNLIDDFRIKFLLFIDTLL---PPETQEYVSD 111

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
               +   P  GL + S L + +  +NGV A+      +Y     RS +   +I+ G  L
Sbjct: 112 IFADIANNPRGGLLSFSFLLSIFLMTNGVNAIFTGFEFSYHTNIKRSLFRQYIIAIGVSL 171

Query: 141 LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG------RIYATMLALFIGLI 194
                  +++F+ +   + + Y+      L    LI  +G      + +A +L ++I + 
Sbjct: 172 -------VLAFLLLITVILMVYLTYAVEDLSEYGLIANDGSGANVVKYFAFVLLIYIAVA 224

Query: 195 FVHLF--LPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
            ++ F    A K++  S+  G  FT I  ++ + LF  YI  FS Y+ +Y  + +++  +
Sbjct: 225 TLYYFGTKEARKARFFSV--GAFFTTILIMLTSFLFGLYIENFSNYNELYGSIGALLILM 282

Query: 253 VFLYMLGVFFILGAELNASMI 273
           V++++     +LG ELNAS+I
Sbjct: 283 VYIWLNANILLLGFELNASLI 303


>gi|281491079|ref|YP_003353059.1| tRNA-processing ribonuclease BN [Lactococcus lactis subsp. lactis
           KF147]
 gi|281374837|gb|ADA64357.1| tRNA-processing ribonuclease BN [Lactococcus lactis subsp. lactis
           KF147]
 gi|326406113|gb|ADZ63184.1| tRNA-processing ribonuclease BN [Lactococcus lactis subsp. lactis
           CV56]
          Length = 301

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 72/261 (27%), Positives = 126/261 (48%), Gaps = 28/261 (10%)

Query: 28  ASHISLSA-------LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           +S +SLS+       LL++FP  +   N+  FL  H     ++  +    P  + K I  
Sbjct: 25  SSEMSLSSIAVAYYLLLAIFPLGLIVGNILPFL--HINTTALLSFLSEQLPSDVYKGIEP 82

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI----SF 136
            I  +L     GL ++S LA  +  S  + AL++S+N+AY V   R + ++R+I     F
Sbjct: 83  VINNLLNQRNTGLLSLSVLAGFWTFSRALSALQMSMNKAYEVFNHRDFIVSRIIGLAAGF 142

Query: 137 GYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFV 196
             +L    ++V+ +F      L L  V + FP   +L   + N  + A  +A F+ L+ +
Sbjct: 143 AILLFLYFSIVLSTFG----QLILEQVHRLFPFDDHLYRTLHNMTLPAIAVATFLSLMML 198

Query: 197 HLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS-TMYAGLASIMTCLVF 254
           +  LP  K  K+   +PG IF+  ++V+  V  T++I  + +++      L  I + +VF
Sbjct: 199 YFILPNVKIRKLRYTMPGTIFS--TFVL--VFLTNWIAKYVSFALQRLDDLKLIGSLVVF 254

Query: 255 LYMLGVFF-----ILGAELNA 270
             M+   F     I+GA LNA
Sbjct: 255 ALMIWFIFIARVLIIGAILNA 275


>gi|153853728|ref|ZP_01995084.1| hypothetical protein DORLON_01075 [Dorea longicatena DSM 13814]
 gi|149753478|gb|EDM63409.1| hypothetical protein DORLON_01075 [Dorea longicatena DSM 13814]
          Length = 274

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 106/218 (48%), Gaps = 7/218 (3%)

Query: 57  QFVP----TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEAL 112
           Q+ P     V+  V   +P+ +   IT  + QV    + G+ +++ + A + +  GV AL
Sbjct: 50  QYTPVTKADVMTAVLQVFPKSVDSLITSIVNQVYN-QSGGIISLTIIVALWSAGKGVLAL 108

Query: 113 RISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALA-YVRKFFPALG 171
              LN  Y   E R++ I R+ +  Y + A + ++I   V       L  +V + +P + 
Sbjct: 109 TTGLNCVYDCKETRNYIILRIRATFYTV-AFIIVIIFLLVLSVFGNTLNLFVTEHYPLME 167

Query: 172 NLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHY 231
             +  I   R   T + LF+  + ++ FLP    ++   L G  F+ + W++ + +F+ Y
Sbjct: 168 RFVDQIMQIRGIITPVLLFVFTMMIYKFLPNHIVQLKVQLMGAAFSAVGWMIVSWIFSVY 227

Query: 232 IVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
           +  F  +S+MY  L +I+  +++LY      +LG E+N
Sbjct: 228 LNIFKGFSSMYGSLTTIVLIMLWLYFCMYILLLGGEVN 265


>gi|284043536|ref|YP_003393876.1| ribonuclease BN [Conexibacter woesei DSM 14684]
 gi|283947757|gb|ADB50501.1| ribonuclease BN [Conexibacter woesei DSM 14684]
          Length = 328

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/270 (23%), Positives = 119/270 (44%), Gaps = 8/270 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVIDVV 66
           +F  +   +  + E++    A+ ++   LLS+FP ++   ++ G  G  Q    ++ D+V
Sbjct: 29  LFATLKRTVREYSEDNMSDWAAALTYYGLLSLFPALIALVSILGLFGDPQSTTRSLTDIV 88

Query: 67  FGAWPEVIAKPITDEILQVLA-VPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVE 124
               P   A      I  + +   A G+     L AA +S++G V A   + N  Y   E
Sbjct: 89  TRLGPSSAADTFEGPIRSITSNRGAAGVLFFVGLGAAIWSASGYVGAFTRAANIVYETPE 148

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R ++  R +     L   V L +++   V     +  V      +G+  + +W    + 
Sbjct: 149 GRPFWKLRPLQLLVTLAMVVMLALVALALVMTGPVVETVADSI-GIGSTAVTVWEFAKWP 207

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMS---ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
            MLA+ + L+F  L+  +   K+     + PG +   + W++ + LF  Y+  F +Y   
Sbjct: 208 VMLAVVV-LMFAVLYHVSPNVKLPGFRWVTPGALLAIVVWLIASALFAFYVANFGSYDKT 266

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNAS 271
           Y  L  I+  LV+ ++  V  +LG ELN+ 
Sbjct: 267 YGTLGGIVVLLVWFWITNVALLLGMELNSE 296


>gi|240146019|ref|ZP_04744620.1| YihY family protein [Roseburia intestinalis L1-82]
 gi|257201833|gb|EEV00118.1| YihY family protein [Roseburia intestinalis L1-82]
          Length = 285

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 117/238 (49%), Gaps = 12/238 (5%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           +LS+ PF++  ++L  +    +   T++ ++    PE IA P    ++  +   + G+ +
Sbjct: 33  ILSLIPFLMVFSSLLQYTSVTE--GTLLKIIERVMPEYIA-PFLISLIDEVYNRSAGIIS 89

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL--ISFGYVLLASVTLVIMSFVF 153
           I+A+ A + ++ GV+ +   LN    + E R+W + R+  + +  + L ++   ++  VF
Sbjct: 90  ITAIVAIWSAAKGVQYMTDGLNSVNDLEETRNWLVLRMWAVVYTVIFLVAIVFTLLVIVF 149

Query: 154 VAIPLALAYVRKFFPALGNL--LLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSIL 211
                 LA   ++ P L +   LL  + G I   ML +F  +IF    LP  K    S L
Sbjct: 150 GNSLQKLA--SQYIPLLRHAVDLLAHFRGLIMLVMLIVFFDVIFTA--LPNKKLTFKSQL 205

Query: 212 PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
           PG     ++W + ++  + Y+  F+ +S MY  L +I   +++LY      ++ AE+N
Sbjct: 206 PGAAICGVAWYIFSIGVSIYVDYFNGFS-MYGSLTTIALIMLWLYFCMYIMMMSAEVN 262


>gi|314936062|ref|ZP_07843411.1| YihY family protein [Staphylococcus hominis subsp. hominis C80]
 gi|313655879|gb|EFS19622.1| YihY family protein [Staphylococcus hominis subsp. hominis C80]
          Length = 402

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 126/255 (49%), Gaps = 12/255 (4%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI-DVVFGAWPEVIAKPIT 79
           ++D   +A+ ++   +L++FP ++F   L       Q  P  I D+V    P   A  +T
Sbjct: 77  KDDASGLAAQMTYHFVLALFPMLIFLLTLLPLF---QIDPQQIKDLVSQNAPAETADVVT 133

Query: 80  DEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYV 139
                + +  +  L ++  + A + +SNG+ A+  S N AY V + R+  + +L+S  + 
Sbjct: 134 KIFKDITSNSSGSLLSVGLILAIWSASNGMTAIMNSFNVAYDVEDARNPIVLKLLSILFT 193

Query: 140 LLASVTLVIMSFVFVAIPLALAYVRK-FFPALGNLLLIIWN---GRIYATMLALFIGLIF 195
           ++ ++ L I     + +P    +++   F  LG    + W     RI   ++ + I  + 
Sbjct: 194 IVMAIVLAIA----LTLPTFGNFIKDHLFGPLGLDQQVAWIFDLVRILLPLIVIIILFLT 249

Query: 196 VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFL 255
           ++   P  K+K  S+ PG IFT I W++G+  F  Y+  F  YS  Y  LA I+  L+++
Sbjct: 250 LYSVAPNVKTKFKSVYPGAIFTSIVWLLGSFAFGWYLSNFGNYSKTYGSLAGIIILLLWI 309

Query: 256 YMLGVFFILGAELNA 270
           Y+     I+GAE+NA
Sbjct: 310 YITCFIIIIGAEINA 324


>gi|163850547|ref|YP_001638590.1| ribonuclease BN [Methylobacterium extorquens PA1]
 gi|218529263|ref|YP_002420079.1| ribonuclease BN [Methylobacterium chloromethanicum CM4]
 gi|163662152|gb|ABY29519.1| ribonuclease BN [Methylobacterium extorquens PA1]
 gi|218521566|gb|ACK82151.1| ribonuclease BN [Methylobacterium chloromethanicum CM4]
          Length = 347

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 136/270 (50%), Gaps = 14/270 (5%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI++  +     +   A A  ++  ALL+VFP +    +L G       +   + ++ G 
Sbjct: 53  DILWRVVLSLQRDRVLATAGGVAFFALLAVFPALATIVSLYGLFSDPTAIGQHLSLLAGV 112

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAA--AYFSSN-GVEALRISLNRAYRVVEMR 126
            P  +   ++++++++       L T S L+   A++S+N GV AL  +LN  YR  E R
Sbjct: 113 LPNGVLDLLSEQLVRIARQSTGALSTASLLSMIIAFWSANSGVSALFDALNVIYREREKR 172

Query: 127 S---WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           S   +Y+T   +F + L   V ++  + + V +P+ L+ +     A   L ++ W     
Sbjct: 173 SLVGFYVT---TFLFTLTGIVFVLASTGMVVILPIVLSRIGLGGLADTALRILRWP---- 225

Query: 184 ATMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
           A +L + + L   + + P+ + +K   +  G +   +SWV  +VLF+ Y+ +F +Y+ +Y
Sbjct: 226 ALLLLVSLSLSLTYRYGPSRREAKWRWVSWGSVAASLSWVCTSVLFSWYVASFDSYNRVY 285

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASM 272
             L + +  + ++++  V  +LGAELNA M
Sbjct: 286 GSLGAGVGFMTWIWLSVVIVLLGAELNAEM 315


>gi|39934322|ref|NP_946598.1| ribonuclease BN [Rhodopseudomonas palustris CGA009]
 gi|39648170|emb|CAE26690.1| Ribonuclease BN [Rhodopseudomonas palustris CGA009]
          Length = 360

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 99/202 (49%), Gaps = 14/202 (6%)

Query: 78  ITDEILQVLAVPAKGL---FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
           + +++ +VLA     L   F IS   A + ++ GV+A+  +LN  Y V E R ++  +L 
Sbjct: 152 VEEQVGRVLANGQTKLGFAFLISLSLALWSANGGVKAIIDALNAVYDVEEQRGFF--KLN 209

Query: 135 SFGYVLLASVTLVIMSFV--FVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFI 191
            F  +L       +++ +   +A P+ LA +      LGNL+ +  + GR     L  F 
Sbjct: 210 GFSLLLTLGALGAVLAAIGLVIAAPIVLARI-----GLGNLVAVAIDYGRWPVLALMTFG 264

Query: 192 GLIFVHLFLPAAKSKIMS-ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           GL  ++   P   S     + PG I   +SW+ G+   ++Y+  F+ Y+  Y  L + + 
Sbjct: 265 GLSLLYRTAPNRPSPPWRWVAPGSIVATLSWLAGSAALSYYLANFADYNATYGSLGAAIG 324

Query: 251 CLVFLYMLGVFFILGAELNASM 272
            +++++M  +  + G E+NA +
Sbjct: 325 LMIWMWMTAIVVLAGGEVNAEI 346


>gi|228476335|ref|ZP_04061036.1| transporter [Staphylococcus hominis SK119]
 gi|228269618|gb|EEK11124.1| transporter [Staphylococcus hominis SK119]
          Length = 402

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 126/255 (49%), Gaps = 12/255 (4%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI-DVVFGAWPEVIAKPIT 79
           ++D   +A+ ++   +L++FP ++F   L       Q  P  I D+V    P   A  +T
Sbjct: 77  KDDASGLAAQMTYHFVLALFPMLIFLLTLLPLF---QIDPQQIKDLVSQNAPAETADVVT 133

Query: 80  DEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYV 139
                + +  +  L ++  + A + +SNG+ A+  S N AY V + R+  + +L+S  + 
Sbjct: 134 KIFKDITSNSSGSLLSVGLILAIWSASNGMTAIMNSFNVAYDVEDARNPIVLKLLSILFT 193

Query: 140 LLASVTLVIMSFVFVAIPLALAYVRK-FFPALGNLLLIIWN---GRIYATMLALFIGLIF 195
           ++ ++ L I     + +P    +++   F  LG    + W     RI   ++ + I  + 
Sbjct: 194 IVMAIVLAIA----LTLPTFGNFIKDHLFGPLGLDQQVAWIFDLVRILLPLIVIIILFLT 249

Query: 196 VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFL 255
           ++   P  K+K  S+ PG IFT I W++G+  F  Y+  F  YS  Y  LA I+  L+++
Sbjct: 250 LYSVAPNVKTKFKSVYPGAIFTSIVWLLGSFAFGWYLSNFGNYSKTYGSLAGIIILLLWI 309

Query: 256 YMLGVFFILGAELNA 270
           Y+     I+GAE+NA
Sbjct: 310 YITCFIIIIGAEINA 324


>gi|238923938|ref|YP_002937454.1| hypothetical protein EUBREC_1576 [Eubacterium rectale ATCC 33656]
 gi|238875613|gb|ACR75320.1| hypothetical protein EUBREC_1576 [Eubacterium rectale ATCC 33656]
          Length = 320

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 96/195 (49%), Gaps = 4/195 (2%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           PE     + D   +V A    G  +I+ + A Y SS    + ++ L+  Y V E R++ +
Sbjct: 108 PESFGDIMKDLASEVYA-SGTGRLSITMITAVYLSSKAFISFQLGLDDMYHVKENRNFIL 166

Query: 131 TRLISFGYVLLASVTLVIMSFVFV-AIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
            R+ S  Y ++ ++ L+ +  V V    L   Y       +G+++  + + R+   +  L
Sbjct: 167 RRIYSVLYSIVFALALIFLLGVMVFGNMLRKMYFSNVHHIIGSIIGSVVDYRLVICLPVL 226

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            +    +++FLP  K +    LPG +F   +W++ + +F+ Y+  ++ YS+ Y  + +I 
Sbjct: 227 ILFFWVIYVFLPNKKRRAKYQLPGAVFAAAAWMIFSGIFSVYVDKYNNYSSFYGTMTTIA 286

Query: 250 TCLVFLYMLGVFFIL 264
             +V+LY  G  ++L
Sbjct: 287 LIMVWLY--GCMYVL 299


>gi|89054551|ref|YP_510002.1| ribonuclease BN, putative [Jannaschia sp. CCS1]
 gi|88864100|gb|ABD54977.1| ribonuclease BN putative [Jannaschia sp. CCS1]
          Length = 318

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 125/260 (48%), Gaps = 14/260 (5%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVL 86
           +A+ ++   LL++FP I     ++G L     +   +  + G  P+ +   +TD+   V 
Sbjct: 37  IAAGVAFYGLLALFPAITAVMAISGLLIEPNAIVDQLSRLGGLLPQEVIAIVTDQATAVA 96

Query: 87  AVPAKGLFTIS---ALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLAS 143
                GL   +    L A Y +S G+ +L   +N AY   E R +   +L++FG  LL  
Sbjct: 97  GSREGGLGLAAIFGVLVAFYSASKGMASLMQGVNVAYDEDEERGFIRLKLVTFGLTLLLI 156

Query: 144 VTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI-GLIFVHLFLPA 202
           V L++     +A+P  LA++      LG ++  +    ++  ++AL I GL  ++ + P+
Sbjct: 157 VGLLVSLGAMLALPAVLAFID-----LGPMVEALLTAALWVGLIALTIFGLSVLYRYAPS 211

Query: 203 AKS---KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLG 259
            ++   K +S+  G +   + W+V +  F  Y+  F +Y+  +  L  ++  L++ ++  
Sbjct: 212 RENAEWKWVSL--GAVVGCVVWIVASAGFAFYVANFGSYNESFGTLGGVVVLLMWFWISA 269

Query: 260 VFFILGAELNASMIIYYWRK 279
              +LGAELNA +     R 
Sbjct: 270 FIILLGAELNAELEAQTRRD 289


>gi|291527064|emb|CBK92650.1| Predicted membrane protein [Eubacterium rectale M104/1]
          Length = 320

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 96/195 (49%), Gaps = 4/195 (2%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           PE     + D   +V A    G  +I+ + A Y SS    + ++ L+  Y V E R++ +
Sbjct: 108 PESFGDIMKDLASEVYA-SGTGRLSITMITAVYLSSKAFISFQLGLDDMYHVKENRNFIL 166

Query: 131 TRLISFGYVLLASVTLVIMSFVFV-AIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
            R+ S  Y ++ ++ L+ +  + V    L   Y       +G+++  + + R+   +  L
Sbjct: 167 RRIYSVLYSIVFALALIFLLGIMVFGNMLRKMYFSNVHHIIGSIIGSVVDYRLVICLPVL 226

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            +    +++FLP  K +    LPG +F   +W++ + +F+ Y+  ++ YS+ Y  + +I 
Sbjct: 227 ILFFWVIYVFLPNKKQRAKYQLPGAVFAAAAWMIFSGIFSVYVDKYNNYSSFYGTMTTIA 286

Query: 250 TCLVFLYMLGVFFIL 264
             +V+LY  G  ++L
Sbjct: 287 LIMVWLY--GCMYVL 299


>gi|260438511|ref|ZP_05792327.1| YihY family protein [Butyrivibrio crossotus DSM 2876]
 gi|292809100|gb|EFF68305.1| YihY family protein [Butyrivibrio crossotus DSM 2876]
          Length = 284

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 88/178 (49%), Gaps = 8/178 (4%)

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
           IS ++  + +  G  +L   LN  + + E R+W++ RL    Y +L ++  +++  + V 
Sbjct: 89  ISGISLIWAAGKGFVSLIDGLNAVFNIKEHRNWFVIRL----YAILYTIIFLVIILLCVV 144

Query: 156 IPLALAYVRKFF----PALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSIL 211
           I +    +  FF    P + ++L  I   R    +  L +   F+++ +P   +KI    
Sbjct: 145 IYVLGYRINDFFKVKAPVISDILDKILAFRALIVIFVLTVLFTFLYVAIPNRHTKIKRQF 204

Query: 212 PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
           PG +F+ + W   +  F+ Y    S  S +Y  L +I+  +++LY+    F++GAE+N
Sbjct: 205 PGALFSAVGWTGFSFFFSLYFKYSSRLSEIYGSLTTIVCVMLWLYVCMYIFLMGAEIN 262


>gi|22537011|ref|NP_687862.1| ribonuclease BN [Streptococcus agalactiae 2603V/R]
 gi|25010920|ref|NP_735315.1| ribonuclease BN [Streptococcus agalactiae NEM316]
 gi|76787357|ref|YP_329592.1| ribonuclease BN [Streptococcus agalactiae A909]
 gi|76798178|ref|ZP_00780430.1| ribonuclease BN, putative [Streptococcus agalactiae 18RS21]
 gi|77405554|ref|ZP_00782645.1| ribonuclease BN, putative [Streptococcus agalactiae H36B]
 gi|77409314|ref|ZP_00786018.1| ribonuclease BN, putative [Streptococcus agalactiae COH1]
 gi|22533867|gb|AAM99734.1|AE014230_14 ribonuclease BN, putative [Streptococcus agalactiae 2603V/R]
 gi|23095299|emb|CAD46509.1| Unknown [Streptococcus agalactiae NEM316]
 gi|76562414|gb|ABA44998.1| ribonuclease BN, putative [Streptococcus agalactiae A909]
 gi|76586486|gb|EAO62992.1| ribonuclease BN, putative [Streptococcus agalactiae 18RS21]
 gi|77172078|gb|EAO75243.1| ribonuclease BN, putative [Streptococcus agalactiae COH1]
 gi|77175861|gb|EAO78639.1| ribonuclease BN, putative [Streptococcus agalactiae H36B]
 gi|319744898|gb|EFV97232.1| YihY family protein [Streptococcus agalactiae ATCC 13813]
          Length = 306

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 66/269 (24%), Positives = 133/269 (49%), Gaps = 25/269 (9%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           + HF   +    A  ++   L++ FP +V  AN+  +   H  V  ++ ++    P+ I 
Sbjct: 23  MRHFQSAEMDLSAIAVAYYLLVTAFPLLVIAANIFPYF--HINVSDLLSLMQKNLPKNIY 80

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
           +P +   +   + P+ G+   ++L A +  S  + +L+ ++N+AY V + R + I+RL+ 
Sbjct: 81  EPASRLAVDAFSKPSTGILGFASLTAFWTMSKSLTSLQKAINKAYGVDQHRDFVISRLVG 140

Query: 136 FGYVLLASVTLVIMSFVFV----AIPLALAYVRKFFPALGNLLLI-IWNGRIYATMLALF 190
            G  L   + L +++FV +    + P+    V  +   LG+ L   + N     T L +F
Sbjct: 141 VGTGL---IILFLLTFVLIFSTFSKPVLQIIVNMY--DLGDTLTAWLLNLAQPVTFLTIF 195

Query: 191 IGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVG--AVLFTHYIVTFSTYSTMYAGLAS 247
           +G+  ++  LP A+  K+  ++PG +F+  ++V+G  + L + Y++           + +
Sbjct: 196 LGIGILYFILPNARIRKVRYVIPGTLFS--TFVIGFFSNLISQYVL---NRVEKMVDIKT 250

Query: 248 IMTCLVFLYMLGVFF-----ILGAELNAS 271
             + ++F+ ML   F     ILGA LNAS
Sbjct: 251 FGSVVIFILMLWFIFLAHIMILGAILNAS 279


>gi|291539020|emb|CBL12131.1| Predicted membrane protein [Roseburia intestinalis XB6B4]
          Length = 285

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 114/236 (48%), Gaps = 8/236 (3%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           +LS+ PF++  ++L  +    +   T++ ++    PE IA P    ++  +   + G+ +
Sbjct: 33  ILSLIPFLMVFSSLLQYTSVTE--GTLLKIIERVMPEYIA-PFLISLIDEVYNRSAGIIS 89

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
           I+A+ A + ++ GV+ +   LN    + E R+W + R+ +  Y ++  V +V    V V 
Sbjct: 90  ITAIVAIWSAAKGVQYMTDGLNSVNDLEETRNWLVLRMWAVVYTVIFLVAIVFTLLVIVF 149

Query: 156 IPLALAYVRKFFPALGNL--LLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPG 213
                    ++ P L +   LL  + G I   ML +F  +IF    LP  K    S +PG
Sbjct: 150 GNSLQKLASQYIPLLRHAVDLLAHFRGLIMLAMLIVFFDVIFTA--LPNKKLTFKSQIPG 207

Query: 214 VIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
                ++W + ++  + Y+  F+ +S MY  L +I   +++LY      ++ AE+N
Sbjct: 208 AAICGVAWYIFSIGVSIYVDYFNGFS-MYGSLTTIALIMLWLYFCMYIMMMSAEVN 262


>gi|116492143|ref|YP_803878.1| ribonuclease BN-like family protein [Pediococcus pentosaceus ATCC
           25745]
 gi|116102293|gb|ABJ67436.1| Ribonuclease BN-like family enzyme [Pediococcus pentosaceus ATCC
           25745]
          Length = 300

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 112/237 (47%), Gaps = 4/237 (1%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKG-LF 94
           LLS FP ++   +L         V TV++ +    P  I   IT+ I++       G L 
Sbjct: 38  LLSFFPMVMLMGSLLPLFDIK--VNTVLEYIETVVPVTIYN-ITEPIVKDFLGSGNGELL 94

Query: 95  TISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFV 154
           + S L   Y +S  V A + ++NRAY V + ++  + R+++F   ++    + I+ F+F 
Sbjct: 95  SFSLLLTIYSASQAVAAFQRTINRAYDVAKHQNPIVNRIVAFVLTVIIIAIMGILVFLFS 154

Query: 155 AIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGV 214
                ++Y+        +L  +I   +   T++ LF+GL  ++  +P AK K   ++PG 
Sbjct: 155 FGQTLISYLTPILNLPTHLFDLIGQLKWPVTIVGLFVGLALLYYLVPNAKIKFKYVIPGS 214

Query: 215 IFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNAS 271
           I   I  ++ +  F+ Y+  F+   T Y  L + +  + +L    +  + G  LNA+
Sbjct: 215 IAATIGTMIISQFFSFYLRIFARSVTSYKTLGTFIAIMFWLNFSAMVVMFGGVLNAT 271


>gi|291536120|emb|CBL09232.1| Predicted membrane protein [Roseburia intestinalis M50/1]
          Length = 285

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 114/236 (48%), Gaps = 8/236 (3%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           +LS+ PF++  ++L  +    +   T++ ++    PE IA P    ++  +   + G+ +
Sbjct: 33  ILSLIPFLMVFSSLLQYTSVTE--GTLLKIIERVMPEYIA-PFLISLIDEVYNRSAGIIS 89

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
           I+A+ A + ++ GV+ +   LN    + E R+W + R+ +  Y ++  V +V    V V 
Sbjct: 90  ITAIVAIWSAAKGVQYMTDGLNSVNDLEETRNWLVLRMWAVVYTVIFLVAIVFTLLVIVF 149

Query: 156 IPLALAYVRKFFPALGNL--LLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPG 213
                    ++ P L +   LL  + G I   ML +F  +IF    LP  K    S +PG
Sbjct: 150 GNSLQKLASQYIPLLRHAVDLLAHFRGLIMLVMLIVFFDVIFTA--LPNKKLTFKSQIPG 207

Query: 214 VIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
                ++W + ++  + Y+  F+ +S MY  L +I   +++LY      ++ AE+N
Sbjct: 208 AAICGVAWYIFSIGVSIYVDYFNGFS-MYGSLTTIALIMLWLYFCMYIMMMSAEVN 262


>gi|320108330|ref|YP_004183920.1| ribonuclease BN [Terriglobus saanensis SP1PR4]
 gi|319926851|gb|ADV83926.1| ribonuclease BN [Terriglobus saanensis SP1PR4]
          Length = 324

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 122/260 (46%), Gaps = 11/260 (4%)

Query: 20  VEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG---AHQFVPTVIDVVFGAWPEVIAK 76
           +E++ +  AS ++     ++FP ++  +++ G       H +V  ++D +    P     
Sbjct: 45  IEDNLFGRASQLAYYFFFALFPTLIAMSSVMGLAAKSATHIYV-QLLDKIASLVPPAAFG 103

Query: 77  PITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISF 136
            + D   Q     +    T+  L A + +S GV A++ +LN  Y+V E RS++  R    
Sbjct: 104 IVMDTFHQTTQASSTRKVTLGLLTALWSASVGVSAIQDTLNAVYKVKETRSYWRAR--GE 161

Query: 137 GYVLLASVTLVIMSFV--FVAIPLALAYVR-KFFPALGNLLLIIWNGRIYATMLALFIGL 193
             VL  +V+LV+ + +   +   +    VR KF  A+   +       I AT+L + I  
Sbjct: 162 AMVLTIAVSLVLTAALGALLGGSIGAELVRYKFSGAIAVSIATRTVAWIVATLLMVLI-F 220

Query: 194 IFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
             ++ F P   K K     PG     + WV+G++    Y+  F +YS  Y  L +++  L
Sbjct: 221 ALLYFFSPDVQKRKWHWFSPGSAIGLLGWVLGSLGLRLYLHWFDSYSVTYGSLGAVIILL 280

Query: 253 VFLYMLGVFFILGAELNASM 272
            + Y+ G+  +LGAE+N+ +
Sbjct: 281 TWFYVAGLMLLLGAEVNSEI 300


>gi|108763366|ref|YP_632756.1| YihY family protein [Myxococcus xanthus DK 1622]
 gi|108467246|gb|ABF92431.1| YihY family protein [Myxococcus xanthus DK 1622]
          Length = 359

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 85/179 (47%), Gaps = 6/179 (3%)

Query: 92  GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
           GL T+  + A + +S GV AL  +LN+ Y V E R  +  R I+    L  +   ++ +F
Sbjct: 94  GLLTVGGVGAVWAASAGVVALMTALNKVYGVTESRPIWKLRGIALLVTLGGAAVAILAAF 153

Query: 152 VFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSIL 211
             +  P+      K    LG +L+  W     A +L +F+  +  ++ LP    K   I 
Sbjct: 154 AVIVTPV---IAGKLPGGLGTVLM--WLRLPVAGLLMMFLWAVLYYV-LPDVNQKFRFIT 207

Query: 212 PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           PG +   + WV  +  F+ Y+  F  Y   Y  +  ++  L+++++     +LGAE+NA
Sbjct: 208 PGSVVGVLIWVFASWGFSQYVANFGKYDVNYGAIGGVIVMLLWMWISAQVILLGAEINA 266


>gi|291525349|emb|CBK90936.1| Predicted membrane protein [Eubacterium rectale DSM 17629]
          Length = 335

 Score = 60.1 bits (144), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 96/195 (49%), Gaps = 4/195 (2%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           PE     + D   +V A    G  +I+ + A Y SS    + ++ L+  Y V E R++ +
Sbjct: 123 PESFGDIMKDLASEVYA-SGTGRLSITMITAVYLSSKAFISFQLGLDDMYHVKENRNFIL 181

Query: 131 TRLISFGYVLLASVTLVIMSFVFV-AIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
            R+ S  Y ++ ++ L+ +  + V    L   Y       +G+++  + + R+   +  L
Sbjct: 182 RRIYSVLYSIVFALALIFLLGIMVFGNMLRKMYFSNVHHIIGSIIGSVVDYRLVICLPVL 241

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            +    +++FLP  K +    LPG +F   +W++ + +F+ Y+  ++ YS+ Y  + +I 
Sbjct: 242 ILFFWVIYVFLPNKKQRAKYQLPGAVFAAAAWMIFSGIFSVYVDKYNNYSSFYGTMTTIA 301

Query: 250 TCLVFLYMLGVFFIL 264
             +V+LY  G  ++L
Sbjct: 302 LIMVWLY--GCMYVL 314


>gi|109900439|ref|YP_663694.1| putative ribonuclease BN [Pseudoalteromonas atlantica T6c]
 gi|109702720|gb|ABG42640.1| putative ribonuclease BN [Pseudoalteromonas atlantica T6c]
          Length = 320

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 126/275 (45%), Gaps = 22/275 (8%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           +DI+   ++  ++++   +A+ +    LL+VFP +V   ++ G L +   +   ++ + G
Sbjct: 21  WDILRRTVKKMLDDNLSLIAAGVGFYFLLAVFPLLVAFISIYGLLVSPDELQQHLNQLIG 80

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYRVVEM 125
             P+   + I+ ++ ++++     L T    S L A + +S G +A+  + N  Y   + 
Sbjct: 81  VVPDQGRQIISQQVERIMSKSNTALSTGVVFSTLFAVWSASKGAQAMVTACNITYGQNQN 140

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R + +  ++       A + LV   F    +P+  +YV     A    +L+ W       
Sbjct: 141 RGFLMMLVMRVLLTASAVMLLVAALFTIAVLPILFSYVGLHHYAS---ILVQW------- 190

Query: 186 MLALFIGLIFVHLFLPA--------AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
           +   F+ L+F +L L A        + +K   + PG +     WV  +  F+ Y+  F  
Sbjct: 191 LTWPFLALVF-NLALSAFYRYGPHRSTAKWRWVTPGSLLASTLWVAFSFAFSFYLGQFGQ 249

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           Y  MY  L S++  L++ Y+     +LGAE NA+M
Sbjct: 250 YDKMYGSLGSVVVLLMWFYLTAYIILLGAEFNAAM 284


>gi|77410710|ref|ZP_00787069.1| ribonuclease BN, putative [Streptococcus agalactiae CJB111]
 gi|77163246|gb|EAO74198.1| ribonuclease BN, putative [Streptococcus agalactiae CJB111]
          Length = 306

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 66/270 (24%), Positives = 133/270 (49%), Gaps = 25/270 (9%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           + HF   +    A  ++   L++ FP +V  AN+  +   H  V  ++  +    P+ I 
Sbjct: 23  MRHFQSAEMDLSAIAVAYYLLVTAFPLLVIAANIFPYF--HINVSDLLSFMQKNLPKNIY 80

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
           +P +   +   + P+ G+   ++L A +  S  + +L+ ++N+AY V + R + I+RL+ 
Sbjct: 81  EPASRLAVDAFSKPSTGILGFASLTAFWTMSKSLTSLQKAINKAYGVDQHRDFVISRLVG 140

Query: 136 FGYVLLASVTLVIMSFVFV----AIPLALAYVRKFFPALGNLLLI-IWNGRIYATMLALF 190
            G  L   + L +++FV +    + P+    V  +   LG+ L   + N     T L +F
Sbjct: 141 VGTGL---IILFLLTFVLIFSTFSKPVLQIIVNMY--DLGDTLTAWLLNLAQPVTFLTIF 195

Query: 191 IGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVG--AVLFTHYIVTFSTYSTMYAGLAS 247
           +G+  ++  LP A+  K+  ++PG +F+  ++V+G  + L + Y++           + +
Sbjct: 196 LGIGILYFILPNARIRKVRYVIPGTLFS--TFVIGFFSNLISQYVL---NRVEKMVDIKT 250

Query: 248 IMTCLVFLYMLGVFF-----ILGAELNASM 272
             + ++F+ ML   F     ILGA LNAS+
Sbjct: 251 FGSVVIFILMLWFIFLAHIMILGAILNASV 280


>gi|160893025|ref|ZP_02073813.1| hypothetical protein CLOL250_00563 [Clostridium sp. L2-50]
 gi|156865108|gb|EDO58539.1| hypothetical protein CLOL250_00563 [Clostridium sp. L2-50]
          Length = 307

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 88/174 (50%)

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
           ISA+ A + ++ G  A+   LN   R  + +++ + RL +  Y L+  V L+ ++ V+V 
Sbjct: 106 ISAIVAIWSAAKGTMAIERGLNFMDRTKDTKNYILRRLTNALYTLIFCVMLIALAGVYVL 165

Query: 156 IPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVI 215
               +  +      +     + +  R+    + +F  ++ ++  LP    ++ + +PG +
Sbjct: 166 GNTIMEDILAKTNWVDYSEKVFFYSRLLTAPVLVFAVILLIYCRLPDNHLRLKTAIPGAV 225

Query: 216 FTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
           FT + WV+ +  F+ Y+  F   + MY  L S++  +++LY+     +LGAELN
Sbjct: 226 FTTVCWVLLSAAFSSYLTYFGINTYMYGNLGSMVIAMLWLYICMYILLLGAELN 279


>gi|171779627|ref|ZP_02920583.1| hypothetical protein STRINF_01464 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171281729|gb|EDT47163.1| hypothetical protein STRINF_01464 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 306

 Score = 59.7 bits (143), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 125/260 (48%), Gaps = 24/260 (9%)

Query: 28  ASHISLSA-------LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           ++ I LSA       LL+ FP IV  AN+  +L     V  ++  +    P  +   ++ 
Sbjct: 28  SAEIDLSAIAVAYYLLLTAFPLIVIAANIFPYLNID--VNILLAFMKKNLPTNLYPSVSA 85

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
             + + + P+  +  ++ L A +  S  + +L+ ++N+AY V + R + I RL+    V+
Sbjct: 86  ITIDIFSKPSGSILGVATLTAFWTMSKSLTSLQKAINKAYGVAQHRDFVIGRLVG---VI 142

Query: 141 LASVTLVIMSFVFVAIPLA---LAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVH 197
            + + L +++FV +    +   L  +  ++     +  +I N     T+L + IGL+ ++
Sbjct: 143 GSLLILFLLTFVLIFSTFSKAILQVINSYYDLSDTMATVILNLAQPVTVLTIVIGLMLLY 202

Query: 198 LFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
             LP  +  +   ILPG IFT +  V    LF+ YI+   T+  M   + +  + ++F+ 
Sbjct: 203 FILPNVRIRRFRYILPGTIFTSVVIVFLNNLFSSYIL--RTFERM-VDIKTFGSVVIFVL 259

Query: 257 MLGVFF-----ILGAELNAS 271
           ML   F     ILGA  NA+
Sbjct: 260 MLWFIFLAHILILGAIFNAT 279


>gi|222153325|ref|YP_002562502.1| ribonuclease BN-like family protein [Streptococcus uberis 0140J]
 gi|222114138|emb|CAR42618.1| ribonuclease BN-like family protein [Streptococcus uberis 0140J]
          Length = 315

 Score = 59.7 bits (143), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 126/266 (47%), Gaps = 19/266 (7%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           + HFV  +    +  ++   +++VFP I+  AN+  +L     +  ++ ++  + P  I 
Sbjct: 24  MRHFVSAEMDLSSIAVAYYLIITVFPLIIIAANIFPYLNID--ISDLLSLMKQSLPVDIY 81

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
           KP    +  + + PA G+  ++ +A  +  S  + +L+ ++N+AY V E R + ++ +I 
Sbjct: 82  KPAAAVVTNIFSKPAGGILGMATVAGLWTMSRSLTSLQKAVNKAYGVSEHRDFLVSHIIG 141

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVR---KFFPALGNL----LLIIWNGRIYATMLA 188
              + ++   L +++FV +    + A ++   + +    N+    LL+I       T++ 
Sbjct: 142 ---LFISVFILFLLTFVLIFSTFSKATIQLLDRHYHLSDNVTSLFLLLIQP----TTIVI 194

Query: 189 LFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           +F G++ ++  LP  K  KI  ILPG IFT       + +  +Y+V             S
Sbjct: 195 IFSGIMVLYFLLPNVKIRKIRYILPGTIFTAFVMTFMSNMIANYVVHNVERMVDIKAFGS 254

Query: 248 IMTCLVFLY--MLGVFFILGAELNAS 271
           IM  ++ L+   L    I GA  NA+
Sbjct: 255 IMIFIIMLWFIFLARILIFGAICNAT 280


>gi|94968858|ref|YP_590906.1| ribonuclease BN, putative [Candidatus Koribacter versatilis
           Ellin345]
 gi|94550908|gb|ABF40832.1| ribonuclease BN, putative [Candidatus Koribacter versatilis
           Ellin345]
          Length = 341

 Score = 59.3 bits (142), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 105/240 (43%), Gaps = 4/240 (1%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           +LS+FP ++  A +   L        ++ V     P+   K ++  +  V+   +  L +
Sbjct: 74  VLSLFPALIALAAVVSLLPMPDLFQNIMSVFGRVLPDESMKLVSKVVADVIRPHSGRLLS 133

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
              + + + +S+G   +  SLN AY V E R+W+ TRL++ G  LL    L +       
Sbjct: 134 FGLIGSLWTASSGFSGMIESLNVAYGVPETRAWWKTRLLAIGLTLLVGGMLTVSILCMTV 193

Query: 156 IPLALA-YVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFL-PAAKSKIMSILPG 213
            P  L  +  K     G + L+ W    +    AL +  I    FL P  +   M  L G
Sbjct: 194 GPHFLEIFADKI--GFGPMFLLTWKIVRWPIAFALVVLSIEAIYFLAPNVRQHFMHTLTG 251

Query: 214 VIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
            +    +WVV ++    Y   F+ ++  Y  L + +  L +LY   +  ++G E+N+ +I
Sbjct: 252 ALIAVGAWVVLSLALGVYFGKFAHFNKTYGVLGAAIGLLTWLYWTSLAILVGGEVNSEII 311


>gi|153813966|ref|ZP_01966634.1| hypothetical protein RUMTOR_00173 [Ruminococcus torques ATCC 27756]
 gi|145848362|gb|EDK25280.1| hypothetical protein RUMTOR_00173 [Ruminococcus torques ATCC 27756]
          Length = 236

 Score = 59.3 bits (142), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 107/216 (49%), Gaps = 11/216 (5%)

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           V+  V   +PE +A P+   I+  +   +  +  ++ + A + +  GV ++   LN    
Sbjct: 4   VMTAVLKVFPESVA-PMIRSIVSQVYFQSGTIVPVTIVVALWSAGKGVLSVTSGLNSICE 62

Query: 122 VVEMRSWYITRLISFGYV---LLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIW 178
            +E R+++  R+ +  Y    LLA V+ +++S VF      + Y  +  P L  ++  I 
Sbjct: 63  NMETRNYFYLRIRASFYTVIFLLAIVSSLVLS-VFGNRISVMIY--EHIPFLSKVVEFII 119

Query: 179 NGRIYATMLALFIGLIFVHLFLPA----AKSKIMSILPGVIFTWISWVVGAVLFTHYIVT 234
             R + T + L +    V+ FLP     AK+ +   LPG +FT   W++ +  F+ Y+  
Sbjct: 120 RIRTFVTFVVLTVFWDLVYRFLPNRRNMAKTTLRKQLPGAVFTACGWLLLSFFFSVYLDV 179

Query: 235 FSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           F  +++MY  L +I+  +++LY      +LG E+NA
Sbjct: 180 FKGFTSMYGSLTTIILIMLWLYGCMYIILLGGEINA 215


>gi|294010161|ref|YP_003543621.1| putative ribonuclease BN [Sphingobium japonicum UT26S]
 gi|292673491|dbj|BAI95009.1| putative ribonuclease BN [Sphingobium japonicum UT26S]
          Length = 323

 Score = 59.3 bits (142), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 112/251 (44%), Gaps = 5/251 (1%)

Query: 22  EDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDE 81
            DG+  A +++  +L+++FPF +  A +A   G  Q     +       P  +A+ +   
Sbjct: 50  NDGFIHAGNLAYLSLMTLFPFFIVAAAVASIFGRSQDGLAAVGAFLETVPPGVAEVVRQP 109

Query: 82  ILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLL 141
           I+ VL      L  +  L   +   + +E +R  L RAY     R ++  RL + G + L
Sbjct: 110 IVDVLNARTGPLLWLGGLVGLWTVGSLIETIRDILRRAYGTRSTRPFWHYRLTAIG-ITL 168

Query: 142 ASVTLVIMSFVFVAIPLAL-AYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFL 200
            SV  V+ +F    I   +  ++ +  P     + I+   ++ A M  L + L ++++ L
Sbjct: 169 VSVFAVMFAFSMQVIITGIDQFLHQILPFADQAIQIVSLTKL-APMAILCVALYYLYVSL 227

Query: 201 PAA--KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYML 258
             +  K       PG I T + W    +L    +     Y   Y  LA +M  L+F +++
Sbjct: 228 TPSLYKDPRFPKWPGAIATALWWYGVTLLLPVTLSMLGGYDMTYGSLAGVMITLIFFFLV 287

Query: 259 GVFFILGAELN 269
           G+  ++GAELN
Sbjct: 288 GLGVVIGAELN 298


>gi|331088034|ref|ZP_08336955.1| hypothetical protein HMPREF1025_00538 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330408990|gb|EGG88449.1| hypothetical protein HMPREF1025_00538 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 292

 Score = 59.3 bits (142), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 58/225 (25%), Positives = 110/225 (48%), Gaps = 15/225 (6%)

Query: 57  QFVP----TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEAL 112
           +F P     V+  V   +PE +A P+   I+  +   +  +  ++ + A + +  GV ++
Sbjct: 51  RFTPITMSEVMTAVLKVFPESVA-PMIRSIVSQVYFQSGTIVPVTIVVALWSAGKGVLSV 109

Query: 113 RISLNRAYRVVEMRSWYITRLISFGYV---LLASVTLVIMSFVFVAIPLALAYVRKFFPA 169
              LN     +E R+++  R+ +  Y    LLA V+ +++S VF      + Y  +  P 
Sbjct: 110 TSGLNSICENMETRNYFYLRIRASFYTVIFLLAIVSSLVLS-VFGNRISVMIY--EHIPF 166

Query: 170 LGNLLLIIWNGRIYATMLALFIGLIFVHLFLPA----AKSKIMSILPGVIFTWISWVVGA 225
           L  ++  I   R + T + L +    V+ FLP     AK+ +   LPG +FT   W++ +
Sbjct: 167 LSKVVEFIIRIRTFVTFVVLTVFWDLVYRFLPNRRNMAKTTLRKQLPGAVFTACGWLLLS 226

Query: 226 VLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
             F+ Y+  F  +++MY  L +I+  +++LY      +LG E+NA
Sbjct: 227 FFFSVYLDVFKGFTSMYGSLTTIILIMLWLYGCMYIILLGGEINA 271


>gi|332662794|ref|YP_004445582.1| ribonuclease BN [Haliscomenobacter hydrossis DSM 1100]
 gi|332331608|gb|AEE48709.1| ribonuclease BN [Haliscomenobacter hydrossis DSM 1100]
          Length = 344

 Score = 59.3 bits (142), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 69/282 (24%), Positives = 133/282 (47%), Gaps = 25/282 (8%)

Query: 12  IYDAIEHFVEE----DGWAMASHISLSALLSVFPFIVFGANLAGFLG---------AHQF 58
           IY+ ++ F++E    D +  A+ I+ S  LS+FP ++    L  +L             F
Sbjct: 41  IYNVVKFFIQEVQRFDLFTRANSIAYSFFLSLFPSLIALFTLIPWLKRTFLHYLPEGENF 100

Query: 59  VPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNR 118
              + + +    P    K +   I  +   P   L +I  ++A YFSSNG+ +L  S ++
Sbjct: 101 DHFLQNEIQKIMPGDAGKQLFGFIEDITNNPRIALLSIGFVSAIYFSSNGILSLLRSFDK 160

Query: 119 AYR-VVEMRSW---YITRLISFGY--VLLASVTLVIMSFVFVAIPLALAYVRKFFPALGN 172
            Y    +  SW   ++  L++F    +L+ASV LVI+   F  I     ++   F A  +
Sbjct: 161 TYEDFAKWNSWKMRWVAILLTFQLSGLLIASVILVILGQSF--IKTINNWLNLSFLAEQS 218

Query: 173 LLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYI 232
           L ++ W     A +   ++ +  ++    A   K     PG        ++ +V+F+ Y+
Sbjct: 219 LNMVRW----LAIIALYYVSIALIYRNGAAMIRKFKFFTPGAALASTLCLLSSVIFSMYV 274

Query: 233 VTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMII 274
             F+TY+ +Y  + +I+  ++++ M  +  ++G ELNAS++I
Sbjct: 275 DMFNTYNRLYGSIGAIIVLMLWIQMNVMSILIGFELNASIVI 316


>gi|317501494|ref|ZP_07959692.1| hypothetical protein HMPREF1026_01636 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|316897123|gb|EFV19196.1| hypothetical protein HMPREF1026_01636 [Lachnospiraceae bacterium
           8_1_57FAA]
          Length = 294

 Score = 59.3 bits (142), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 58/225 (25%), Positives = 110/225 (48%), Gaps = 15/225 (6%)

Query: 57  QFVP----TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEAL 112
           +F P     V+  V   +PE +A P+   I+  +   +  +  ++ + A + +  GV ++
Sbjct: 53  RFTPITMSEVMTAVLKVFPESVA-PMIRSIVSQVYFQSGTIVPVTIVVALWSAGKGVLSV 111

Query: 113 RISLNRAYRVVEMRSWYITRLISFGYV---LLASVTLVIMSFVFVAIPLALAYVRKFFPA 169
              LN     +E R+++  R+ +  Y    LLA V+ +++S VF      + Y  +  P 
Sbjct: 112 TSGLNSICENMETRNYFYLRIRASFYTVIFLLAIVSSLVLS-VFGNRISVMIY--EHIPF 168

Query: 170 LGNLLLIIWNGRIYATMLALFIGLIFVHLFLPA----AKSKIMSILPGVIFTWISWVVGA 225
           L  ++  I   R + T + L +    V+ FLP     AK+ +   LPG +FT   W++ +
Sbjct: 169 LSKVVEFIIRIRTFVTFVVLTVFWDLVYRFLPNRRNMAKTTLRKQLPGAVFTACGWLLLS 228

Query: 226 VLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
             F+ Y+  F  +++MY  L +I+  +++LY      +LG E+NA
Sbjct: 229 FFFSVYLDVFKGFTSMYGSLTTIILIMLWLYGCMYIILLGGEINA 273


>gi|220918325|ref|YP_002493629.1| ribonuclease BN [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219956179|gb|ACL66563.1| ribonuclease BN [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 338

 Score = 59.3 bits (142), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 100/217 (46%), Gaps = 12/217 (5%)

Query: 55  AHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRI 114
           A Q V  +  V     P  + K + D I Q+ A     L    AL A + +S    AL  
Sbjct: 61  AQQLVHQLAQVA----PGEVTKIVGDRIQQLGAQQNVTLLGFGALGALWAASGATLALMR 116

Query: 115 SLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAI-PLALAYVRKFFPALGNL 173
           SLN AY V E R ++  R I+    ++A V  ++ +   VA  PLA A   +   A    
Sbjct: 117 SLNTAYDVGESRPFWKVRAIALLMTVVAGVLALVGALAAVATEPLANAIGGRAGAA---- 172

Query: 174 LLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIV 233
             I+W     A ++ +F+    ++  LP  + +   I PG +F  + WV+ +  F  Y+ 
Sbjct: 173 --ILWLRLPVAALVMMFL-WALLYYVLPDVEQRFKFITPGSVFGVVLWVLASWGFGKYVA 229

Query: 234 TFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
            F  Y   Y  +A ++  L ++++  +  ++GAE+NA
Sbjct: 230 NFGHYDKTYGSIAGVIVLLFWMWLSALVLLVGAEINA 266


>gi|197123527|ref|YP_002135478.1| ribonuclease BN [Anaeromyxobacter sp. K]
 gi|196173376|gb|ACG74349.1| ribonuclease BN [Anaeromyxobacter sp. K]
          Length = 338

 Score = 59.3 bits (142), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 100/217 (46%), Gaps = 12/217 (5%)

Query: 55  AHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRI 114
           A Q V  +  V     P  + K + D I Q+ A     L    AL A + +S    AL  
Sbjct: 61  AQQLVHQLAQVA----PGEVTKIVGDRIQQLGAQQNVTLLGFGALGALWAASGATLALMR 116

Query: 115 SLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAI-PLALAYVRKFFPALGNL 173
           SLN AY V E R ++  R I+    ++A V  ++ +   VA  PLA A   +   A    
Sbjct: 117 SLNTAYDVGESRPFWKVRAIALLMTVVAGVLALVGALAAVATEPLANAIGGRAGAA---- 172

Query: 174 LLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIV 233
             I+W     A ++ +F+    ++  LP  + +   I PG +F  + WV+ +  F  Y+ 
Sbjct: 173 --ILWLRLPVAALVMMFL-WALLYYVLPDVEQRFKFITPGSVFGVVLWVLASWGFGKYVA 229

Query: 234 TFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
            F  Y   Y  +A ++  L ++++  +  ++GAE+NA
Sbjct: 230 NFGHYDKTYGSIAGVIVLLFWMWLSALVLLVGAEINA 266


>gi|302869239|ref|YP_003837876.1| ribonuclease BN [Micromonospora aurantiaca ATCC 27029]
 gi|302572098|gb|ADL48300.1| ribonuclease BN [Micromonospora aurantiaca ATCC 27029]
          Length = 363

 Score = 58.9 bits (141), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 74/266 (27%), Positives = 129/266 (48%), Gaps = 15/266 (5%)

Query: 16  IEHFVEED--GWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
           ++ F ++    WA A  ++   +LS+FP ++   ++ G LG  +    V D V  A PE 
Sbjct: 69  VQEFQDDSLTDWAAA--LTYYGVLSIFPGVLVLISVLGLLG-ERATEGVRDTVGQAVPEE 125

Query: 74  IAKPITDEILQVLAVPAKGLFTISA---LAAAYFSSNG-VEALRISLNRAYRVVEMRSWY 129
             + I +  +   A  + GL +I+A   L AA++S++G V A   + N  Y V E R  +
Sbjct: 126 NIRRIIESAID-QAGQSGGLASIAAIVGLVAAFWSASGYVAAFMRASNSIYDVPEGRPIW 184

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
            T  +  G   +  V L+I S V V     LA        LG   + +WN   +  +L L
Sbjct: 185 KTLPVRLGVTAVIGVMLLI-SAVIVVFTGGLAEQAGNAIGLGETAVTVWNIAKWPVLLVL 243

Query: 190 FIGLIFVHLFLPAAKSKIMS---ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
            + L+F  L+  +  ++      + PG +   + W+V + LF  Y+  F +Y+  Y  +A
Sbjct: 244 -VSLMFAILYWASPNARHGGFRWVSPGGVLAVVLWLVVSGLFALYVSNFGSYNKTYGAVA 302

Query: 247 SIMTCLVFLYMLGVFFILGAELNASM 272
            ++  LV+L++  V  +LGAE +A +
Sbjct: 303 GVIIFLVWLWLSNVAILLGAEFDAEL 328


>gi|153812966|ref|ZP_01965634.1| hypothetical protein RUMOBE_03373 [Ruminococcus obeum ATCC 29174]
 gi|149830913|gb|EDM86003.1| hypothetical protein RUMOBE_03373 [Ruminococcus obeum ATCC 29174]
          Length = 320

 Score = 58.9 bits (141), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 123/258 (47%), Gaps = 9/258 (3%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           ++   E+   A A+  +   ++S  PF++    L       Q+ P    ++  A    + 
Sbjct: 38  VKRMQEDHIGAYAAQAAYFLIMSFIPFVLVLTALV------QYTPLTYRMLRQAILGFVP 91

Query: 76  KPITDEILQVLA---VPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
             + D +L+++A     +  +  IS L A + S  G+++L   LN  Y V E R+W   R
Sbjct: 92  LNLQDFVLKIIAEVFTKSAAVVPISGLFALWSSGKGMQSLIAGLNVIYHVKETRNWLTNR 151

Query: 133 LISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIG 192
           L S  Y+ L  + ++I   + V      A +    P LG +L  + + + +   + LF+ 
Sbjct: 152 LYSMLYMFLFVLAIIISLLLLVMGNRIHAALVIHAPLLGRMLGRLLSAKTFLVFVVLFLV 211

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
            + ++ +LP  K+ + S +PG     ++W + +  F+ Y   F  +S MY  L++++  +
Sbjct: 212 FLVLYRYLPNRKASLKSQVPGAFIIAVAWSLFSYFFSLYFTFFPNFSNMYGSLSALIMVM 271

Query: 253 VFLYMLGVFFILGAELNA 270
           ++LY+     + GAE+NA
Sbjct: 272 LWLYVCMNLLLYGAEINA 289


>gi|312869802|ref|ZP_07729944.1| YihY family protein [Lactobacillus oris PB013-T2-3]
 gi|311094648|gb|EFQ52950.1| YihY family protein [Lactobacillus oris PB013-T2-3]
          Length = 302

 Score = 58.9 bits (141), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 122/264 (46%), Gaps = 16/264 (6%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           + HF      + A+ ++   LLS+FP ++   NL   +G      TV+  +  A P  + 
Sbjct: 16  MRHFTMAQISSSAAMLAYYTLLSIFPAVLVIGNLLPMVGLD--ADTVLSYLQTAVPSSVY 73

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
             I   I   L   + GL T  AL A + +S G+ A + S+N  Y V   ++  I R++S
Sbjct: 74  VFIKPLIYDFLRQGSGGLLTTGALIALWSTSQGIAAFQRSVNLTYDVARNQNPVINRVVS 133

Query: 136 FGY----VLLASVTLVIMSF---VFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           F +    ++L    +++  F   V  +I   L + R++     +L       R    +  
Sbjct: 134 FIWMIVVIILIYAIVLLYGFGEQVLNSIQPLLQFNRRYISLFNSL-------RWPVALAV 186

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LFI L  ++ F+P AK ++     G +   + W+  + LF++Y V F      Y  + + 
Sbjct: 187 LFIALTLLYYFVPNAKVRLRYAATGALLAALLWMGLSRLFSYYTVFFRHSVVSYKTIGAF 246

Query: 249 MTCLVFLYMLGVFFILGAELNASM 272
           +  +++L + G   +LGA LNA++
Sbjct: 247 IAMMIWLDLSGYVIMLGAVLNATL 270


>gi|146301229|ref|YP_001195820.1| putative ribonuclease BN [Flavobacterium johnsoniae UW101]
 gi|146155647|gb|ABQ06501.1| putative ribonuclease BN [Flavobacterium johnsoniae UW101]
          Length = 307

 Score = 58.9 bits (141), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 63/277 (22%), Positives = 129/277 (46%), Gaps = 11/277 (3%)

Query: 12  IYDAIEHF---VEEDGWA-MASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +YD +E +   + E  ++  AS +S S  +++FPF +F  NL  F+    F    +  V 
Sbjct: 35  LYDLLEMYTLGILEGAFSYHASAVSFSFFMALFPFALFILNLIPFIPIDNFQEDFLQFVQ 94

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
            + P      I+  I  +L     GL +   L + +  +NG+  +      +  V + R 
Sbjct: 95  QSVPPNTYDAISKIISDILNNSHSGLLSSGFLLSIFLMANGINGILSGFESSKHVFDKRG 154

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVA-IPLALAYVRKFF--PALGNLLLIIWNGRIYA 184
           ++   L++    L+ +V L    FV VA I +   +++K      L + + +I  GR   
Sbjct: 155 FFRQYLVALAISLVMTVIL----FVTVATIVVFEVFIQKTIIQDVLSDRIPLIILGRYLF 210

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
            +L + I    +  +     +K+  I  G +FT +  V+ +  F  +++ FS Y+ +Y  
Sbjct: 211 VILMILITSSILLRYGTKQYNKVPFISIGSVFTTVLIVISSFFFGIWVIKFSKYNELYGS 270

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
           + +++  + ++++  +  +LG ELNAS+     +K+ 
Sbjct: 271 IGTLLILMFYIWINCMILLLGFELNASIRKLKQKKEK 307


>gi|255024064|ref|ZP_05296050.1| transport protein [Listeria monocytogenes FSL J1-208]
          Length = 214

 Score = 58.9 bits (141), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 94/194 (48%), Gaps = 10/194 (5%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           + D    A+ ++   L S+FP ++  A L  +L  H    +V +++    P+ I   + +
Sbjct: 27  KNDVSGNAAQLAYYMLFSIFPMLLIAATLLAYL--HIDKDSVFNMIKEFAPDQIMDFLEE 84

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS--FGY 138
            +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R++ + RL+S  F  
Sbjct: 85  NLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRNYVVQRLLSXFFTL 144

Query: 139 VLLASVTLVIMSFVF-VAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLIFV 196
            +LA+V   ++  VF   I + L     F        L  WN  R   T++ +F+   F+
Sbjct: 145 AMLATVGATLLLLVFGQQIGMFLINHLNFSED----FLSFWNNLRWTVTLIVIFVVFTFL 200

Query: 197 HLFLPAAKSKIMSI 210
           +   P  +S ++S+
Sbjct: 201 YWVAPNRRSTLISV 214


>gi|154252348|ref|YP_001413172.1| putative ribonuclease BN [Parvibaculum lavamentivorans DS-1]
 gi|154156298|gb|ABS63515.1| putative ribonuclease BN [Parvibaculum lavamentivorans DS-1]
          Length = 322

 Score = 58.9 bits (141), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 91/173 (52%), Gaps = 5/173 (2%)

Query: 101 AAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLAL 160
           A + ++N V+AL  ++N AY   E RS+    L+SF + L A    V+       +P AL
Sbjct: 123 ALWSANNSVKALFEAMNVAYEEEEKRSFVKRHLVSFSFTLGAIAIGVLFLLTVGIVPAAL 182

Query: 161 AYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWI 219
           A +R    +    L+ +  GR    ++A+ I +  ++ + P+ + +K+  +  G     +
Sbjct: 183 AVLR--IESWAETLIRL--GRWPVMLIAVGIAISLIYRYGPSREHAKLRWLSWGAALATL 238

Query: 220 SWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
            W+  +V F++Y+  F+ Y+  Y  L +++  +++ ++  +  ++GAE+NA M
Sbjct: 239 VWIAASVGFSYYLENFANYNATYGALGAVIGLMMWTWISVMIILIGAEINAEM 291


>gi|322412067|gb|EFY02975.1| Ribonuclease BN [Streptococcus dysgalactiae subsp. dysgalactiae
           ATCC 27957]
          Length = 318

 Score = 58.9 bits (141), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 65/276 (23%), Positives = 129/276 (46%), Gaps = 29/276 (10%)

Query: 13  YDAIEHFVEEDGWAMASHISLSAL-------LSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
           Y+ I+ F+       +S + LS++       L+ FP I+  AN+  +L     +  ++ +
Sbjct: 16  YEPIQAFMRH---FQSSEMDLSSIAVAYYLILTAFPLIIIAANIFPYLNID--IADLLRL 70

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           +    P+ I KP +  ++ + + P+  +  ++ L   +  S  + +L+ ++N+AY   + 
Sbjct: 71  MKQNLPKDIFKPASSIVVNIFSKPSGSVLGVATLTGFWTMSRSLTSLQKAINKAYGASQH 130

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVR---KFFPALGNL----LLIIW 178
           R ++I  L+    +L + + L +++F  +    + A ++     +    N+    LL+I 
Sbjct: 131 RDFFIGHLVG---LLTSLIILFLLTFALIFSTFSKAAIQVLDNHYNLSDNITTAFLLLIQ 187

Query: 179 NGRIYATMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
                 T+L +F+GL+ ++  LP  K  KI  ILPG IFT       + L  +Y+V    
Sbjct: 188 P----ITVLIIFVGLMLLYFLLPNVKIKKIRYILPGTIFTSFVMTFLSNLVGNYVVHNVE 243

Query: 238 YSTMYAGLASIMTCLVFLY--MLGVFFILGAELNAS 271
                    S+M  ++ L+   L    ILGA  NA+
Sbjct: 244 KMVDIKTFGSVMIFIIMLWFIFLARILILGAIFNAT 279


>gi|108760431|ref|YP_634071.1| YihY family protein [Myxococcus xanthus DK 1622]
 gi|108464311|gb|ABF89496.1| YihY family protein [Myxococcus xanthus DK 1622]
          Length = 348

 Score = 58.5 bits (140), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 90/194 (46%), Gaps = 2/194 (1%)

Query: 78  ITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFG 137
           IT  +  ++  P   L T   +   + +S GV ALR +LN AY V E R  + T+ ++  
Sbjct: 82  ITGHLQSLVNQPQPKLLTAGLVITLWSASRGVNALRTALNLAYDVSESRPLWKTQGLAML 141

Query: 138 YVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLIFV 196
             LL S+ L+ +SF    +   L         L +   ++W+  R   T   + + L   
Sbjct: 142 VTLLGSL-LIPLSFAAFLLGGRLGLWLAGKLQLVDAFHLVWSWLRWPFTASLVMLVLALC 200

Query: 197 HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
           +  LP  K +   I PG +     W+     FT Y+  F  Y+  Y  +  +M  L++LY
Sbjct: 201 YYLLPDVKQRFKYITPGSVLGTGLWLTSTWGFTQYVEHFGKYNVTYGSIGGVMVLLLWLY 260

Query: 257 MLGVFFILGAELNA 270
           + G+ FI+G E+NA
Sbjct: 261 LSGLIFIVGGEVNA 274


>gi|315504286|ref|YP_004083173.1| ribonuclease bn [Micromonospora sp. L5]
 gi|315410905|gb|ADU09022.1| ribonuclease BN [Micromonospora sp. L5]
          Length = 363

 Score = 58.5 bits (140), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 73/255 (28%), Positives = 124/255 (48%), Gaps = 13/255 (5%)

Query: 25  WAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQ 84
           WA A  ++   +LS+FP ++   ++ G LG  +    V D V  A PE   + I +  + 
Sbjct: 80  WAAA--LTYYGVLSIFPGVLVLISVLGLLG-DRATEGVRDTVGQAVPEENIRRIIESAID 136

Query: 85  VLAVPAKGLFTISA---LAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
             A  + GL +I+A   L AA++S++G V A   + N  Y V E R  + T  +  G   
Sbjct: 137 -QAGQSGGLASIAAIVGLVAAFWSASGYVAAFMRASNSIYDVPEGRPIWKTLPVRLGVTA 195

Query: 141 LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFL 200
           +  V L+I S V V     LA        LG   + +WN   +  +L L + L+F  L+ 
Sbjct: 196 VIGVMLLI-SAVIVVFTGGLAEQAGNAIGLGETAVTVWNIAKWPVLLVL-VSLMFAILYW 253

Query: 201 PAAKSKIMS---ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
            +  ++      + PG +   + W+V + LF  Y+  F +Y+  Y  +A ++  LV+L++
Sbjct: 254 ASPNARHGGFRWVSPGGVLAVVLWLVVSGLFALYVSNFGSYNKTYGAVAGVIIFLVWLWL 313

Query: 258 LGVFFILGAELNASM 272
             V  +LGAE +A +
Sbjct: 314 SNVAILLGAEFDAEL 328


>gi|186683817|ref|YP_001867013.1| ribonuclease BN [Nostoc punctiforme PCC 73102]
 gi|186466269|gb|ACC82070.1| putative ribonuclease BN [Nostoc punctiforme PCC 73102]
          Length = 299

 Score = 58.5 bits (140), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 62/285 (21%), Positives = 134/285 (47%), Gaps = 25/285 (8%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R ++ + +  +       +E     +AS I+ +A+LS+FP I+        L A   +  
Sbjct: 8   RFFYYLNWRTLKKTFARTMERRLLGLASEIAFNAMLSLFPAIL------AVLTAIGLLAE 61

Query: 62  VIDVVFGAWPEVIAKPITDEIL---------QVLAVPAKGLFTISALAAAYFSSNGVEAL 112
            +   F      +++ + +E L         ++      GLF++S + A + +S  V   
Sbjct: 62  SLQATFKQLAAQLSQILPEEALVLIRDFATTEITNSRNSGLFSLSFVLAIWTASGAVSTA 121

Query: 113 RISLNRAYRV--VEMRSWYITRLISFGYVLLASVTLVIMSF-VFVAIPLALAYVRKFFPA 169
             +L++ +++    MR ++  +L+S G  +   + LV+ SF VF +  L    VR+    
Sbjct: 122 MTALDQIHQIPSENMRPFWKAKLVSLGLTVGTMLLLVLASFLVFTSDWLLGMVVREN--- 178

Query: 170 LGNLLLIIWNGRIYATMLALFIGLI---FVHLFLPAAKSKIMSILPGVIFTWISWVVGAV 226
            G+L++++   ++    LAL I  +   FV+ + P+  +    ++PG I   + W + + 
Sbjct: 179 -GSLIVLLHLWQLLRWPLALSIVAVAFGFVYRYGPSVWNSGTPMMPGAILAAVFWAILSA 237

Query: 227 LFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNAS 271
           LF  Y+  F  Y+ +Y  + +++  +++L M     ++G +LN +
Sbjct: 238 LFRLYVANFGNYNKVYGAVGAVIVLMLWLSMSAAVLLIGDQLNVT 282


>gi|90426068|ref|YP_534438.1| ribonuclease BN, putative [Rhodopseudomonas palustris BisB18]
 gi|90108082|gb|ABD90119.1| ribonuclease BN, putative [Rhodopseudomonas palustris BisB18]
          Length = 351

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 102/203 (50%), Gaps = 16/203 (7%)

Query: 78  ITDEILQVLAVPAKGLFTIS-----ALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYIT 131
           I D++ +VLA   KG   +      ++A A +S+NG ++A+  SLN  Y   E R ++  
Sbjct: 128 IQDQVGRVLA---KGDVKLGTAFLFSMALALWSANGGMKAIIDSLNVVYGEQEKRGFFKL 184

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALG-NLLLIIWNGRIYATMLALF 190
             +S  + L +   ++    + VA P+ L+ V      LG     +I  GR  A  + + 
Sbjct: 185 NAVSLAFTLGSLAAVLAAIGLVVAAPIVLSMV-----GLGATADALIRYGRWPALAVLVL 239

Query: 191 IGLIFVHLFLPAAKSKIMS-ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            GL  ++ + P+  +     I PG +   +SW+ G+   ++Y+  F+ Y   Y  L + +
Sbjct: 240 FGLAVLYRYGPSLTAPQWRWISPGSVAAALSWLAGSAALSYYLANFANYDATYGSLGAAI 299

Query: 250 TCLVFLYMLGVFFILGAELNASM 272
             +V+++M  +  +LGA+LN+++
Sbjct: 300 GLMVWMWMTTIVVLLGAQLNSAI 322


>gi|125623441|ref|YP_001031924.1| putative tRNA-processing ribonuclease BN [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|124492249|emb|CAL97179.1| putative tRNA-processing ribonuclease BN [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|300070189|gb|ADJ59589.1| putative tRNA-processing ribonuclease BN [Lactococcus lactis subsp.
           cremoris NZ9000]
          Length = 301

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 71/261 (27%), Positives = 125/261 (47%), Gaps = 28/261 (10%)

Query: 28  ASHISLSA-------LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           +S +SLS+       LL++FP  +   N+  FL  H     ++  +    P  + K I  
Sbjct: 25  SSEMSLSSIAVAYYLLLAIFPLGLIVGNILPFL--HINTTALLSFLSDQLPSDVYKGIEP 82

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI----SF 136
            I  +L     GL ++S LA  +  S  + AL++S+N+AY V   R + ++R+I     F
Sbjct: 83  VINNLLNQRNTGLLSLSVLAGFWTFSRALSALQMSMNKAYEVFNHRDFIVSRVIGLAAGF 142

Query: 137 GYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFV 196
             +L    ++V+ +F      L L  V + F    +L   + N  + A  +A F+ L+ +
Sbjct: 143 AILLFLYFSIVLSTFE----QLILEQVHRIFAFDDHLYRTLHNMTLPAIAVATFLSLMML 198

Query: 197 HLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS-TMYAGLASIMTCLVF 254
           +  LP  K  K+   +PG IF+  ++V+  V  T++I  + +++      L  I + +VF
Sbjct: 199 YFILPNVKIRKLRYTMPGTIFS--TFVL--VFLTNWIAKYVSFALQRLDDLKLIGSLVVF 254

Query: 255 LYMLGVFF-----ILGAELNA 270
             M+   F     I+GA LNA
Sbjct: 255 ALMIWFIFIARVLIIGAILNA 275


>gi|162147146|ref|YP_001601607.1| ribonuclease protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785723|emb|CAP55294.1| putative ribonuclease protein [Gluconacetobacter diazotrophicus PAl
           5]
          Length = 321

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 112/245 (45%), Gaps = 7/245 (2%)

Query: 35  ALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL- 93
           A LS+FP I    ++ G +     V   +DV+    P      I + I  ++A P   L 
Sbjct: 56  ATLSLFPAISTLISIYGLMFDPDTVEPQMDVLRHLLPPSAFTLIDERIHTLVAEPHSSLT 115

Query: 94  --FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
               +S     + +S    ++  ++N AY   E R +    L++ G  L A    V+   
Sbjct: 116 LNLILSTTITLWSASAATRSIISAVNIAYDTRETRGFVQFHLMALGMTLCAICGAVLTLS 175

Query: 152 VFVAIPLALAYVRKFF---PALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKI 207
           V VA+P+ + +V       P   ++ L++  G     +L +      ++ F P  +    
Sbjct: 176 VLVALPVLIDFVPARLGLAPPPWSVELLVQTGGPALMLLFVLAACSLLYRFSPNRRIVHW 235

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAE 267
           + ILPG     + W+V ++ F++Y+ T ++Y+  Y  L +++  +++ ++     +LGAE
Sbjct: 236 ICILPGSCTATLIWIVSSIGFSYYVSTIASYNATYGPLGAVVATMMWFFVTAYVILLGAE 295

Query: 268 LNASM 272
           LNA +
Sbjct: 296 LNAGL 300


>gi|315639598|ref|ZP_07894738.1| YihY family protein [Enterococcus italicus DSM 15952]
 gi|315484559|gb|EFU75015.1| YihY family protein [Enterococcus italicus DSM 15952]
          Length = 313

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 90/185 (48%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P  I   I   I  +L   +  L ++SAL A + +S  +  L+ ++NRAY V +  ++ I
Sbjct: 75  PSQIYDFIGPAIKDLLTQGSGKLLSVSALGALWSASQSINGLQTAMNRAYGVEQRSNFII 134

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            R++SF  ++   +++V +  V     + L  ++  F      + +    +   T+L L 
Sbjct: 135 VRIVSFFVIIFFMISIVGVFLVMGIGKVILDILQPIFQIPSEWISLFQTIKWPVTILGLL 194

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
             L  ++  +P AK K+ S LPG IFT   W+  + +F  Y + F+   + Y  + S + 
Sbjct: 195 AMLTMIYWIVPNAKVKLRSALPGAIFTTAGWMALSQIFGLYAMYFTRRISGYQIIGSFIV 254

Query: 251 CLVFL 255
            +++L
Sbjct: 255 LMIWL 259


>gi|209544202|ref|YP_002276431.1| ribonuclease BN [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531879|gb|ACI51816.1| ribonuclease BN [Gluconacetobacter diazotrophicus PAl 5]
          Length = 321

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 112/245 (45%), Gaps = 7/245 (2%)

Query: 35  ALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL- 93
           A LS+FP I    ++ G +     V   +DV+    P      I + I  ++A P   L 
Sbjct: 56  ATLSLFPAISTLISIYGLMFDPDTVEPQMDVLRHLLPPSAFTLIDERIHTLVAEPHSSLT 115

Query: 94  --FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
               +S     + +S    ++  ++N AY   E R +    L++ G  L A    V+   
Sbjct: 116 LNLILSTTITLWSASAATRSIISAVNIAYDTRETRGFVQFHLMALGMTLCAICGAVLTLS 175

Query: 152 VFVAIPLALAYVRKFF---PALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKI 207
           V VA+P+ + +V       P   ++ L++  G     +L +      ++ F P  +    
Sbjct: 176 VLVALPVLIDFVPARLGLAPPPWSVELLVQTGGPALMLLFVLAACSLLYRFSPNRRIVHW 235

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAE 267
           + ILPG     + W+V ++ F++Y+ T ++Y+  Y  L +++  +++ ++     +LGAE
Sbjct: 236 ICILPGSCTATLIWIVSSIGFSYYVSTIASYNATYGPLGAVVATMMWFFVTAYVILLGAE 295

Query: 268 LNASM 272
           LNA +
Sbjct: 296 LNAGL 300


>gi|108801303|ref|YP_641500.1| ribonuclease BN, putative [Mycobacterium sp. MCS]
 gi|119870454|ref|YP_940406.1| putative ribonuclease BN [Mycobacterium sp. KMS]
 gi|126437284|ref|YP_001072975.1| putative ribonuclease BN [Mycobacterium sp. JLS]
 gi|108771722|gb|ABG10444.1| ribonuclease BN, putative [Mycobacterium sp. MCS]
 gi|119696543|gb|ABL93616.1| putative ribonuclease BN [Mycobacterium sp. KMS]
 gi|126237084|gb|ABO00485.1| putative ribonuclease BN [Mycobacterium sp. JLS]
          Length = 350

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 64/269 (23%), Positives = 126/269 (46%), Gaps = 7/269 (2%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG-AHQFVPTVIDVVF 67
           F ++      F  +    +A+ ++  A+LS+FP ++   +L G  G   +    ++D+V 
Sbjct: 32  FYVLRKTAREFGHDQCTDLAAALTYYAVLSLFPAVLVMVSLLGVFGQGRRTTDALLDIVS 91

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMR 126
              P      +   I Q++  P+ G   +  +  A +S++G V A   ++NR Y V E R
Sbjct: 92  DVAPASTVDTLRPTIEQLVESPSAGFALVIGILTALWSASGYVGAFGRAMNRIYEVAEGR 151

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVF-VAIPLALAYVRKFFPALGNLLLIIWN-GRIYA 184
             +  R +       A +   +++F+  V+ P+A A        LG   +  W+ GR   
Sbjct: 152 PVWKLRPLQLVLTFAALLGAALVAFMLAVSGPVAEALGNAI--GLGEAAVTAWSIGRWPV 209

Query: 185 TMLALFIGLIFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            +L + + +  ++   P   + K   I  G     ++W+V +V F  Y+  FS+Y+  Y 
Sbjct: 210 ILLLVVVAVAVLYYATPNVQQPKFRWISLGAGLAILTWIVASVGFGFYVANFSSYNKTYG 269

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASM 272
            LA ++  L++L++  +  + GAEL+A +
Sbjct: 270 TLAGVIIFLLWLWITNLALLFGAELDAEL 298


>gi|311746051|ref|ZP_07719836.1| putative ribonuclease BN [Algoriphagus sp. PR1]
 gi|126576268|gb|EAZ80546.1| putative ribonuclease BN [Algoriphagus sp. PR1]
          Length = 327

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/279 (20%), Positives = 128/279 (45%), Gaps = 8/279 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-----TV 62
           V+D+    I+   ++D    A  ++ S  L++FP I+F  N+  +L    F+P      +
Sbjct: 32  VYDVGRIFIQQLQKDDIVERAGSVAFSFTLALFPLILFLLNIIPYL--QDFIPIVTTQNI 89

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
           +  +    P  +       I+ +++ P + L ++    A + S+ GV ++  S N  Y+ 
Sbjct: 90  LTFIQEMLPGELYAQAETTIMDIVSRPRQSLISLGFFFALFSSTQGVVSMMNSFNSVYQT 149

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E R ++ TR I+   V +  +T+   S V +   + +  + +      + ++ +++   
Sbjct: 150 KENRGFFQTRAIAASIVFILVLTIFAASAVMIIGGVIIRRLDELQLFNSDFMIFLFSTLK 209

Query: 183 YATMLALF-IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
           +  +L +F I   F+  F PA   K      G     +   +G   FT Y+  F++Y+ +
Sbjct: 210 FMVLLFMFYITTAFIFRFAPAVHDKWRFFSTGARLGGLLITLGFYGFTFYLNNFASYNKL 269

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           Y  + +++  +++L +  +  ++  E+N S+ +    KK
Sbjct: 270 YGSIGTLIALMLWLLITSLIVLVCFEVNVSLDLVEEDKK 308


>gi|15924873|ref|NP_372407.1| transporter [Staphylococcus aureus subsp. aureus Mu50]
 gi|156980199|ref|YP_001442458.1| hypothetical protein SAHV_1868 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|255006671|ref|ZP_05145272.2| hypothetical protein SauraM_09385 [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|14247655|dbj|BAB58045.1| similar to transporter [Staphylococcus aureus subsp. aureus Mu50]
 gi|156722334|dbj|BAF78751.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3]
          Length = 405

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 99/193 (51%), Gaps = 8/193 (4%)

Query: 82  ILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLL 141
           I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  + +L+S    ++
Sbjct: 141 ICDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGIVLKLLS----VV 196

Query: 142 ASVTLVIMSFVFVAIPLALAYVRKF-FPALGNLLLIIW--NGRIYATMLALFIGLIFV-H 197
            +V + ++  V +A+P   + +  F F  LG    + W  N       + +   +  V +
Sbjct: 197 FTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIIIFIIFIVLY 256

Query: 198 LFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
              P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+  L++LY+
Sbjct: 257 SVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGIIILLLWLYI 316

Query: 258 LGVFFILGAELNA 270
                I+GAE+NA
Sbjct: 317 TSFIIIVGAEINA 329


>gi|316935505|ref|YP_004110487.1| ribonuclease BN [Rhodopseudomonas palustris DX-1]
 gi|315603219|gb|ADU45754.1| ribonuclease BN [Rhodopseudomonas palustris DX-1]
          Length = 319

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 103/202 (50%), Gaps = 14/202 (6%)

Query: 78  ITDEILQVLAVPAKGL---FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
           I +++ +VLA     L   F +S   A + ++ GV+A+  +LN  Y V E R ++  +L 
Sbjct: 110 IEEQVGRVLANGQTRLGFAFLVSLSLALWSANGGVKAIIDALNAVYDVEEERGFF--KLN 167

Query: 135 SFGYVLLASVTLVIMSFV--FVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFI 191
           +F  +L       +++ +   +A P+ LA +      LG+L+ ++ + GR     L  F 
Sbjct: 168 AFSLLLTLGALGAVLAAIGLVIAAPIVLAQI-----GLGSLVAVVIDYGRWPVLALLTFA 222

Query: 192 GLIFVHLFLPAAKSKIMS-ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           GL  ++       S     +LPG +   +SW+ G+   ++Y+  F+ Y+  Y  L + + 
Sbjct: 223 GLGLLYRTAANRPSPPWRWVLPGSVAATLSWLAGSAALSYYLANFADYNATYGSLGAAIG 282

Query: 251 CLVFLYMLGVFFILGAELNASM 272
            +++++M  +  ++G ELNA++
Sbjct: 283 LMIWMWMTAIVVLVGGELNAAI 304


>gi|254451160|ref|ZP_05064597.1| ribonuclease BN [Octadecabacter antarcticus 238]
 gi|198265566|gb|EDY89836.1| ribonuclease BN [Octadecabacter antarcticus 238]
          Length = 275

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 133/281 (47%), Gaps = 21/281 (7%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           F+I    ++   E++   +++ ++   L ++FP I    +L G       V + +D++ G
Sbjct: 7   FEITRQVLDDLREKNAGLISAGVAFYGLFAIFPGIAATISLFGIFADPIVVESQLDLMAG 66

Query: 69  AWPEVIAKPITDEILQVLAVPAK--GLFTISALAAAYFSSN-GVEALRISLN----RAYR 121
             PE + K    +I  +L+  +   G+ T+ ++  A +S+  GV AL   LN    R  R
Sbjct: 67  LMPEGVFKLFQTQIDGLLSARSATLGVTTLLSIGLALWSARTGVAALIRGLNAIFDRPNR 126

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
              +R   +  L++   V +A V L+++    V  P+ LA +   F     +LL ++  R
Sbjct: 127 G-SIRHVLVALLLTICLVGIAIVALLMV----VVAPIFLAVIP--FNTDQTVLLELF--R 177

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMS-ILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
               +  LF+GL  ++ + P  +   M  + PG       W+  +  F+ Y+  FSTY+ 
Sbjct: 178 WSLVIAVLFVGLGLLYRYGPNRRFARMGWVTPGAFVVVAFWLAMSAAFSTYVANFSTYNE 237

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
           +Y  L +++  L + Y+     ++GA LN ++     R+KP
Sbjct: 238 VYGSLGAVIALLFWFYLSAYLILVGAALNNTLD----RRKP 274


>gi|94496023|ref|ZP_01302602.1| hypothetical protein SKA58_15612 [Sphingomonas sp. SKA58]
 gi|94424715|gb|EAT09737.1| hypothetical protein SKA58_15612 [Sphingomonas sp. SKA58]
          Length = 321

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/253 (23%), Positives = 116/253 (45%), Gaps = 3/253 (1%)

Query: 22  EDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDE 81
            DG+  A +++  +L+++FPF +  A +A   G  Q     ++      P  +A  +   
Sbjct: 49  SDGFIHAGNLAYLSLMTLFPFFIVAAAVASVFGRTQDGLQALNAFLYTVPRGVADVVRQP 108

Query: 82  ILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLL 141
           I  VL   +  L  +  L   +   + +E +R  L RAY     ++++  RL + G  L 
Sbjct: 109 INDVLTARSGPLLWLGGLVGLWTVGSLIETIRDILRRAYGTKSTKAFWQYRLSAIGITLF 168

Query: 142 ASVTLVIMSFVF-VAIPLALAYVRKFFPALGNLLLIIWNGRIYA-TMLALFIGLIFVHLF 199
            SV  V+ +F   V I     ++ +  P   + + ++ + R+    ++ + +  +FV L 
Sbjct: 169 -SVFAVMFAFSMQVVITGIDQFLVRLVPWADDAIALVASARLVPMAIVCVALWSLFVALT 227

Query: 200 LPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLG 259
             A K +     PG + T + W    +L    +     Y   Y  LA +M  L+F +++G
Sbjct: 228 PTAYKDRRFPKWPGAVATALWWYGTTLLLPPTLSLLGGYGRTYGSLAGVMITLIFFFLVG 287

Query: 260 VFFILGAELNASM 272
           +  ++GAELNA++
Sbjct: 288 LGVVIGAELNAAL 300


>gi|169333779|ref|ZP_02860972.1| hypothetical protein ANASTE_00163 [Anaerofustis stercorihominis DSM
           17244]
 gi|169259628|gb|EDS73594.1| hypothetical protein ANASTE_00163 [Anaerofustis stercorihominis DSM
           17244]
          Length = 295

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/273 (22%), Positives = 123/273 (45%), Gaps = 15/273 (5%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
           I  +++   E+  +  A+  +   + S  P I+    L  +L   Q    +I +    +P
Sbjct: 10  IKSSLDKLSEDFIYTFAAQSAFFMMFSFVPLIMIIVLLVQYLPLTQ--EELISISIHIFP 67

Query: 72  EVIAKPITDEILQVLAVPAKG-LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           + +A  ITD + + L +   G +  ++ L   + +S G+ ++   LN  Y+  + R++  
Sbjct: 68  QALAGFITD-LFKGLYINYSGTVLLVTFLTLVWSASKGIYSISKGLNTIYKTKDERNYIQ 126

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            R +S  Y        +    +F+++ + L +       L + L  I +  I  + L  F
Sbjct: 127 IRGVSLLYT-------ICFGLIFLSVIILLIFGINIAKFLQSELFFIGDLHINYSYLGGF 179

Query: 191 IGLIFVHLF----LPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             L+ + L     LP  K  I+  LPG IF+   W++ + L++ YI      S +Y  L+
Sbjct: 180 FLLLAIFLITFCVLPKRKCHILKELPGAIFSSAGWIIFSWLYSLYITKVGANSLIYGSLS 239

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           +++  +++LY+      LG ELN  +  Y  +K
Sbjct: 240 AVILFMLWLYICMYIIFLGGELNVVLQTYDIKK 272


>gi|251782760|ref|YP_002997063.1| ribonuclease BN [Streptococcus dysgalactiae subsp. equisimilis
           GGS_124]
 gi|242391390|dbj|BAH81849.1| ribonuclease BN [Streptococcus dysgalactiae subsp. equisimilis
           GGS_124]
 gi|323127604|gb|ADX24901.1| Ribonuclease BN [Streptococcus dysgalactiae subsp. equisimilis ATCC
           12394]
          Length = 318

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 112/243 (46%), Gaps = 13/243 (5%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           +L+ FP I+  AN+  +L     +  ++ ++    P+ I KP +  ++ + + P+  +  
Sbjct: 43  ILTAFPLIIIAANIFPYLNID--IADLLRLMKQNLPKDIFKPASSIVVNIFSKPSGSVLG 100

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI----SFGYVLLASVTLVIMSF 151
           ++ L   +  S  + +L+ ++N+AY   + R ++I  L+    S   + L +  L+  +F
Sbjct: 101 VATLTGFWTMSRSLTSLQKAINKAYGASQHRDFFIGHLVGLLTSLIILFLLTFALIFSTF 160

Query: 152 VFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIMSI 210
              AI +   +           LL+I       T+L +F+GL+ ++  LP  K  KI  I
Sbjct: 161 SKAAIQVLDNHYNLSDNITTAFLLLIQP----ITVLIIFVGLMLLYFLLPNVKIKKIRYI 216

Query: 211 LPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY--MLGVFFILGAEL 268
           LPG IFT       + L  +Y+V             S+M  ++ L+   L    ILGA  
Sbjct: 217 LPGTIFTSFVMTFLSNLVGNYVVHNVEKMVDIKTFGSVMIFIIMLWFIFLARILILGAIF 276

Query: 269 NAS 271
           NA+
Sbjct: 277 NAT 279


>gi|227530303|ref|ZP_03960352.1| ribonuclease BN [Lactobacillus vaginalis ATCC 49540]
 gi|227349780|gb|EEJ40071.1| ribonuclease BN [Lactobacillus vaginalis ATCC 49540]
          Length = 317

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 121/257 (47%), Gaps = 2/257 (0%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           ++HF      + A+ ++   LLS+FP ++   NL   +G      TV+  +    P  + 
Sbjct: 31  VKHFTLAQLSSSAATLAYYTLLSIFPALLVIGNLLPMIGLD--ANTVLTYLQTLVPATVY 88

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
             I   +L  L   + G+ T  AL A + +S G+ A + S+N AY + E ++    R+IS
Sbjct: 89  SFIRPLVLDFLQRGSGGVLTTGALIALWSTSQGIAAFQRSVNHAYGIAENQNPISNRVIS 148

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIF 195
           F ++++  + + ++ F++      L +++ F       + +  + +   T   +FI L  
Sbjct: 149 FIWMIVVVIIIFVIVFLYGVGEQFLKWLQPFLHFNRRYIFLFSSLKWPITFAVIFIALTM 208

Query: 196 VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFL 255
           ++ F+P AK  +     G     I W+  + LF  Y V FS     Y  + + +  +V+L
Sbjct: 209 LYYFVPNAKVGLRFAAIGAFLVSIFWLWLSKLFGLYTVLFSHGVIGYKTIGAFIAMMVWL 268

Query: 256 YMLGVFFILGAELNASM 272
              G   ++GA +NA++
Sbjct: 269 DFSGYLIMMGAAINAAL 285


>gi|149276231|ref|ZP_01882375.1| hypothetical protein PBAL39_00887 [Pedobacter sp. BAL39]
 gi|149232751|gb|EDM38126.1| hypothetical protein PBAL39_00887 [Pedobacter sp. BAL39]
          Length = 329

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/250 (22%), Positives = 123/250 (49%), Gaps = 8/250 (3%)

Query: 28  ASHISLSALLSVFPFIVFGANLAGFLGAH-QFVPTVIDVVFGAWPEVIAKPITDEILQVL 86
           AS ++ + +L++FP I+F   L  F+     F   +++ +    P    K     + +++
Sbjct: 54  ASSLAYNFMLALFPAIIFLFTLIPFIPKQIGFQERLMEFIVLILPYDAYKAFETTLNEIV 113

Query: 87  AVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTL 146
                 L +     + +F++NGV  L ++ N++  ++E RSW   RLI+    +  + ++
Sbjct: 114 NKQNGRLLSFGFFLSLFFATNGVHNLMMAFNKSSLIIETRSWVKQRLIAIVLTITIAFSV 173

Query: 147 VIMSFVFVAIPLALAYVRKFFPALGNLL-LIIWNGRIYATMLALFIGLIFVHLFLPAAKS 205
           ++ +       +AL Y+R      GN +  +I   R     +  F+ +  ++ + PA   
Sbjct: 174 ILCTVAMTLGEIALTYIRTGLHMKGNFIPYLIQLTRWSLLGILYFVTISILYRYGPAHAK 233

Query: 206 KIMSILPGVIFTWISWVVGAVL---FTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFF 262
           K      G   +W++ ++  +    F+ YI  FS+Y+ +Y  +++++  +++LY+  +  
Sbjct: 234 KWRFFSAG---SWLATILAFLTVWGFSFYINNFSSYNKVYGSISALIVLMIWLYLNSLIL 290

Query: 263 ILGAELNASM 272
           ++G ELNAS+
Sbjct: 291 LVGFELNASV 300


>gi|170739721|ref|YP_001768376.1| ribonuclease BN [Methylobacterium sp. 4-46]
 gi|168193995|gb|ACA15942.1| ribonuclease BN [Methylobacterium sp. 4-46]
          Length = 386

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/271 (23%), Positives = 127/271 (46%), Gaps = 12/271 (4%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI+Y     F ++   ++A+ ++   LL++FP I    +L G       +   + ++ G 
Sbjct: 89  DILYRVYVEFQKDRVLSVAAGVTFYTLLAIFPAIAALVSLYGLFTDPATINDHLSLLQGV 148

Query: 70  WPEVIAKPITDEILQVLAVPAK--GLFTISALAAAYFSSN-GVEALRISLNRAYRVVEMR 126
            P      I D++ ++ A      GL   ++LA + +S+N GV+A+  +LN  Y   E R
Sbjct: 149 LPSGALDIIGDQVKRITAKGGTTLGLTFFTSLAISLWSANAGVKAIFDALNIVYEEEEKR 208

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKF----FPALGNLLLIIWNGRI 182
           S+    L S  + L   + +V      V +P+ L +V  F     P    + L+ W    
Sbjct: 209 SFIRLNLQSLAFTLGGLLFVVFALTGIVVLPVILNFVGTFGISISPKAWYIALLRWP--- 265

Query: 183 YATMLALFIGLIFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
              +  L + L  ++ + P+  K +   + PG +   + W++G++ F+ Y+  F +Y+  
Sbjct: 266 -ILLAVLLLALAVLYRYGPSRDKPQWRWVTPGSLIAGVVWIIGSIAFSWYVAHFGSYNET 324

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           Y  L + +  + ++++     +LG E+NA +
Sbjct: 325 YGSLGAAVGFMTWIWISATIVLLGGEINAEL 355


>gi|238917097|ref|YP_002930614.1| hypothetical protein EUBELI_01167 [Eubacterium eligens ATCC 27750]
 gi|238872457|gb|ACR72167.1| Hypothetical protein EUBELI_01167 [Eubacterium eligens ATCC 27750]
          Length = 284

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 119/259 (45%), Gaps = 19/259 (7%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP----TVIDVVFGAWPEVIAK 76
           E+     AS      +LS FPF +      G L   +F+P     ++ V++G  P  + +
Sbjct: 17  EDRIGDYASSACYYLMLSFFPFFI------GLLSLIKFLPVSKADLLKVIYGVLPTQL-Q 69

Query: 77  PITDEIL-QVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
           PI   +L  +       L  I+A+A  + +  G  A+   L + YR    ++W   R+ +
Sbjct: 70  PIVQAMLTDIYDNSTTALTLITAIAIIWAAGKGFMAIVRGLKQIYRKDNQKNWLFQRIRA 129

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLI---IWNGR--IYATMLALF 190
             Y L+  + ++    + V     + +  K+ P L N+++I   I+N +  ++ ++  LF
Sbjct: 130 SIYALIFMILIIASLILMVFGNNIMNFTMKYIPQLTNVVVIFRGIFNSKHFLFPSIFTLF 189

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
             + F    +     K    +PG  F+ + W +   L++ Y+     +S MY  LA+I+ 
Sbjct: 190 FTIAFS--LVSRRGKKFYKEIPGAFFSALGWYLFTALYSLYVGHSPNFSYMYGSLATIII 247

Query: 251 CLVFLYMLGVFFILGAELN 269
            L+++Y   +   +GAE+N
Sbjct: 248 ALIWMYACMIIIFIGAEIN 266


>gi|258447867|ref|ZP_05696001.1| ribonuclease BN [Staphylococcus aureus A6224]
 gi|257858799|gb|EEV81668.1| ribonuclease BN [Staphylococcus aureus A6224]
          Length = 405

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 103/201 (51%), Gaps = 11/201 (5%)

Query: 82  ILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLL 141
           I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  + +L+S    ++
Sbjct: 141 IGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGIVLKLLS----VV 196

Query: 142 ASVTLVIMSFVFVAIPLALAYVRKF-FPALGNLLLIIW--NGRIYATMLALFIGLIFV-H 197
            +V + ++  V +A+P   + +  F F  LG    + W  N       + +   +  V +
Sbjct: 197 FTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIIIFIIFIVLY 256

Query: 198 LFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
              P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+  L++LY+
Sbjct: 257 SVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGIIILLLWLYI 316

Query: 258 LGVFFILGAELNASMIIYYWR 278
                I+GAE+NA   I++ R
Sbjct: 317 TSFIIIVGAEINA---IFHQR 334


>gi|150025898|ref|YP_001296724.1| hypothetical protein FP1855 [Flavobacterium psychrophilum JIP02/86]
 gi|149772439|emb|CAL43921.1| Protein of unknown function YfkH [Flavobacterium psychrophilum
           JIP02/86]
          Length = 315

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/262 (22%), Positives = 124/262 (47%), Gaps = 15/262 (5%)

Query: 28  ASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLA 87
           A+ ++ S  +++FPF++F  NL  ++    F    +  V    P      I + I  +L 
Sbjct: 55  AAAVAWSFFMALFPFMLFILNLIPYIPITGFQEDFLGFVRANVPPTTFDAIDNIINDILH 114

Query: 88  VPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW--------YITRLISFGYV 139
               GL +   + + +  +NGV A+      +  +VE R++        +I+ L++F  +
Sbjct: 115 NSHSGLLSTGGILSVFLMTNGVNAVMSGFETSQHIVEKRAYFRQYFVALFISMLLTF--I 172

Query: 140 LLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLF 199
           LL +V+ +I+  VF+   +    +      + + + +I  GR    ++ + + +  +  F
Sbjct: 173 LLITVSAIIIFEVFIQRTIIQDVLSS---RISDKISLIEFGRYSFIIIMIIMSIGILFKF 229

Query: 200 LPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLG 259
                 K   I  GV+FT I  ++ +  F  ++V FS Y+ +Y  + +++  + +L++  
Sbjct: 230 GIRQTRKRAFITIGVVFTTILIILSSYFFGIWVVRFSKYNELYGSIGTLLIVMFYLWLNC 289

Query: 260 VFFILGAELNASMIIYYWRKKP 281
           +  +LG EL+AS  IY  +  P
Sbjct: 290 MVLLLGFELDAS--IYKLKHHP 309


>gi|296114390|ref|ZP_06833044.1| ribonuclease BN [Gluconacetobacter hansenii ATCC 23769]
 gi|295979151|gb|EFG85875.1| ribonuclease BN [Gluconacetobacter hansenii ATCC 23769]
          Length = 397

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 117/251 (46%), Gaps = 13/251 (5%)

Query: 35  ALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLF 94
           A LS+FP +    ++ G L   Q V   + V+    P      I D I  VL   +    
Sbjct: 111 ATLSLFPAMSTMISIYGLLFDPQTVEPQLVVLRNLLPPAAYDLICDRI-HVLVAQSHSSL 169

Query: 95  T----ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL-LASVTLVIM 149
           T    +S   A + +S    +L +++N AY   E RS+   R  + G ++ L ++   I+
Sbjct: 170 TLNLIVSTTIAMWSASAATRSLLLAMNVAYNTPETRSFL--RFQAMGMIMTLCAICGGIL 227

Query: 150 SF-VFVAIPLALAYVRK---FFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKS 205
           +  + VA+P+ L Y+ +     P  G+L L++  G     +L +  G   ++ F P  +S
Sbjct: 228 TLALMVALPILLDYLPQKLSLAPPPGSLELLVRMGGPALMLLFVLSGCSLLYRFGPNRRS 287

Query: 206 KI-MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFIL 264
                ILPG +   + W++ +  F++Y+   + Y   Y  L + +  +++ Y+     +L
Sbjct: 288 PSWRCILPGSVAATLLWLLTSFGFSYYVSHIAGYGATYGPLGAFVATMMWFYVSAYVVLL 347

Query: 265 GAELNASMIIY 275
           GAELNA + I 
Sbjct: 348 GAELNAGLEIQ 358


>gi|118589631|ref|ZP_01547036.1| ribonuclease BN, putative [Stappia aggregata IAM 12614]
 gi|118437717|gb|EAV44353.1| ribonuclease BN, putative [Stappia aggregata IAM 12614]
          Length = 317

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 117/256 (45%), Gaps = 20/256 (7%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVL 86
           +A+ ++   LL++FP I     L+G +     V   ++++    P   ++ I  +   V 
Sbjct: 37  IAAGVAFYGLLAIFPTITALTALSGLIVEPVEVSRQLELIESVLPHEASQIILAQAADVA 96

Query: 87  AVPAKGL---FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLAS 143
                GL     I    A Y +S G+ ++   LN AY  VE RS+   ++ +    LL  
Sbjct: 97  GSENAGLSFALIIGLGIAIYSTSRGMASIMEGLNIAYDEVEKRSFIALKVRTLAMALLLV 156

Query: 144 VTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLI------FVH 197
           +  V+     + +P+  +Y          L L  W  RI ++   + +GL+      FV+
Sbjct: 157 LAFVLGLVSALLLPVIFSY----------LALPEWLERILSSARWIILGLLTVTGLSFVY 206

Query: 198 LFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
            F P+   +K   I PG +   + W+  +  F+ Y+  F++Y+  +  LA ++  L++L+
Sbjct: 207 RFGPSRTDAKWKWITPGAVVACLLWLAASYGFSVYVSNFASYNKTFGSLAGVIILLMWLW 266

Query: 257 MLGVFFILGAELNASM 272
           +     +LGAELN  M
Sbjct: 267 ISAYIVLLGAELNGEM 282


>gi|332188562|ref|ZP_08390281.1| hypothetical protein SUS17_3692 [Sphingomonas sp. S17]
 gi|332011406|gb|EGI53492.1| hypothetical protein SUS17_3692 [Sphingomonas sp. S17]
          Length = 323

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 112/256 (43%), Gaps = 9/256 (3%)

Query: 22  EDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDE 81
            DG+  A +++  AL+++FPF +  A L    G        ++      P  ++  +   
Sbjct: 49  NDGFIHAGNLAYLALMTLFPFFITTAALLSLFGQSNETQHAVESFLHVLPPDVSDLLRKP 108

Query: 82  ILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLL 141
           I  VLA     L  +  L   +     +E +R   +RAY V    +++ +RL S   V++
Sbjct: 109 IADVLAARTGSLLWLGGLVGLWTVGGFIETIRDIFHRAYGVKATAAFWKSRLSST-LVIV 167

Query: 142 ASVTLVIMSFVFVAI-PLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFL 200
           ASV + ++SF+   +   A  ++ +  P   +  +  W G       A+  G +++ LF 
Sbjct: 168 ASVVIALLSFLVAGVLTAAEQFIYRLVPFAQD--VAGWVGLSRFIPGAVMFGALYM-LFY 224

Query: 201 PAAKSKIMSIL----PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
               SK         PG +FT   WV    L    +     Y   Y  LA ++  L+F Y
Sbjct: 225 SVTPSKYRESDCPKWPGALFTAAWWVSMTALLPVVLSQLGGYDLTYGSLAGVVVMLLFFY 284

Query: 257 MLGVFFILGAELNASM 272
           ++G+  + GA LNA++
Sbjct: 285 LIGLGLVFGAHLNAAL 300


>gi|170741936|ref|YP_001770591.1| ribonuclease BN [Methylobacterium sp. 4-46]
 gi|168196210|gb|ACA18157.1| ribonuclease BN [Methylobacterium sp. 4-46]
          Length = 348

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 122/252 (48%), Gaps = 9/252 (3%)

Query: 26  AMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQV 85
           A A  ++  ALL+VFP +    +L G +     +   + ++ G  P+ +   +  E+ +V
Sbjct: 69  ATAGGVAFFALLAVFPGLALIVSLYGLVADPGAIYKHLSLLTGLLPQAVLDLLAAELSRV 128

Query: 86  LAVPAKGLFTISALA--AAYFSSN-GVEALRISLNRAYRVVEMRSWYITRLISFGYVLLA 142
                  L   S ++   A++S+N GV AL  +LN  Y+  E R        +F + L  
Sbjct: 129 AGKSTGALGAASGVSLLVAFWSANSGVSALFDALNVIYKEREKRPLLHFYATTFLFTLTG 188

Query: 143 SVTLVIMSFVFVAIPLALAYVR-KFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLP 201
            +  ++ + + VA+P+ L  V  + + +   L L+ W     A ++ + +GL  ++ + P
Sbjct: 189 VLFALVATGMVVALPVVLNQVGFQSYASDAALRLLRWP----ALLVLVSLGLAAIYRYGP 244

Query: 202 AA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGV 260
           +  ++K   +  G     + WV  + LF+ Y+  F +Y+ MY  L + +  + +++   V
Sbjct: 245 SRHEAKWRWVTWGSGIAALLWVCASALFSWYVARFDSYNRMYGSLGAGVGFMTWIWFSIV 304

Query: 261 FFILGAELNASM 272
             +LGAELNA M
Sbjct: 305 IVLLGAELNAEM 316


>gi|302670427|ref|YP_003830387.1| YihY family protein [Butyrivibrio proteoclasticus B316]
 gi|302394900|gb|ADL33805.1| YihY family protein [Butyrivibrio proteoclasticus B316]
          Length = 265

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 90/178 (50%), Gaps = 1/178 (0%)

Query: 92  GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
            +F+ISA+A+ +  + G+ AL   LN  Y V E R+++  RLI+  Y +   V ++IM  
Sbjct: 48  AVFSISAVASIWTGALGMLALIRGLNIIYDVDERRNYFYLRLIAAFYTIAMIVIVLIMLV 107

Query: 152 VFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSIL 211
           + V        +   +P +   +    N +    +         ++ F+P+A+ K +  L
Sbjct: 108 IMVFGDFVKQLIMNAYPHVWTAISFFVNFKFIMVIGIATFAFAMIYTFIPSARMKFIYQL 167

Query: 212 PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
           PG +F+ I W V + LF+ Y+    TYS +Y  LA+ +  + +LY     F++GA +N
Sbjct: 168 PGALFSAIVWYVFSWLFSLYVSLPDTYS-IYGSLATPVIMMFWLYFCIYIFLIGAFIN 224


>gi|226945350|ref|YP_002800423.1| Ribonuclease BN protein [Azotobacter vinelandii DJ]
 gi|226720277|gb|ACO79448.1| Ribonuclease BN protein [Azotobacter vinelandii DJ]
          Length = 289

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 88/180 (48%), Gaps = 2/180 (1%)

Query: 92  GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
           GLF++  +AA + +S GV +   ++N+AY V E R  +    +S  Y +  ++ L+  + 
Sbjct: 94  GLFSLGIVAALWTASAGVRSTMQAMNKAYDVAESRPAWKRIPLSVLYTVGIALMLLSAAG 153

Query: 152 VFVAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFIGLIFVHLFLPAAKSKIMSI 210
           + +  P  + ++  +   L  L++ +W   R    +L L + +  ++   P  + +   I
Sbjct: 154 LMLIGPEVMTWLAGWV-GLEQLIVTLWTWLRWPVAILLLILVVAVIYYVAPDVEQRFRFI 212

Query: 211 LPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
            PG +   + W+  ++ F  Y+  F  Y   Y  + +I+  L++ ++     + GAELNA
Sbjct: 213 TPGSVLAVLVWIATSLGFGFYVGNFGNYDATYGSVGAIIVMLLYFFISAAVLLFGAELNA 272


>gi|253314945|ref|ZP_04838158.1| hypothetical protein SauraC_01970 [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
          Length = 291

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 99/193 (51%), Gaps = 8/193 (4%)

Query: 82  ILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLL 141
           I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  + +L+S    ++
Sbjct: 17  IGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGIVLKLLS----VV 72

Query: 142 ASVTLVIMSFVFVAIPLALAYVRKF-FPALGNLLLIIW--NGRIYATMLALFIGLIFV-H 197
            +V + ++  V +A+P   + +  F F  LG    + W  N       + +   +  V +
Sbjct: 73  FTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIIIFIIFIVLY 132

Query: 198 LFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
              P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+  L++LY+
Sbjct: 133 SVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGIIILLLWLYI 192

Query: 258 LGVFFILGAELNA 270
                I+GAE+NA
Sbjct: 193 TSFIIIVGAEINA 205


>gi|57652102|ref|YP_186766.1| ribonuclease BN, putative [Staphylococcus aureus subsp. aureus COL]
 gi|57286288|gb|AAW38382.1| ribonuclease BN, putative [Staphylococcus aureus subsp. aureus COL]
          Length = 405

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 96/183 (52%), Gaps = 8/183 (4%)

Query: 92  GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
           GL +I  + A + +SNG+ A+  S N AY V + R+  + +L+S    ++ +V + ++  
Sbjct: 151 GLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGIVLKLLS----VVFTVVMGVVFV 206

Query: 152 VFVAIPLALAYVRKF-FPALGNLLLIIW--NGRIYATMLALFIGLIFV-HLFLPAAKSKI 207
           V +A+P   + +  F F  LG    + W  N       + +   +  V +   P  K+K+
Sbjct: 207 VALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIIIFIIFIVLYSVAPNVKTKL 266

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAE 267
            S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+  L++LY+     I+GAE
Sbjct: 267 KSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGIIILLLWLYITSFIIIVGAE 326

Query: 268 LNA 270
           +NA
Sbjct: 327 INA 329


>gi|15927457|ref|NP_374990.1| hypothetical protein SA1699 [Staphylococcus aureus subsp. aureus
           N315]
 gi|87160245|ref|YP_494516.1| hypothetical protein SAUSA300_1864 [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88195779|ref|YP_500588.1| hypothetical protein SAOUHSC_02097 [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|148268355|ref|YP_001247298.1| ribonuclease BN [Staphylococcus aureus subsp. aureus JH9]
 gi|150394417|ref|YP_001317092.1| ribonuclease BN [Staphylococcus aureus subsp. aureus JH1]
 gi|151222033|ref|YP_001332855.1| ribonuclease BN [Staphylococcus aureus subsp. aureus str. Newman]
 gi|161510102|ref|YP_001575761.1| ribonuclease BN [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221141456|ref|ZP_03565949.1| hypothetical protein SauraJ_07428 [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|253729641|ref|ZP_04863806.1| ribonuclease BN [Staphylococcus aureus subsp. aureus USA300_TCH959]
 gi|257793763|ref|ZP_05642742.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|258408905|ref|ZP_05681187.1| conserved hypothetical protein [Staphylococcus aureus A9763]
 gi|258420991|ref|ZP_05683922.1| ribonuclease BN [Staphylococcus aureus A9719]
 gi|258430037|ref|ZP_05688407.1| ribonuclease BN [Staphylococcus aureus A9299]
 gi|258443445|ref|ZP_05691787.1| ribonuclease BN [Staphylococcus aureus A8115]
 gi|258445303|ref|ZP_05693494.1| ribonuclease BN [Staphylococcus aureus A6300]
 gi|258453300|ref|ZP_05701285.1| ribonuclease BN [Staphylococcus aureus A5937]
 gi|269203535|ref|YP_003282804.1| ribonuclease BN, putative [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282894548|ref|ZP_06302776.1| hypothetical protein SGAG_01896 [Staphylococcus aureus A8117]
 gi|282923219|ref|ZP_06330900.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|282928055|ref|ZP_06335662.1| conserved hypothetical protein [Staphylococcus aureus A10102]
 gi|294849428|ref|ZP_06790170.1| hypothetical protein SKAG_01510 [Staphylococcus aureus A9754]
 gi|295407261|ref|ZP_06817060.1| hypothetical protein SMAG_02434 [Staphylococcus aureus A8819]
 gi|296275884|ref|ZP_06858391.1| hypothetical protein SauraMR_06032 [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297246212|ref|ZP_06930063.1| hypothetical protein SLAG_02294 [Staphylococcus aureus A8796]
 gi|304379067|ref|ZP_07361814.1| YihY family protein [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|13701676|dbj|BAB42969.1| SA1699 [Staphylococcus aureus subsp. aureus N315]
 gi|87126219|gb|ABD20733.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87203337|gb|ABD31147.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|147741424|gb|ABQ49722.1| putative ribonuclease BN [Staphylococcus aureus subsp. aureus JH9]
 gi|149946869|gb|ABR52805.1| putative ribonuclease BN [Staphylococcus aureus subsp. aureus JH1]
 gi|150374833|dbj|BAF68093.1| ribonuclease BN [Staphylococcus aureus subsp. aureus str. Newman]
 gi|160368911|gb|ABX29882.1| possible ribonuclease BN [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253726637|gb|EES95366.1| ribonuclease BN [Staphylococcus aureus subsp. aureus USA300_TCH959]
 gi|257787735|gb|EEV26075.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|257840352|gb|EEV64814.1| conserved hypothetical protein [Staphylococcus aureus A9763]
 gi|257842939|gb|EEV67357.1| ribonuclease BN [Staphylococcus aureus A9719]
 gi|257849631|gb|EEV73599.1| ribonuclease BN [Staphylococcus aureus A9299]
 gi|257851330|gb|EEV75270.1| ribonuclease BN [Staphylococcus aureus A8115]
 gi|257855821|gb|EEV78745.1| ribonuclease BN [Staphylococcus aureus A6300]
 gi|257864508|gb|EEV87251.1| ribonuclease BN [Staphylococcus aureus A5937]
 gi|262075825|gb|ACY11798.1| ribonuclease BN, putative [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269941354|emb|CBI49751.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282590119|gb|EFB95200.1| conserved hypothetical protein [Staphylococcus aureus A10102]
 gi|282593130|gb|EFB98129.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|282763035|gb|EFC03167.1| hypothetical protein SGAG_01896 [Staphylococcus aureus A8117]
 gi|285817563|gb|ADC38050.1| Ribonuclease BN [Staphylococcus aureus 04-02981]
 gi|294823565|gb|EFG39992.1| hypothetical protein SKAG_01510 [Staphylococcus aureus A9754]
 gi|294967836|gb|EFG43866.1| hypothetical protein SMAG_02434 [Staphylococcus aureus A8819]
 gi|297176919|gb|EFH36176.1| hypothetical protein SLAG_02294 [Staphylococcus aureus A8796]
 gi|302751755|gb|ADL65932.1| putative membrane protein [Staphylococcus aureus subsp. aureus str.
           JKD6008]
 gi|304342302|gb|EFM08194.1| YihY family protein [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312830255|emb|CBX35097.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ECT-R 2]
 gi|315129310|gb|EFT85304.1| hypothetical protein CGSSa03_08610 [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|315196045|gb|EFU26405.1| hypothetical protein CGSSa01_12032 [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320139739|gb|EFW31608.1| YihY family protein [Staphylococcus aureus subsp. aureus MRSA131]
 gi|320142345|gb|EFW34159.1| YihY family protein [Staphylococcus aureus subsp. aureus MRSA177]
 gi|329314559|gb|AEB88972.1| Ribonuclease BN [Staphylococcus aureus subsp. aureus T0131]
 gi|329724799|gb|EGG61303.1| YihY family protein [Staphylococcus aureus subsp. aureus 21172]
 gi|329728613|gb|EGG65043.1| YihY family protein [Staphylococcus aureus subsp. aureus 21189]
          Length = 405

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 96/183 (52%), Gaps = 8/183 (4%)

Query: 92  GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
           GL +I  + A + +SNG+ A+  S N AY V + R+  + +L+S    ++ +V + ++  
Sbjct: 151 GLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGIVLKLLS----VVFTVVMGVVFV 206

Query: 152 VFVAIPLALAYVRKF-FPALGNLLLIIW--NGRIYATMLALFIGLIFV-HLFLPAAKSKI 207
           V +A+P   + +  F F  LG    + W  N       + +   +  V +   P  K+K+
Sbjct: 207 VALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIIIFIIFIVLYSVAPNVKTKL 266

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAE 267
            S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+  L++LY+     I+GAE
Sbjct: 267 KSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGIIILLLWLYITSFIIIVGAE 326

Query: 268 LNA 270
           +NA
Sbjct: 327 INA 329


>gi|119715572|ref|YP_922537.1| putative ribonuclease BN [Nocardioides sp. JS614]
 gi|119536233|gb|ABL80850.1| putative ribonuclease BN [Nocardioides sp. JS614]
          Length = 377

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/262 (22%), Positives = 129/262 (49%), Gaps = 7/262 (2%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG-AHQFVPTVIDVVFGAWPEVI 74
           +  F ++    +A+ ++  A+L+VFP  +   +L G +G     V T++ +V       +
Sbjct: 61  VREFSDDQCTDLAAALTYYAVLAVFPAAIALTSLLGLVGQGTSSVETLLGIVDDLGGASV 120

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRS-WYITR 132
            K + D ++++    A GL  +  LA A +S++G V A   ++NR Y + E R  W +  
Sbjct: 121 VKSVHDPLIEISRSQAAGLAFVLGLAGALWSASGYVGAFGRAMNRIYEIREGRPVWKLRP 180

Query: 133 LISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFI 191
           L+    ++L ++   ++  + V  P+A +        +G+ LL +WN  +     LA+ +
Sbjct: 181 LMLLLTLVLVTLAAAVLLALVVTGPVADSVGSAL--GVGSTLLGVWNIAKWPVIALAVVV 238

Query: 192 GLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
            +  ++   P  +  +   +  G +   ++W + ++ F  Y+  FS+Y   Y  L  ++ 
Sbjct: 239 MVALLYYATPNVRQPRFRWVSVGAVLAIVTWALVSLAFGFYVANFSSYDKTYGALGGVIA 298

Query: 251 CLVFLYMLGVFFILGAELNASM 272
            L+++++  +  + GAEL+A +
Sbjct: 299 FLLWVWLTNLALLFGAELDAEL 320


>gi|258451051|ref|ZP_05699087.1| conserved hypothetical protein [Staphylococcus aureus A5948]
 gi|257861293|gb|EEV84105.1| conserved hypothetical protein [Staphylococcus aureus A5948]
          Length = 405

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 96/183 (52%), Gaps = 8/183 (4%)

Query: 92  GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
           GL +I  + A + +SNG+ A+  S N AY V + R+  + +L+S    ++ +V + ++  
Sbjct: 151 GLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGIVLKLLS----VVFTVVMGVVFV 206

Query: 152 VFVAIPLALAYVRKF-FPALGNLLLIIW--NGRIYATMLALFIGLIFV-HLFLPAAKSKI 207
           V +A+P   + +  F F  LG    + W  N       + +   +  V +   P  K+K+
Sbjct: 207 VALALPTLGSIISHFLFGPLGFDEQVKWIFNLIRIVLPIIIIFIIFIVLYSVAPNVKTKL 266

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAE 267
            S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+  L++LY+     I+GAE
Sbjct: 267 KSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGIIILLLWLYITSFIIIVGAE 326

Query: 268 LNA 270
           +NA
Sbjct: 327 INA 329


>gi|254465241|ref|ZP_05078652.1| ribonuclease BN [Rhodobacterales bacterium Y4I]
 gi|206686149|gb|EDZ46631.1| ribonuclease BN [Rhodobacterales bacterium Y4I]
          Length = 315

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 119/253 (47%), Gaps = 14/253 (5%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVL 86
           +A+ ++   L+++FP I     + G +     +   I  + G  P+ + + I  +  QV 
Sbjct: 37  IAAGVAFYGLMALFPAITALLAIGGLMVEPAQIVDQISQLEGVVPDEVMEIIIGQATQV- 95

Query: 87  AVPAKGLFTISALA----AAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLA 142
           A   +G   ++A+A    A Y +S G+ +L   +N AY   E R +++   ++    L  
Sbjct: 96  AGSREGGLGLAAVAGILIALYSASKGMNSLIEGMNVAYDEEEKRGFFMKTFVTLVLTLFL 155

Query: 143 SVTLVIMSFVFVAIP--LALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFL 200
              L++     +A+P  +AL        ALG LL   W   +  TM     GL  ++ + 
Sbjct: 156 IAGLLMGLLAALAVPSVIALVDAGPVIEALGTLL--AWGVLLVMTM----AGLAVLYRYG 209

Query: 201 PA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLG 259
           P+  K +++   PG     + W+ G+  F  Y+  F +Y+  +  LA ++  L++L++  
Sbjct: 210 PSRDKPELLWTSPGAAAACVLWLAGSAGFAFYVGNFGSYNESFGALAGVVVLLMWLWISA 269

Query: 260 VFFILGAELNASM 272
              +LGAE+NA +
Sbjct: 270 FIVLLGAEINAEV 282


>gi|315660133|ref|ZP_07912990.1| YihY family protein [Staphylococcus lugdunensis M23590]
 gi|315494814|gb|EFU83152.1| YihY family protein [Staphylococcus lugdunensis M23590]
          Length = 409

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 68/256 (26%), Positives = 127/256 (49%), Gaps = 14/256 (5%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT-VIDVVFGAWPEVIAKPIT 79
           ++D   +A+ ++   +L++FP ++F   L       Q  P  V D+V    P   A  ++
Sbjct: 80  KDDASGLAAQMTYHFVLALFPMLIFLLTLLPLF---QIDPQQVKDMVSQNAPAETASVVS 136

Query: 80  DEILQVLAVPAKG-LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGY 138
            +I   +   A G + ++  +   + +SNG+ A+  S N AY V + R+  + +L+S  +
Sbjct: 137 -KIFNDITKNASGSILSVGLILTIWSASNGMTAIMNSFNVAYDVEDGRNPIVLKLLSVVF 195

Query: 139 VLLASVTLVIMSFVFVAIPLALAYVRK-FFPALGNLLLIIWNG---RIYATMLALFIGLI 194
            ++  + L     V + +P    +++   F A+G    + W     R+    + + +  I
Sbjct: 196 TVVMGLVLA----VALTLPTFGTFIKDHLFGAIGLDKQVAWIFDLIRVILPFIIILLLFI 251

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++   P  K+KI S+ PG +FT I W++G+  F  Y+  F  YS  Y  LA I+  L++
Sbjct: 252 TLYSVAPNVKTKIKSVFPGALFTSIIWLLGSFGFGWYLSNFGNYSKTYGSLAGIIILLLW 311

Query: 255 LYMLGVFFILGAELNA 270
           LY+     I+GAE+NA
Sbjct: 312 LYITCFIIIIGAEINA 327


>gi|170745562|ref|YP_001767019.1| ribonuclease BN [Methylobacterium radiotolerans JCM 2831]
 gi|170659163|gb|ACB28217.1| ribonuclease BN [Methylobacterium radiotolerans JCM 2831]
          Length = 351

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 68/273 (24%), Positives = 129/273 (47%), Gaps = 20/273 (7%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D+++  +  F  +   A A  ++  ALL+ FP +    ++         +   + ++ G 
Sbjct: 57  DVLFRVVYSFPRDRVLATAGGVAFFALLATFPALATIVSVYSLFADPHAISQHVSLLAGV 116

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P  +   ++D++++V       L T   +S L A + +++GV AL  +LN  YR  E R
Sbjct: 117 LPSGVLDLLSDQLIRVAQQSTGALSTASLVSVLIAFWSANSGVSALFDALNVIYREREKR 176

Query: 127 S----WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGN--LLLIIWNG 180
           S    +  T L +   +L A   L   S V V +P+AL  +     AL +  L L+ W G
Sbjct: 177 SLMRFYATTFLFTLSGILFA---LTATSLVVV-LPIALNQL--GLGALTDALLRLVRWPG 230

Query: 181 RIYATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                ++ + +GL   + + P  +  K   +  G     +SWV  +V F+ Y+ +F +Y+
Sbjct: 231 ----LLILVSLGLAVTYRYGPGRRDAKWRWVSWGGAAAAVSWVCASVSFSWYVASFDSYN 286

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
            +Y  L + +  + +++   V  +LGA+LNA +
Sbjct: 287 RIYGSLGAGIGFMTWIWFSVVIVLLGAKLNAEI 319


>gi|88812085|ref|ZP_01127337.1| Ribonuclease BN [Nitrococcus mobilis Nb-231]
 gi|88790589|gb|EAR21704.1| Ribonuclease BN [Nitrococcus mobilis Nb-231]
          Length = 331

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 118/261 (45%), Gaps = 30/261 (11%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVL 86
           +A+ ++  ALLS+FP +V   +L G +     V        G  PE  A+ +  + LQ +
Sbjct: 50  IAAGVAFYALLSIFPALVAIVSLYGLVANPADVQQQFTHYGGILPEE-AQLLISQQLQRI 108

Query: 87  AVPAKGLFTISALAAAYFS----SNGVEALRISLNRAYRVVEMRSW----YITRLISFGY 138
              A    +   ++   F+    + G +A  ++LN  Y   E R +     I  +I+FG 
Sbjct: 109 TASATSAMSAGVISGVLFAVWSATRGTKAFMLALNIVYNEKEKRGFLQFNKIALMITFGM 168

Query: 139 VLLAS------VTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIG 192
           ++L        VTL I+    + +P AL+ V  FFP L           + +     ++ 
Sbjct: 169 IMLVVLALGLIVTLPIL-LSILNLPGALSTVLSFFPWL-----------LLSGCFVFWLA 216

Query: 193 LIFVHLFLPAAKSKIMS-ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
           ++F   + P+      + +  G I   + WV+ ++LF+ Y+  F  Y+  Y  + +I+  
Sbjct: 217 MLF--RYGPSRSEPQWNWVSVGSIAATVLWVITSMLFSFYVGNFGKYANTYGSVGAIIIL 274

Query: 252 LVFLYMLGVFFILGAELNASM 272
           L++ Y+     + GAELNA M
Sbjct: 275 LLWFYLTAFVILFGAELNAQM 295


>gi|289550401|ref|YP_003471305.1| Ribonuclease BN [Staphylococcus lugdunensis HKU09-01]
 gi|289179933|gb|ADC87178.1| Ribonuclease BN [Staphylococcus lugdunensis HKU09-01]
          Length = 409

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 68/256 (26%), Positives = 127/256 (49%), Gaps = 14/256 (5%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT-VIDVVFGAWPEVIAKPIT 79
           ++D   +A+ ++   +L++FP ++F   L       Q  P  V D+V    P   A  ++
Sbjct: 80  KDDASGLAAQMTYHFVLALFPMLIFLLTLLPLF---QIDPQQVKDMVSQNAPAETASVVS 136

Query: 80  DEILQVLAVPAKG-LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGY 138
            +I   +   A G + ++  +   + +SNG+ A+  S N AY V + R+  + +L+S  +
Sbjct: 137 -KIFNDITKNASGSILSVGLILTIWSASNGMTAIMNSFNVAYDVEDGRNPIVLKLLSVVF 195

Query: 139 VLLASVTLVIMSFVFVAIPLALAYVRK-FFPALGNLLLIIWNG---RIYATMLALFIGLI 194
            ++  + L     V + +P    +++   F A+G    + W     R+    + + +  I
Sbjct: 196 TVVMGLVLA----VALTLPTFGTFIKDHLFGAIGLDKQVAWIFDLIRVILPFIIILLLFI 251

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++   P  K+KI S+ PG +FT I W++G+  F  Y+  F  YS  Y  LA I+  L++
Sbjct: 252 TLYSVAPNVKTKIKSVFPGALFTSIIWLLGSFGFGWYLSNFGNYSKTYGSLAGIIILLLW 311

Query: 255 LYMLGVFFILGAELNA 270
           LY+     I+GAE+NA
Sbjct: 312 LYITCFIIIIGAEINA 327


>gi|259503840|ref|ZP_05746742.1| ribonuclease BN [Lactobacillus antri DSM 16041]
 gi|259168219|gb|EEW52714.1| ribonuclease BN [Lactobacillus antri DSM 16041]
          Length = 332

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 123/258 (47%), Gaps = 4/258 (1%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           + HF      + A+ ++   LLS+FP ++   NL   +G      TV+  +  A P  + 
Sbjct: 52  MRHFTMAQISSSAAMLAYYTLLSIFPAVLVIGNLLPMVGLD--ANTVLSYLQTAVPSSVY 109

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
             I   I   L   + GL T  AL A + +S G+ A + S+N  Y V   ++  I R++S
Sbjct: 110 VFIKPLIYDFLRRGSGGLLTTGALIALWSTSQGIAAFQRSVNLTYDVARNQNPVINRVVS 169

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA-LFIGLI 194
           F ++++  + + ++  ++      L  ++ F        + ++N   +   LA LFI L 
Sbjct: 170 FIWMIVVIILIFVIVLLYGFGEQVLNSIQPFL-QFNRRYISLFNSLRWPVALAVLFIALT 228

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++ F+P AK ++     G +   + W+  + LF++Y V F      Y  + + +  +++
Sbjct: 229 LLYYFVPNAKVRLRYAATGALLAALLWMGLSRLFSYYTVFFRHSVVSYKTIGAFIAMMIW 288

Query: 255 LYMLGVFFILGAELNASM 272
           L + G   +LGA LNA++
Sbjct: 289 LDLSGYVIMLGAVLNATL 306


>gi|163746838|ref|ZP_02154195.1| ribonuclease BN, putative [Oceanibulbus indolifex HEL-45]
 gi|161379952|gb|EDQ04364.1| ribonuclease BN, putative [Oceanibulbus indolifex HEL-45]
          Length = 315

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 115/251 (45%), Gaps = 10/251 (3%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVL 86
           +A+ ++  ALL++FP +     LAG +     V   ++ +    PE  A  I D+ + V 
Sbjct: 37  VAAGVAFYALLAIFPAVTALMALAGLVMEPAQVTEQLEAITRLIPEEAATIILDQAIAVT 96

Query: 87  AVPAKGL---FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI-SFGYVLLA 142
                GL   F I    A Y +S GV +L   LN AY   E R  ++T+LI + G  L+ 
Sbjct: 97  GSEETGLGWAFLIGVGLALYSASKGVGSLMEGLNVAYDEDETRG-FVTKLIWTLGLTLML 155

Query: 143 SVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPA 202
              L++     +A+P  + ++    P     LL    G          + L  ++ + PA
Sbjct: 156 VGVLLLGLGATLAVPAVVNFLA--LPDWFETLLTY--GSWVLLAALTVLALAVLYRYGPA 211

Query: 203 AKSKIMSIL-PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVF 261
             +     L PG +   + W+V +V F+ Y+  F +Y+  +  +A  +  L++L++    
Sbjct: 212 RDNAEWKWLTPGSVIACVLWIVASVGFSIYVSNFGSYNESFGSMAGAIILLMWLWISAFI 271

Query: 262 FILGAELNASM 272
            +LGAE N+ M
Sbjct: 272 VLLGAEFNSEM 282


>gi|315193410|gb|EFU23807.1| hypothetical protein CGSSa00_04751 [Staphylococcus aureus subsp.
           aureus CGS00]
          Length = 380

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 104/193 (53%), Gaps = 8/193 (4%)

Query: 82  ILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLL 141
           I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  + +L+S    ++
Sbjct: 141 IGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGIVLKLLS----VV 196

Query: 142 ASVTLVIMSFVFVAIPLALAYVRKF-FPALGNLLLIIW--N-GRIYATMLALFIGLIFVH 197
            +V + ++  V +A+P   + +  F F  LG    + W  N  RI   ++ +FI  I ++
Sbjct: 197 FTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIIIFIVFIVLY 256

Query: 198 LFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
              P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+  L++LY+
Sbjct: 257 SVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGIIILLLWLYI 316

Query: 258 LGVFFILGAELNA 270
                I+GAE+NA
Sbjct: 317 TSFIIIVGAEINA 329


>gi|82751536|ref|YP_417277.1| hypothetical protein SAB1815 [Staphylococcus aureus RF122]
 gi|82657067|emb|CAI81504.1| probable membrane protein [Staphylococcus aureus RF122]
          Length = 405

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 104/193 (53%), Gaps = 8/193 (4%)

Query: 82  ILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLL 141
           I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  + +L+S    ++
Sbjct: 141 IGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGIVLKLLS----VV 196

Query: 142 ASVTLVIMSFVFVAIPLALAYVRKF-FPALGNLLLIIW--N-GRIYATMLALFIGLIFVH 197
            +V + ++  V +A+P   + +  F F  LG    + W  N  RI   ++ +FI  I ++
Sbjct: 197 FTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIIIFIVFIVLY 256

Query: 198 LFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
              P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+  L++LY+
Sbjct: 257 SVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGIIILLLWLYI 316

Query: 258 LGVFFILGAELNA 270
                I+GAE+NA
Sbjct: 317 TSFIIIVGAEINA 329


>gi|170780894|ref|YP_001709226.1| putative integral membrane protein [Clavibacter michiganensis
           subsp. sepedonicus]
 gi|169155462|emb|CAQ00570.1| putative integral membrane protein [Clavibacter michiganensis
           subsp. sepedonicus]
          Length = 363

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 128/270 (47%), Gaps = 13/270 (4%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG-AHQFVPTVIDVVFGA 69
           ++   +  F  +    +A+ ++  A+LS+FP ++   +L G  G     V  V+D++ G 
Sbjct: 36  VLRKTMREFGTDQCTDIAASLTYYAVLSLFPALIAIISLLGVFGQGESTVSAVLDLLRGF 95

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSW 128
            P      I   +   +  PA G   +S +  A +S++G V A   ++NR Y + E R +
Sbjct: 96  APADALALIEPILTGFVESPAAGFALVSGIVLAIWSASGYVGAFSRAMNRIYEIPEGRPF 155

Query: 129 YITRLISFGYVLLASVTLVIMSFVF-VAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           +  +       ++  V L++ + +  ++ P+  A        LG  + I+W+   +  +L
Sbjct: 156 WKLKPTQLAVTVIGIVLLLVCALIIAISGPVTDAIGEAL--GLGQTVQIVWSIAKW-PVL 212

Query: 188 ALFIGLIFVHLF--LPAAKS---KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
           A  I L+   L+   P AK    + MS+  G     +  V+ +V F  Y+  FS+Y+  Y
Sbjct: 213 AFAIVLLIAILYYATPNAKQPKFRWMSM--GAAIALVVLVIASVAFAFYVTEFSSYAKSY 270

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASM 272
             LA ++  L++L++  +  + GAE +A +
Sbjct: 271 GALAGVVVFLLWLWIANLALLFGAEFDAEL 300


>gi|253734428|ref|ZP_04868593.1| ribonuclease BN [Staphylococcus aureus subsp. aureus TCH130]
 gi|253727581|gb|EES96310.1| ribonuclease BN [Staphylococcus aureus subsp. aureus TCH130]
 gi|329731512|gb|EGG67875.1| YihY family protein [Staphylococcus aureus subsp. aureus 21193]
          Length = 405

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 101/183 (55%), Gaps = 8/183 (4%)

Query: 92  GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
           GL +I  + A + +SNG+ A+  S N AY V + R+  + +L+S    ++ +V + ++  
Sbjct: 151 GLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGIVLKLLS----VVFTVVMGVVFV 206

Query: 152 VFVAIPLALAYVRKF-FPALGNLLLIIW--N-GRIYATMLALFIGLIFVHLFLPAAKSKI 207
           V +A+P   + +  F F  LG    + W  N  RI   ++ +FI  I ++   P  K+K+
Sbjct: 207 VALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIIIFIVFIVLYSVAPNVKTKL 266

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAE 267
            S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+  L++LY+     I+GAE
Sbjct: 267 KSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGIIILLLWLYITSFIIIVGAE 326

Query: 268 LNA 270
           +NA
Sbjct: 327 INA 329


>gi|322377322|ref|ZP_08051813.1| putative ribonuclease BN [Streptococcus sp. M334]
 gi|321281522|gb|EFX58531.1| putative ribonuclease BN [Streptococcus sp. M334]
          Length = 291

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 120/243 (49%), Gaps = 13/243 (5%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           L+S+FP ++   N+  +      V   + VV    PE I   + + I +VL  P+ GL +
Sbjct: 43  LISIFPLLLVVVNILPYFQIP--VSNFLKVVNEFLPETIYDVVANIITEVLTQPSTGLLS 100

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMR----SWYITRLISFGYVLLASVTLVIMSF 151
            + L+A +  S  +  L+ + N+AY V + R    S  ++  +SFG  +L ++ L +  F
Sbjct: 101 FAVLSALWTFSKSMNFLQKAFNKAYGVAKNRGMISSQLMSLFVSFGLQILFALALFLSVF 160

Query: 152 VFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIMSI 210
             + + L  +Y +   P L + L  +    +YA + A+   L+ ++ FLP     +I S+
Sbjct: 161 GRMLLNLIKSYWKSDSP-LFDYLQDLTGPLVYALIFAI---LVMLYYFLPNVTVRRIRSV 216

Query: 211 LPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY--MLGVFFILGAEL 268
           LPG  F  ++ V+   +F+ Y+  +  +       +SI+  ++  +  ++    I+GA +
Sbjct: 217 LPGSAFVMLTLVLLLNIFSVYVNNYVNHIVDVRFFSSIVVVVMMFWFILIAKILIVGAVI 276

Query: 269 NAS 271
           NAS
Sbjct: 277 NAS 279


>gi|302333548|gb|ADL23741.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           JKD6159]
          Length = 405

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 101/183 (55%), Gaps = 8/183 (4%)

Query: 92  GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
           GL +I  + A + +SNG+ A+  S N AY V + R+  + +L+S    ++ +V + ++  
Sbjct: 151 GLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGIVLKLLS----VVFTVVMGVVFV 206

Query: 152 VFVAIPLALAYVRKF-FPALGNLLLIIW--N-GRIYATMLALFIGLIFVHLFLPAAKSKI 207
           V +A+P   + +  F F  LG    + W  N  RI   ++ +FI  I ++   P  K+K+
Sbjct: 207 VALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIIIFIVFIVLYSVAPNVKTKL 266

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAE 267
            S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+  L++LY+     I+GAE
Sbjct: 267 KSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGIIILLLWLYITSFIIIVGAE 326

Query: 268 LNA 270
           +NA
Sbjct: 327 INA 329


>gi|257426015|ref|ZP_05602437.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428688|ref|ZP_05605083.1| ribonuclease BN [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257431298|ref|ZP_05607674.1| ribonuclease BN [Staphylococcus aureus subsp. aureus 68-397]
 gi|257434016|ref|ZP_05610367.1| ribonuclease BN [Staphylococcus aureus subsp. aureus E1410]
 gi|257436920|ref|ZP_05612962.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|282904514|ref|ZP_06312399.1| YihY family protein [Staphylococcus aureus subsp. aureus C160]
 gi|282906286|ref|ZP_06314138.1| ribonuclease BN [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282909202|ref|ZP_06317018.1| ribonuclease BN [Staphylococcus aureus subsp. aureus WW2703/97]
 gi|282914680|ref|ZP_06322465.1| YihY family protein [Staphylococcus aureus subsp. aureus M899]
 gi|282919717|ref|ZP_06327449.1| hypothetical protein SASG_02334 [Staphylococcus aureus subsp.
           aureus C427]
 gi|282925121|ref|ZP_06332781.1| hypothetical protein SARG_02410 [Staphylococcus aureus subsp.
           aureus C101]
 gi|283958644|ref|ZP_06376090.1| YihY family protein [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|293507757|ref|ZP_06667599.1| hypothetical protein SCAG_02273 [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|293510775|ref|ZP_06669477.1| ribonuclease BN [Staphylococcus aureus subsp. aureus M809]
 gi|293539314|ref|ZP_06671993.1| YihY family protein [Staphylococcus aureus subsp. aureus M1015]
 gi|297590065|ref|ZP_06948705.1| YihY family protein [Staphylococcus aureus subsp. aureus MN8]
 gi|257271158|gb|EEV03315.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257274332|gb|EEV05844.1| ribonuclease BN [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257277947|gb|EEV08603.1| ribonuclease BN [Staphylococcus aureus subsp. aureus 68-397]
 gi|257280942|gb|EEV11086.1| ribonuclease BN [Staphylococcus aureus subsp. aureus E1410]
 gi|257283709|gb|EEV13834.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|282313079|gb|EFB43477.1| hypothetical protein SARG_02410 [Staphylococcus aureus subsp.
           aureus C101]
 gi|282316355|gb|EFB46732.1| hypothetical protein SASG_02334 [Staphylococcus aureus subsp.
           aureus C427]
 gi|282321394|gb|EFB51720.1| YihY family protein [Staphylococcus aureus subsp. aureus M899]
 gi|282326770|gb|EFB57067.1| ribonuclease BN [Staphylococcus aureus subsp. aureus WW2703/97]
 gi|282330483|gb|EFB60000.1| ribonuclease BN [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282595070|gb|EFC00037.1| YihY family protein [Staphylococcus aureus subsp. aureus C160]
 gi|283471153|emb|CAQ50364.1| transporter [Staphylococcus aureus subsp. aureus ST398]
 gi|283789684|gb|EFC28506.1| YihY family protein [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|290919849|gb|EFD96918.1| YihY family protein [Staphylococcus aureus subsp. aureus M1015]
 gi|291094820|gb|EFE25088.1| hypothetical protein SCAG_02273 [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|291466406|gb|EFF08930.1| ribonuclease BN [Staphylococcus aureus subsp. aureus M809]
 gi|297577193|gb|EFH95907.1| YihY family protein [Staphylococcus aureus subsp. aureus MN8]
 gi|323439155|gb|EGA96883.1| ribonuclease BN, putative [Staphylococcus aureus O11]
 gi|323441561|gb|EGA99211.1| ribonuclease BN, putative [Staphylococcus aureus O46]
          Length = 405

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 101/183 (55%), Gaps = 8/183 (4%)

Query: 92  GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
           GL +I  + A + +SNG+ A+  S N AY V + R+  + +L+S    ++ +V + ++  
Sbjct: 151 GLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGIVLKLLS----VVFTVVMGVVFV 206

Query: 152 VFVAIPLALAYVRKF-FPALGNLLLIIW--N-GRIYATMLALFIGLIFVHLFLPAAKSKI 207
           V +A+P   + +  F F  LG    + W  N  RI   ++ +FI  I ++   P  K+K+
Sbjct: 207 VALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIIIFIVFIVLYSVAPNVKTKL 266

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAE 267
            S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+  L++LY+     I+GAE
Sbjct: 267 KSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGIIILLLWLYITSFIIIVGAE 326

Query: 268 LNA 270
           +NA
Sbjct: 327 INA 329


>gi|220911338|ref|YP_002486647.1| ribonuclease BN [Arthrobacter chlorophenolicus A6]
 gi|219858216|gb|ACL38558.1| ribonuclease BN [Arthrobacter chlorophenolicus A6]
          Length = 402

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 125/268 (46%), Gaps = 11/268 (4%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVIDVVFGA 69
           I    +  F ++    +A+ ++  A+LS+FP I+   +L G  G  Q     ++ +V G 
Sbjct: 40  IAKKTLREFSKDQCPDLAASLTYYAVLSLFPAILALVSLVGLFGDPQKTTDALLQIVSGF 99

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSW 128
            P      I   +  +   PA G   +  L  A +S++G V A   +LNR Y V E R +
Sbjct: 100 VPGETMDTIGGVVKDLANAPAAGFTLVIGLGTALWSASGYVGAFGRALNRVYEVDEGRPF 159

Query: 129 YITRLISFGYVLLASVTLVIMSFVFV-AIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
              R       LLA V + I++ + V + P+A A     F  L  + L +WN   +  M+
Sbjct: 160 VKLRGTMLAVTLLAIVIIAILAGMLVLSGPVAEAV--GGFIGLSGVFLAVWNIAKWPVMV 217

Query: 188 ALFIGLIFVHLF-LPAAKS---KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            L I +I V  +  P  K    K MS+  G+    + +++ ++ F  Y+  F  Y+  Y 
Sbjct: 218 VLIIVIIAVLYYATPNVKQPKFKWMSMGSGIAL--VVFLLASLGFGFYVGNFGNYNKTYG 275

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNAS 271
            L  ++  L++L++L +  + GAE +A 
Sbjct: 276 ALGGVIVMLLWLWILNMSLLFGAEFDAE 303


>gi|262052870|ref|ZP_06025054.1| hypothetical protein SA930_0032 [Staphylococcus aureus 930918-3]
 gi|259159224|gb|EEW44284.1| hypothetical protein SA930_0032 [Staphylococcus aureus 930918-3]
          Length = 405

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 96/183 (52%), Gaps = 8/183 (4%)

Query: 92  GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
           GL +I  + A + +SNG+ A+  S N AY V + R+  + +L+S    ++ +V + ++  
Sbjct: 151 GLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGIVLKLLS----VVFTVVMGVVFV 206

Query: 152 VFVAIPLALAYVRKF-FPALGNLLLIIW--NGRIYATMLALFIGLIFV-HLFLPAAKSKI 207
           V +A+P   + +  F F  LG    + W  N       + +   +  V +   P  K+K+
Sbjct: 207 VALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIIIFIIFIVLYSVAPNVKTKL 266

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAE 267
            S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+  L++LY+     I+GAE
Sbjct: 267 KSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGIIILLLWLYITSFIIIVGAE 326

Query: 268 LNA 270
           +NA
Sbjct: 327 INA 329


>gi|258422960|ref|ZP_05685859.1| ribonuclease BN [Staphylococcus aureus A9635]
 gi|257846747|gb|EEV70762.1| ribonuclease BN [Staphylococcus aureus A9635]
          Length = 405

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 101/183 (55%), Gaps = 8/183 (4%)

Query: 92  GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
           GL +I  + A + +SNG+ A+  S N AY V + R+  + +L+S    ++ +V + ++  
Sbjct: 151 GLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGIVLKLLS----VVFTVVMGVVFV 206

Query: 152 VFVAIPLALAYVRKF-FPALGNLLLIIW--N-GRIYATMLALFIGLIFVHLFLPAAKSKI 207
           V +A+P   + +  F F  LG    + W  N  RI   ++ +FI  I ++   P  K+K+
Sbjct: 207 VALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIIIFIVFIVLYSVAPNVKTKL 266

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAE 267
            S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+  L++LY+     I+GAE
Sbjct: 267 KSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGIIILLLWLYITSFIIIVGAE 326

Query: 268 LNA 270
           +NA
Sbjct: 327 INA 329


>gi|94990668|ref|YP_598768.1| ribonuclease BN [Streptococcus pyogenes MGAS10270]
 gi|94544176|gb|ABF34224.1| Ribonuclease BN [Streptococcus pyogenes MGAS10270]
          Length = 321

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/272 (23%), Positives = 126/272 (46%), Gaps = 21/272 (7%)

Query: 13  YDAIEHFVEEDGWAMASHISLSAL-------LSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
           Y+ I+ F+       ++ + LSA+       L+ FP IV  AN+  +L     +  ++ +
Sbjct: 16  YEPIQVFMRH---LQSAEMDLSAIAVAYYLILTAFPLIVIAANIFPYLNID--IADLLRL 70

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           +    P+ I +P +  +  + + P+  +  ++ L   +  S  + +L+ ++N+AY   + 
Sbjct: 71  MKQNLPKDIFRPTSAIVENIFSKPSGSVLGVATLTGLWTMSRSLTSLQKAINKAYGASQH 130

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVR---KFFPALGNLLLIIWNGRI 182
           R ++I  L+    +L + + L +++F  +    + A ++   K +    N+  I      
Sbjct: 131 RDFFIGHLVG---LLTSLIILFLLAFALIFSTFSKAAIQVLDKHYHLSDNITTIFLLLIQ 187

Query: 183 YATMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
             T+L +F+GL+ ++  LP  K  KI  ILPG +FT       + L  +Y+V        
Sbjct: 188 PITVLIIFVGLMLLYFLLPNVKIKKIRYILPGTLFTSFVMTFLSNLVGNYVVYNVERMVD 247

Query: 242 YAGLASIMTCLVFLY--MLGVFFILGAELNAS 271
                S+M  ++ L+   L    ILGA  NA+
Sbjct: 248 IKMFGSVMIFIIMLWFIFLARILILGAIFNAT 279


>gi|283771032|ref|ZP_06343923.1| ribonuclease BN [Staphylococcus aureus subsp. aureus H19]
 gi|283459626|gb|EFC06717.1| ribonuclease BN [Staphylococcus aureus subsp. aureus H19]
          Length = 405

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 104/193 (53%), Gaps = 8/193 (4%)

Query: 82  ILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLL 141
           I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  + +L+S    ++
Sbjct: 141 IGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGIVLKLLS----VV 196

Query: 142 ASVTLVIMSFVFVAIPLALAYVRKF-FPALGNLLLIIW--N-GRIYATMLALFIGLIFVH 197
            +V + ++  V +A+P   + +  F F  LG    + W  N  RI   ++ +FI  I ++
Sbjct: 197 FTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIIIFIVFIVLY 256

Query: 198 LFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
              P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+  L++LY+
Sbjct: 257 SVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGIIILLLWLYI 316

Query: 258 LGVFFILGAELNA 270
                I+GAE+NA
Sbjct: 317 TSFIIIVGAEINA 329


>gi|307294846|ref|ZP_07574688.1| ribonuclease BN [Sphingobium chlorophenolicum L-1]
 gi|306879320|gb|EFN10538.1| ribonuclease BN [Sphingobium chlorophenolicum L-1]
          Length = 322

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 111/251 (44%), Gaps = 5/251 (1%)

Query: 22  EDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDE 81
            DG+  A +++  +L+++FPF +  A +A   G  Q     +       P  +A  +   
Sbjct: 50  SDGFIHAGNLAYLSLMTLFPFFIVAAAVASIFGHSQDGLAAVRAFLETVPPGVADVVRQP 109

Query: 82  ILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLL 141
           I+ VL      L  +  L   +   + +E +R  L RAY     R ++  RL + G + L
Sbjct: 110 IIDVLNARTGPLLWLGGLVGLWTVGSLIETIRDILRRAYGTKSTRPFWHYRLTAIG-ITL 168

Query: 142 ASVTLVIMSFVFVAIPLAL-AYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFL 200
            SV  V+ +F    I   +  ++ +  P     + I+   ++ A M  L + L ++++ L
Sbjct: 169 VSVFAVMFAFSMQVIITGIDQFLHQILPFADQAIQIVALTKL-APMAILCVALYYLYVSL 227

Query: 201 PAA--KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYML 258
             +  K       PG I T + W    +L    +     Y   Y  LA +M  L+F +++
Sbjct: 228 TPSLYKDPRFPKWPGAIATALWWYGVTLLLPVTLSLLGGYDLTYGSLAGVMITLIFFFLV 287

Query: 259 GVFFILGAELN 269
           G+  ++GAELN
Sbjct: 288 GLGVVIGAELN 298


>gi|298695221|gb|ADI98443.1| probable membrane protein [Staphylococcus aureus subsp. aureus
           ED133]
          Length = 405

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 101/183 (55%), Gaps = 8/183 (4%)

Query: 92  GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
           GL +I  + A + +SNG+ A+  S N AY V + R+  + +L+S    ++ +V + ++  
Sbjct: 151 GLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGIVLKLLS----VVFTVVMGVVFV 206

Query: 152 VFVAIPLALAYVRKF-FPALGNLLLIIW--N-GRIYATMLALFIGLIFVHLFLPAAKSKI 207
           V +A+P   + +  F F  LG    + W  N  RI   ++ +FI  I ++   P  K+K+
Sbjct: 207 VALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIIIFIVFIVLYSVAPNVKTKL 266

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAE 267
            S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+  L++LY+     I+GAE
Sbjct: 267 KSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGIIILLLWLYITSFIIIVGAE 326

Query: 268 LNA 270
           +NA
Sbjct: 327 INA 329


>gi|282917228|ref|ZP_06324983.1| hypothetical protein SATG_01802 [Staphylococcus aureus subsp.
           aureus D139]
 gi|282318855|gb|EFB49210.1| hypothetical protein SATG_01802 [Staphylococcus aureus subsp.
           aureus D139]
          Length = 405

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 101/183 (55%), Gaps = 8/183 (4%)

Query: 92  GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
           GL +I  + A + +SNG+ A+  S N AY V + R+  + +L+S    ++ +V + ++  
Sbjct: 151 GLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGIVLKLLS----VVFTVVMGVVFV 206

Query: 152 VFVAIPLALAYVRKF-FPALGNLLLIIW--N-GRIYATMLALFIGLIFVHLFLPAAKSKI 207
           V +A+P   + +  F F  LG    + W  N  RI   ++ +FI  I ++   P  K+K+
Sbjct: 207 VALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIIIFIVFIVLYSVAPNVKTKL 266

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAE 267
            S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+  L++LY+     I+GAE
Sbjct: 267 KSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGIIILLLWLYITSFIIIVGAE 326

Query: 268 LNA 270
           +NA
Sbjct: 327 INA 329


>gi|94971696|ref|YP_593744.1| ribonuclease BN, putative [Candidatus Koribacter versatilis
           Ellin345]
 gi|94553746|gb|ABF43670.1| ribonuclease BN, putative [Candidatus Koribacter versatilis
           Ellin345]
          Length = 296

 Score = 56.6 bits (135), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 127/280 (45%), Gaps = 22/280 (7%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFI-VFGANLAGFLGAHQFV 59
           MR++   +   ++ A +H    D +A+A   + SA+L++FP + V  + L        FV
Sbjct: 1   MRDFLDHLRRALWRAFQH----DAFAVAKGAAYSAILTLFPAVLVVASTLTLSHTTAAFV 56

Query: 60  PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGV-----EALRI 114
             +   V    PE  A  + +       +P K L T + L    +++ GV     E  R 
Sbjct: 57  REISYAVGRILPEGTASAVQEYFEGEHPIPMKFLITTAILT--LWTATGVMISWMEGFR- 113

Query: 115 SLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPA--LGN 172
               AY++ +       R+++   VL+A   +   SF+ VA  L +     F     LG 
Sbjct: 114 ---NAYQLQKTWGLIQERMVAISLVLMAGGPMAFASFL-VAFGLQIENWMIFHAGRELGM 169

Query: 173 LLLIIWN--GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTH 230
            +L++W+    + AT+ ++ +  +  H  +P  +     +LPG +     W    VLF  
Sbjct: 170 YILLMWSLVRWLIATVTSIAVIALIYHNGVPRTQ-PWHRVLPGAVLATAMWFGSTVLFGW 228

Query: 231 YIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           YI  F+ Y  +Y  + + +  L++LY++ +  ++GAE NA
Sbjct: 229 YIRNFAHYDVIYGSVGTAIALLIWLYLISMVVLVGAEFNA 268


>gi|282911508|ref|ZP_06319308.1| ribonuclease BN [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282324517|gb|EFB54829.1| ribonuclease BN [Staphylococcus aureus subsp. aureus WBG10049]
 gi|312437652|gb|ADQ76723.1| YihY family protein [Staphylococcus aureus subsp. aureus TCH60]
          Length = 405

 Score = 56.6 bits (135), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 101/183 (55%), Gaps = 8/183 (4%)

Query: 92  GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
           GL +I  + A + +SNG+ A+  S N AY V + R+  + +L+S    ++ +V + ++  
Sbjct: 151 GLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGIVLKLLS----VVFTVVMGVVFV 206

Query: 152 VFVAIPLALAYVRKF-FPALGNLLLIIW--N-GRIYATMLALFIGLIFVHLFLPAAKSKI 207
           V +A+P   + +  F F  LG    + W  N  RI   ++ +FI  I ++   P  K+K+
Sbjct: 207 VALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIIIFIVFIVLYSVAPNVKTKL 266

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAE 267
            S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+  L++LY+     I+GAE
Sbjct: 267 KSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGIIILLLWLYITSFIIIVGAE 326

Query: 268 LNA 270
           +NA
Sbjct: 327 INA 329


>gi|21283552|ref|NP_646640.1| hypothetical protein MW1823 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49486701|ref|YP_043922.1| hypothetical protein SAS1805 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|297208908|ref|ZP_06925313.1| YihY family protein [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|300913034|ref|ZP_07130472.1| YihY family protein [Staphylococcus aureus subsp. aureus TCH70]
 gi|21204993|dbj|BAB95688.1| MW1823 [Staphylococcus aureus subsp. aureus MW2]
 gi|49245144|emb|CAG43610.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|296886469|gb|EFH25397.1| YihY family protein [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|300885812|gb|EFK81019.1| YihY family protein [Staphylococcus aureus subsp. aureus TCH70]
          Length = 403

 Score = 56.6 bits (135), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 101/183 (55%), Gaps = 8/183 (4%)

Query: 92  GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
           GL +I  + A + +SNG+ A+  S N AY V + R+  + +L+S    ++ +V + ++  
Sbjct: 149 GLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGIVLKLLS----VVFTVVMGVVFV 204

Query: 152 VFVAIPLALAYVRKF-FPALGNLLLIIW--N-GRIYATMLALFIGLIFVHLFLPAAKSKI 207
           V +A+P   + +  F F  LG    + W  N  RI   ++ +FI  I ++   P  K+K+
Sbjct: 205 VALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIIIFIVFIVLYSVAPNVKTKL 264

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAE 267
            S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+  L++LY+     I+GAE
Sbjct: 265 KSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGIIILLLWLYITSFIIIVGAE 324

Query: 268 LNA 270
           +NA
Sbjct: 325 INA 327


>gi|229916931|ref|YP_002885577.1| ribonuclease BN [Exiguobacterium sp. AT1b]
 gi|229468360|gb|ACQ70132.1| ribonuclease BN [Exiguobacterium sp. AT1b]
          Length = 281

 Score = 56.6 bits (135), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 86/190 (45%), Gaps = 1/190 (0%)

Query: 92  GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
           GL ++SA+ A + +SNG   L      AY   E R +   RLI    +L  S+  VI+  
Sbjct: 87  GLLSVSAIIAFWSASNGTARLVKLTVFAYGETEARGYIFRRLIGLLVILAGSIGAVILIV 146

Query: 152 VFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSIL 211
             +     +  +   +P +     +    R   + + L I     +   P  + + +  L
Sbjct: 147 FHLFGQEFVELIYALYPQVEEFDRLSTVTRYTVSTIILIIAFSLFYKIAPQQRVRFIETL 206

Query: 212 PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNAS 271
           PG +F  ISW + +  ++ Y+  FS     Y  + +++   ++LY+     ++GAE+NA+
Sbjct: 207 PGAVFAVISWQLLSTGYSIYVERFSILGDTYGTIGAVILLQIWLYLTAATMLIGAEINAA 266

Query: 272 MIIYYWRKKP 281
              Y+  ++P
Sbjct: 267 W-PYHMTRQP 275


>gi|325262470|ref|ZP_08129207.1| ribonuclease BN [Clostridium sp. D5]
 gi|324032302|gb|EGB93580.1| ribonuclease BN [Clostridium sp. D5]
          Length = 282

 Score = 56.6 bits (135), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 109/221 (49%), Gaps = 10/221 (4%)

Query: 55  AHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRI 114
             Q V   +  VF    E +   I D++ Q     +  +  ++ + A + +  GV ++  
Sbjct: 56  TRQDVMAAVTQVFPTTVEGLISSIVDQVYQ----QSSTIIPVTIIVALWSAGKGVLSMTS 111

Query: 115 SLNRAYRVVEMRSWYITRLISFGYVLLASVTLVI-MSFVFVAIPLALAYVRKFFPALGNL 173
            +N  Y   E R+++  RL +  Y ++  + +V+ +S       +++ +V K  P L  +
Sbjct: 112 GMNLIYENTETRNYFYLRLRASFYTVIFILAIVLSLSLSVFGNSISM-FVYKHAPVLTTI 170

Query: 174 LLIIWNGRIYATMLALFIGLIFVHLFLPA----AKSKIMSILPGVIFTWISWVVGAVLFT 229
           +  +   R   T++ L +    V+ +LP     +K+ +   LPG +FT   W++ + +F+
Sbjct: 171 MDFLIRIRTLLTLVVLTLFWDLVYKYLPNRTNRSKTTMKQQLPGAVFTSCGWLLISFIFS 230

Query: 230 HYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
            Y+  F+ +S+MY  L +I+  +++LY+     +LG ELNA
Sbjct: 231 IYLDIFTGFSSMYGSLTTIILIMLWLYVCMYVILLGGELNA 271


>gi|86159452|ref|YP_466237.1| ribonuclease BN [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85775963|gb|ABC82800.1| ribonuclease BN, putative [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 338

 Score = 56.6 bits (135), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 92/211 (43%), Gaps = 28/211 (13%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P  + K + D I Q+ A     L    AL A + +S    AL  SLN AY V E R ++ 
Sbjct: 73  PGEVTKIVGDRIQQLGAQQNVTLLGFGALGALWAASGATLALMRSLNTAYDVKESRPFWK 132

Query: 131 TRLISF-----------GYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
            R I+               + A  T  I + +  +   A+ ++R  F AL         
Sbjct: 133 VRAIALLMTVVAGVLALAGAVAAVATEPIANAIGGSAGAAILWLRLPFAAL--------- 183

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                 M++L+  L +V   LP  + +   I PG +F  + WV+ +  F  Y+  F  Y 
Sbjct: 184 -----VMMSLWALLYYV---LPDVEQQFKFITPGSVFGVVLWVLASWGFGKYVANFGHYD 235

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
             Y  +A ++  L ++++  +  ++GAE+NA
Sbjct: 236 KTYGSIAGVIVLLFWMWISSLVLLVGAEINA 266


>gi|297625291|ref|YP_003687054.1| tRNA processing ribonuclease BN [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
 gi|296921056|emb|CBL55594.1| TRNA processing ribonuclease BN [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
          Length = 364

 Score = 56.2 bits (134), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 125/275 (45%), Gaps = 23/275 (8%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT-VIDVVFGA 69
           ++   I  F  +    +A+ ++  A+LS+FP ++   +L G +G  +     V+ ++   
Sbjct: 35  VLRKTIREFSSDQCTDIAASLTYYAVLSLFPCLIAIFSLLGVVGQGKAASDAVLGIIEQV 94

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSW 128
            P      I   I Q+   P  G   I+ +  A +S++G V A   ++NR Y + E R +
Sbjct: 95  APGDTVDTIRGPIEQIAESPGAGFALITGILLAIWSASGYVGAFSRAMNRIYEIEEGRPF 154

Query: 129 YITR-------LISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           +  +       +I+   +++A++ LV+   V  AI  AL         +G++   IW+  
Sbjct: 155 WKLKPAQLLVTVITIVLLVIAAIILVVSGDVTKAIGDALG--------IGDVPQTIWS-- 204

Query: 182 IYATMLALFIGLIFVHLF---LPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
           I    L +FI ++ V +     P AK  K   I  G +   I   +    F  Y+  FS 
Sbjct: 205 IAKWPLLIFIAVLVVAILYYATPNAKQPKFRWISMGALLAIIVLALATAAFGFYVGNFSN 264

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           Y   Y  LA ++  L++L++  +  + GAE +A +
Sbjct: 265 YDRTYGSLAGVIIFLLWLWIANLALLFGAEFDAEL 299


>gi|225011726|ref|ZP_03702164.1| ribonuclease BN [Flavobacteria bacterium MS024-2A]
 gi|225004229|gb|EEG42201.1| ribonuclease BN [Flavobacteria bacterium MS024-2A]
          Length = 308

 Score = 56.2 bits (134), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 117/278 (42%), Gaps = 26/278 (9%)

Query: 12  IYDAIEHFV----EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA------HQFVPT 61
           IYD IE +V    +      A  IS S  +++FPF++F  NL  F+          F  T
Sbjct: 30  IYDLIEMYVIGIVKGALSYRAGSISFSFFMALFPFLLFIINLIPFVDMIPFIHIENFDQT 89

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
            ++ +    P       T     +   P  GL +   L + + S+NGV A+  S   +Y 
Sbjct: 90  FLNYIELFLPSETQTFFTGIFEDIRNKPRGGLLSSVFLLSIFLSANGVSAIFGSFEVSYH 149

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL-LIIWNG 180
           V   RS++   L S G     SV L  +S   V I          F  L NL  L+    
Sbjct: 150 VKLSRSFFRQYLFSMG----ISVVLAFLSLFAVIIFFYFE-----FYILNNLESLVPSEV 200

Query: 181 RIYATMLALFIGLI------FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVT 234
           R+       F GL        ++ F      KI    PG + T + + +    F  YI  
Sbjct: 201 RLTRISQISFFGLFAYLTVSILYYFGTIEGRKIRFFSPGALMTTLLFFLTTYGFGIYIDN 260

Query: 235 FSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           FSTY+ +Y  + +++  L++++M     +LG ELNA++
Sbjct: 261 FSTYNQLYGSIGALLIFLLYIWMNSNILLLGFELNATL 298


>gi|19746326|ref|NP_607462.1| hypothetical protein spyM18_1365 [Streptococcus pyogenes MGAS8232]
 gi|21910564|ref|NP_664832.1| hypothetical protein SpyM3_1028 [Streptococcus pyogenes MGAS315]
 gi|28895744|ref|NP_802094.1| hypothetical protein SPs0832 [Streptococcus pyogenes SSI-1]
 gi|50914420|ref|YP_060392.1| ribonuclease BN [Streptococcus pyogenes MGAS10394]
 gi|56808457|ref|ZP_00366201.1| COG1295: Predicted membrane protein [Streptococcus pyogenes M49
           591]
 gi|71903759|ref|YP_280562.1| ribonuclease BN [Streptococcus pyogenes MGAS6180]
 gi|94988776|ref|YP_596877.1| ribonuclease BN [Streptococcus pyogenes MGAS9429]
 gi|94992661|ref|YP_600760.1| ribonuclease BN [Streptococcus pyogenes MGAS2096]
 gi|139473605|ref|YP_001128321.1| ribonuclease BN-like family protein [Streptococcus pyogenes str.
           Manfredo]
 gi|209559593|ref|YP_002286065.1| Ribonuclease BN [Streptococcus pyogenes NZ131]
 gi|306827129|ref|ZP_07460421.1| YihY family protein [Streptococcus pyogenes ATCC 10782]
 gi|19748519|gb|AAL97961.1| conserved hypothetical protein [Streptococcus pyogenes MGAS8232]
 gi|21904764|gb|AAM79635.1| conserved hypothetical protein [Streptococcus pyogenes MGAS315]
 gi|28810993|dbj|BAC63927.1| conserved hypothetical protein [Streptococcus pyogenes SSI-1]
 gi|50903494|gb|AAT87209.1| Ribonuclease BN [Streptococcus pyogenes MGAS10394]
 gi|71802854|gb|AAX72207.1| ribonuclease BN [Streptococcus pyogenes MGAS6180]
 gi|94542284|gb|ABF32333.1| ribonuclease BN [Streptococcus pyogenes MGAS9429]
 gi|94546169|gb|ABF36216.1| Ribonuclease BN [Streptococcus pyogenes MGAS2096]
 gi|134271852|emb|CAM30087.1| ribonuclease BN-like family protein [Streptococcus pyogenes str.
           Manfredo]
 gi|209540794|gb|ACI61370.1| Ribonuclease BN [Streptococcus pyogenes NZ131]
 gi|304430682|gb|EFM33699.1| YihY family protein [Streptococcus pyogenes ATCC 10782]
          Length = 321

 Score = 56.2 bits (134), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 63/272 (23%), Positives = 126/272 (46%), Gaps = 21/272 (7%)

Query: 13  YDAIEHFVEEDGWAMASHISLSAL-------LSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
           Y+ I+ F+       ++ + LSA+       L+ FP IV  AN+  +L     +  ++ +
Sbjct: 16  YEPIQVFMRH---LQSAEMDLSAIAVAYYLILTAFPLIVIAANIFPYLNID--IADLLRL 70

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           +    P+ I +P +  +  + + P+  +  ++ L   +  S  + +L+ ++N+AY   + 
Sbjct: 71  MKQNLPKDIFRPASAIVENIFSKPSGSVLGVATLTGLWTMSRSLTSLQKAINKAYGASQH 130

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVR---KFFPALGNLLLIIWNGRI 182
           R ++I  L+    +L + + L +++F  +    + A ++   K +    N+  I      
Sbjct: 131 RDFFIGHLVG---LLTSLIILFLLAFALIFSTFSKAAIQVLDKHYHLSDNITTIFLLLIQ 187

Query: 183 YATMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
             T+L +F+GL+ ++  LP  K  KI  ILPG +FT       + L  +Y+V        
Sbjct: 188 PITVLIIFVGLMLLYFLLPNVKIKKIRYILPGTLFTSFVMTFLSNLVGNYVVYNVERMVD 247

Query: 242 YAGLASIMTCLVFLY--MLGVFFILGAELNAS 271
                S+M  ++ L+   L    ILGA  NA+
Sbjct: 248 IKMFGSVMIFIIMLWFIFLARILILGAIFNAT 279


>gi|94994597|ref|YP_602695.1| ribonuclease BN [Streptococcus pyogenes MGAS10750]
 gi|94548105|gb|ABF38151.1| Ribonuclease BN [Streptococcus pyogenes MGAS10750]
          Length = 321

 Score = 56.2 bits (134), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 63/272 (23%), Positives = 126/272 (46%), Gaps = 21/272 (7%)

Query: 13  YDAIEHFVEEDGWAMASHISLSAL-------LSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
           Y+ I+ F+       ++ + LSA+       L+ FP IV  AN+  +L     +  ++ +
Sbjct: 16  YEPIQVFMRH---LQSAEMDLSAIAVAYYLILTAFPLIVIAANIFPYLNID--IADLLRL 70

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           +    P+ I +P +  +  + + P+  +  ++ L   +  S  + +L+ ++N+AY   + 
Sbjct: 71  MKQNLPKDIFRPASAIVENIFSKPSGSVLGVATLTGLWTMSRSLTSLQKAINKAYGASQH 130

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVR---KFFPALGNLLLIIWNGRI 182
           R ++I  L+    +L + + L +++F  +    + A ++   K +    N+  I      
Sbjct: 131 RDFFIGHLVG---LLTSLIILFLLAFALIFSTFSKAAIQVLDKHYHLSDNITTIFLLLIQ 187

Query: 183 YATMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
             T+L +F+GL+ ++  LP  K  KI  ILPG +FT       + L  +Y+V        
Sbjct: 188 PITVLIIFVGLMLLYFLLPNVKIKKIRYILPGTLFTSFVMTFLSNLVGNYVVYNVERMVD 247

Query: 242 YAGLASIMTCLVFLY--MLGVFFILGAELNAS 271
                S+M  ++ L+   L    ILGA  NA+
Sbjct: 248 IKMFGSVMIFIIMLWFIFLARILILGAIFNAT 279


>gi|255531742|ref|YP_003092114.1| ribonuclease BN [Pedobacter heparinus DSM 2366]
 gi|255344726|gb|ACU04052.1| ribonuclease BN [Pedobacter heparinus DSM 2366]
          Length = 330

 Score = 56.2 bits (134), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/250 (21%), Positives = 125/250 (50%), Gaps = 8/250 (3%)

Query: 28  ASHISLSALLSVFPFIVFGANLAGFLGAH-QFVPTVIDVVFGAWPEVIAKPITDEILQVL 86
           AS ++ + +L++FP I+F   L  F+     F   ++ ++    P       +  + +++
Sbjct: 54  ASSLAYNFMLAIFPAIIFLFTLIPFIPKRFHFQDQLMQLIMLILPADAYNAFSATLDEIV 113

Query: 87  AVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTL 146
               +GL +   L + +F++NGV  L ++ N++  ++E R+W   RLI+    L  ++++
Sbjct: 114 HKQNRGLLSFGFLLSLFFATNGVHNLMMAFNKSSLIIETRTWLKQRLIAIVLTLTIALSV 173

Query: 147 VIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL-FIGLIFVHLFLPAAKS 205
           ++          AL Y+       G+ ++ +     ++ +  L F+ +  ++ + PA   
Sbjct: 174 IVCIIAMAIGEYALNYIDTGLDIKGDFIVYLIKLTRWSLLGILYFVTISILYRYGPAHAK 233

Query: 206 KIMSILPGVIFTWISWVVGAVL---FTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFF 262
           K      G   +W++ ++  +    F+ YI  FS+Y+ +Y  + +++  +++LY+  +  
Sbjct: 234 KWRFFSAG---SWLATILAFLTIWGFSFYINNFSSYNKIYGSIGTLIVIMIWLYLNSLIL 290

Query: 263 ILGAELNASM 272
           ++G ELNAS+
Sbjct: 291 LIGFELNASV 300


>gi|322373467|ref|ZP_08048003.1| YihY family protein [Streptococcus sp. C150]
 gi|321278509|gb|EFX55578.1| YihY family protein [Streptococcus sp. C150]
          Length = 319

 Score = 56.2 bits (134), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 113/244 (46%), Gaps = 15/244 (6%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           +L+VFP IV  AN+  +L        +++ +    P+    P  + +  V + P+  L  
Sbjct: 43  ILTVFPLIVIAANVFPYLNID--TTDLLNFMSEHLPKQFYAPAANVVKDVFSTPSGQLLG 100

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
           +++L   +     + +L+ ++N+ Y   E R  +I+ +I     L+    L     +   
Sbjct: 101 VASLTGFWTMIKSLSSLQKAINKVYGASEHRDVFISHIIGGLLSLVILFLLTFALMLSTI 160

Query: 156 IPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIMSILPGV 214
           +   L  + + +P   NL  +I N     ++  +F+G++ ++  LP  K  KI  I+PG 
Sbjct: 161 VQSVLRVINQTYPIGSNLTQLILNSIQPLSVAVVFLGVMVLYFILPNVKIRKIRYIMPGT 220

Query: 215 IFTWISWVVG--AVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFF-----ILGAE 267
           IFT  + V+G  + LF  Y++   +         SIM   +F++ML   F     ILGA 
Sbjct: 221 IFT--TLVIGYLSNLFGTYVIRTLSRLVDIKLFGSIM---IFVFMLWFIFLARILILGAI 275

Query: 268 LNAS 271
            NA+
Sbjct: 276 FNAT 279


>gi|78223975|ref|YP_385722.1| ribonuclease BN [Geobacter metallireducens GS-15]
 gi|78195230|gb|ABB32997.1| tRNA-processing RNAse BN [Geobacter metallireducens GS-15]
          Length = 453

 Score = 56.2 bits (134), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 120/267 (44%), Gaps = 33/267 (12%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFG-ANLAGFLGAHQFVPTVIDVVFGAWPEVI 74
           ++ F+++     AS ++ S LLS+ PF     A L GF   +   P ++D V     E++
Sbjct: 45  VKDFLDDQCLIRASALAFSTLLSIVPFFALAFAVLKGFGVQNTLEPFILDQVAAGSHEIV 104

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFS-----SNGVEALRISLNRAYRVVEMRSWY 129
                D+I+  +     G      LAA + +      N  EA     N  + V E RS Y
Sbjct: 105 -----DKIVAYINNTKVGSLGAIGLAALFVTVVTLLGNVEEAF----NAIWGVRETRSLY 155

Query: 130 ------ITRLISFGYVLLASV--TLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
                 ++ L+S   +L A+V  T  I S  FV   +   Y       LG+ LL ++   
Sbjct: 156 RKFSDYLSVLVSGPILLFAAVSTTTTIESQAFVQWIMGYTY-------LGDALLALFRLV 208

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
            Y   L+++I L+F+++F+P  K +  S L G I     W      + H+ V  + Y+ +
Sbjct: 209 PY---LSIWIALVFLYMFIPNTKVRFRSALVGGIIAGTIWQGAQWGYIHFQVGVAKYNAI 265

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAEL 268
           Y  LA +   +V+LY   V  +LG E+
Sbjct: 266 YGTLAVLPVFMVWLYASWVIVLLGGEV 292


>gi|284024929|ref|ZP_06379327.1| hypothetical protein Saura13_10091 [Staphylococcus aureus subsp.
           aureus 132]
          Length = 405

 Score = 56.2 bits (134), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 96/183 (52%), Gaps = 8/183 (4%)

Query: 92  GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
           GL +I  + A + +SNG+ A+  S N AY V + R+  + +L+S    ++ +V + ++  
Sbjct: 151 GLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGIVLKLLS----VVFTVVMGVVFV 206

Query: 152 VFVAIPLALAYVRKF-FPALGNLLLIIW--NGRIYATMLALFIGLIFV-HLFLPAAKSKI 207
           V +A+P   + +  F F  LG    + W  N       + +   +  V +   P  K+K+
Sbjct: 207 VALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIIIFIIFIVLYSVAPNVKTKL 266

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAE 267
            S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+  L++LY+     I+GAE
Sbjct: 267 KSVLPGAVFTSIIWLAGSFGFGWYISIFGNYSKTYGSIAGIIILLLWLYITSFIIIVGAE 326

Query: 268 LNA 270
           +NA
Sbjct: 327 INA 329


>gi|83953008|ref|ZP_00961730.1| hypothetical protein NAS141_11906 [Sulfitobacter sp. NAS-14.1]
 gi|83841976|gb|EAP81144.1| hypothetical protein NAS141_11906 [Sulfitobacter sp. NAS-14.1]
          Length = 303

 Score = 56.2 bits (134), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 131/283 (46%), Gaps = 24/283 (8%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           +D +  A+    E++   +A+ ++  A+LS+FP +     +   +     V   ++ + G
Sbjct: 8   WDALKAALVDISEKNVSLIAAGVAFYAMLSLFPALAALVTILSLISDPVVVIAQLEDMRG 67

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRVVEM 125
             P+ +   + D+++ ++      L      S L A + +  GV A+ I LN  Y     
Sbjct: 68  LLPDDVYDILNDQVVSLVTTSTGKLGWAGAASVLVAMWSARAGVGAMMIGLNSVYSERNR 127

Query: 126 ---RSWYITRLISFGYV---LLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
              R +    +++F  V   L+A +T+VI   V   IPL    V  +F A     +I W+
Sbjct: 128 NAARHYLRALMLTFTLVMVGLIALITVVIAPIVLSFIPLG---VFGYFVAE----IIRWS 180

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILP-GVIFTWISWVVGAVLFTHYIVTFSTY 238
                 +L L  G+  ++ F P  ++  +  L  G +F   SW V ++ F++Y+  F  Y
Sbjct: 181 ----IAILVLLAGVGVLYRFGPNRRAARIGWLTWGAVFAVFSWAVVSIGFSYYVANFGNY 236

Query: 239 STMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
           + +Y  + +++  LV+L++     ++GA  NA + +   R +P
Sbjct: 237 NQVYGSIGAVIAMLVWLWISSFLVLMGASWNAQVEL---RTRP 276


>gi|83941959|ref|ZP_00954421.1| conserved hypothetical membrane protein [Sulfitobacter sp. EE-36]
 gi|83847779|gb|EAP85654.1| conserved hypothetical membrane protein [Sulfitobacter sp. EE-36]
          Length = 308

 Score = 56.2 bits (134), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 131/283 (46%), Gaps = 24/283 (8%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           +D +  A+    E++   +A+ ++  A+LS+FP +     +   +     V   ++ + G
Sbjct: 13  WDALKAALVDISEKNVSLIAAGVAFYAMLSLFPALAALVTILSLISDPVVVIAQLEDMRG 72

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRVVEM 125
             P+ +   + D+++ ++      L      S L A + +  GV A+ I LN  Y     
Sbjct: 73  LLPDDVYDILNDQVVSLVTTSTGKLGWAGAASVLVAMWSARAGVGAMMIGLNSVYSERNR 132

Query: 126 ---RSWYITRLISFGYV---LLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
              R +    +++F  V   L+A +T+VI   V   IPL    V  +F A     +I W+
Sbjct: 133 NAARHYLRALMLTFTLVMVGLIALITVVIAPIVLSFIPLG---VFGYFVAE----IIRWS 185

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILP-GVIFTWISWVVGAVLFTHYIVTFSTY 238
                 +L L  G+  ++ F P  ++  +  L  G +F   SW V ++ F++Y+  F  Y
Sbjct: 186 ----IAILVLLAGVGVLYRFGPNRRAARIGWLTWGAVFAVFSWAVVSIGFSYYVANFGNY 241

Query: 239 STMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
           + +Y  + +++  LV+L++     ++GA  NA + +   R +P
Sbjct: 242 NQVYGSIGAVIAMLVWLWISSFLVLMGASWNAQVEL---RTRP 281


>gi|49484124|ref|YP_041348.1| hypothetical protein SAR1973 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|295428464|ref|ZP_06821091.1| hypothetical protein SIAG_02233 [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|49242253|emb|CAG40960.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|295127446|gb|EFG57085.1| hypothetical protein SIAG_02233 [Staphylococcus aureus subsp.
           aureus EMRSA16]
          Length = 405

 Score = 55.8 bits (133), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 104/193 (53%), Gaps = 8/193 (4%)

Query: 82  ILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLL 141
           I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  + +L+S    ++
Sbjct: 141 IGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYYVEDSRNGIVLKLLS----VV 196

Query: 142 ASVTLVIMSFVFVAIPLALAYVRKF-FPALGNLLLIIW--N-GRIYATMLALFIGLIFVH 197
            +V + ++  V +A+P   + +  F F  LG    + W  N  RI   ++ +FI  I ++
Sbjct: 197 FTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIIIFIVFIVLY 256

Query: 198 LFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
              P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+  L++LY+
Sbjct: 257 SVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGIIILLLWLYI 316

Query: 258 LGVFFILGAELNA 270
                I+GAE+NA
Sbjct: 317 TSFIIIVGAEINA 329


>gi|332711504|ref|ZP_08431435.1| putative membrane protein [Lyngbya majuscula 3L]
 gi|332349482|gb|EGJ29091.1| putative membrane protein [Lyngbya majuscula 3L]
          Length = 350

 Score = 55.8 bits (133), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 105/219 (47%), Gaps = 10/219 (4%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV--VEMRSW 128
           P    +PI +   Q+       LF++S + A + SS  + A   +L+  + +   + R +
Sbjct: 125 PAQAVQPIQEFTEQIHLSTNSSLFSLSFIIAIWVSSGALSAAMNALDHIHHIPREQQRPF 184

Query: 129 YITRLISFGYVLLASVTLVIMSF-VFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           +  +LIS G  + + + LVI SF VF++  +    V     ++   L  +    +  +M+
Sbjct: 185 WKAKLISLGLTIGSIILLVIASFLVFISHWVLKTVVDTSGASILLTLWSLLTWPVALSMV 244

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIV-TFSTYSTMYAGLA 246
           A      F++ + P+       ILPG +   ISW V + LF HY+   FS Y+ +Y  + 
Sbjct: 245 A--ASFAFIYRYGPSRWQLGTPILPGAVLAAISWAVASGLFRHYVTANFSNYNKVYGTVT 302

Query: 247 SIMTCLVFLYMLGVFFILGAELN----ASMIIYYWRKKP 281
           +++   ++LYM  +  +LG +LN     +M   + R +P
Sbjct: 303 AVIILQLWLYMTSLLLLLGDQLNVIVGEAMQASHRRPRP 341


>gi|116511406|ref|YP_808622.1| ribonuclease BN-like family protein [Lactococcus lactis subsp.
           cremoris SK11]
 gi|116107060|gb|ABJ72200.1| Ribonuclease BN-like family enzyme [Lactococcus lactis subsp.
           cremoris SK11]
          Length = 301

 Score = 55.8 bits (133), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 70/261 (26%), Positives = 125/261 (47%), Gaps = 28/261 (10%)

Query: 28  ASHISLSA-------LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           +S +SLS+       LL++FP  +   N+  FL  H     ++  +    P  + + I  
Sbjct: 25  SSEMSLSSIAVAYYLLLAIFPLGLIIGNILPFL--HIDTSGLLSFLSEQLPSDVYRGIEP 82

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI----SF 136
            I  +L     GL ++S LA  +  S  + AL++S+N+AY V   R + ++R+I     F
Sbjct: 83  VINNLLNQRNTGLLSLSVLAGFWTFSRALSALQMSMNKAYEVFNHRDFIVSRVIGLAAGF 142

Query: 137 GYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFV 196
             +L    ++V+ +F      L L  V + F    +L   + N  + A  +A F+ L+ +
Sbjct: 143 AILLFLYFSIVLSTFG----QLILEQVHRIFAFDDHLYRTLHNMTLPAIAVATFLSLMML 198

Query: 197 HLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS-TMYAGLASIMTCLVF 254
           +  LP  K  K+   +PG IF+  ++V+  V  T++I  + +++      L  I + +VF
Sbjct: 199 YFILPNVKIRKLRYTMPGTIFS--TFVL--VFLTNWIAKYVSFALQRLDDLKLIGSLVVF 254

Query: 255 LYMLGVFF-----ILGAELNA 270
             M+   F     I+GA LNA
Sbjct: 255 ALMIWFIFIARVLIIGAILNA 275


>gi|226323653|ref|ZP_03799171.1| hypothetical protein COPCOM_01428 [Coprococcus comes ATCC 27758]
 gi|225207837|gb|EEG90191.1| hypothetical protein COPCOM_01428 [Coprococcus comes ATCC 27758]
          Length = 277

 Score = 55.5 bits (132), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 102/219 (46%), Gaps = 6/219 (2%)

Query: 57  QFVP----TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEAL 112
           Q+ P     V+  V   +PE   +     I+  +   +K +  I+A+ A + +  GV A+
Sbjct: 47  QYTPVTKADVMTAVVNLFPETSMQDFMVGIVNEVYNQSKTVIPITAIVALWSAGKGVLAV 106

Query: 113 RISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALA-YVRKFFPALG 171
              LN AY + E R++   R+ +  Y +L  +  ++M+ V       ++ ++    P L 
Sbjct: 107 STGLNCAYELRETRNYVFLRIRASIYTILF-IAAIVMALVLSVFGNNISIFIYHKIPFLA 165

Query: 172 NLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHY 231
               +I   R   + +A+    + V+ FLP  K     ++ G IF  + W+V + +F+ Y
Sbjct: 166 ETTDMIMRLRTVISFVAMTGISLLVYHFLPNRKLPFRDLILGSIFCSLGWLVISFVFSMY 225

Query: 232 IVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
           +  F  +S +Y  + +I+  +++LY      +LG  +N 
Sbjct: 226 LTIFKGFSGLYGSMTAIILVMLWLYFCMYVMLLGGLINC 264


>gi|77164583|ref|YP_343108.1| ribonuclease BN [Nitrosococcus oceani ATCC 19707]
 gi|254434849|ref|ZP_05048357.1| YihY family protein [Nitrosococcus oceani AFC27]
 gi|76882897|gb|ABA57578.1| Ribonuclease BN [Nitrosococcus oceani ATCC 19707]
 gi|207091182|gb|EDZ68453.1| YihY family protein [Nitrosococcus oceani AFC27]
          Length = 328

 Score = 55.5 bits (132), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 56/267 (20%), Positives = 127/267 (47%), Gaps = 8/267 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI Y   +   +++   +A+ ++  ALL++FP +V   ++ G +     V    D + G 
Sbjct: 28  DIAYRIKDSLDDDNISIVAAGVAFYALLAIFPALVAMVSIYGIIADPADVQRQFDALSGI 87

Query: 70  WPEVIAKPITDEILQVLAVPAKGL---FTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P      +++++ ++ +  +  L     +  + A + ++ G +A  I+LN  Y   E R
Sbjct: 88  LPTEAQVLLSEQLRRITSQASTALSVGVGVGVILALWSATRGTKAFIIALNIVYGEKEKR 147

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            +     I+    L A V  ++   + V +P+ L+Y+    P +  +L  +    + A  
Sbjct: 148 GFLKLNAIALMLTLGAIVLAILALGMIVVLPILLSYLD--LPEIFQVLASLLPWLLLA-- 203

Query: 187 LALFIGLIFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
               +GL  ++ + P+ ++++   +  G +   + W+VG+ LF+ Y+  F+ Y+  Y  +
Sbjct: 204 FTFILGLAVLYRYGPSRSEARWRWVSWGAVAATVLWIVGSALFSFYVANFAQYNKTYGSV 263

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASM 272
            +++  L++ ++     +L AE NA M
Sbjct: 264 GALIILLMWFFVTAYIILLAAEFNAEM 290


>gi|148271712|ref|YP_001221273.1| putative tRNA processing ribonuclease BN [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
 gi|147829642|emb|CAN00558.1| putative tRNA processing ribonuclease BN [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
          Length = 363

 Score = 55.5 bits (132), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 66/276 (23%), Positives = 126/276 (45%), Gaps = 25/276 (9%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG-AHQFVPTVIDVVFGA 69
           ++   +  F  +    +A+ ++  A+LS+FP ++   +L G  G   Q V  V+D++ G 
Sbjct: 36  VLRKTVREFGSDQCTDIAASLTYYAVLSLFPALIAIISLLGVFGQGQQTVTAVLDLLRGF 95

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSW 128
            P      I   +   +  PA G   +S +  A +S++G V A   ++NR Y + E R +
Sbjct: 96  APADALALIEPILTGFVESPAAGFALVSGIVLAIWSASGYVGAFTRAMNRIYEIPEGRPF 155

Query: 129 YITRLISFGYVLLASVTLVIMSFVF-VAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
              + +     L+  V L++ + +  ++ P+  A        LG  + I+W+   +  +L
Sbjct: 156 LKLKPMQLAVTLIGIVILLVCALIIAISGPVTDAIGEAL--GLGPTVQIVWSIAKW-PVL 212

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVL-----------FTHYIVTFS 236
           A  I L+   L+     +K         F W+S  VGA +           F  Y+  FS
Sbjct: 213 AFAIVLLIAILYYATPNAKQPK------FRWMS--VGAAIALVVLVVASVGFAFYVTEFS 264

Query: 237 TYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           +Y+  Y  LA ++  L++L++  +  + GAE +A +
Sbjct: 265 SYAKSYGALAGVVVFLLWLWIANLALLFGAEFDAEL 300


>gi|15675286|ref|NP_269460.1| hypothetical protein SPy_1353 [Streptococcus pyogenes M1 GAS]
 gi|71910915|ref|YP_282465.1| ribonuclease BN [Streptococcus pyogenes MGAS5005]
 gi|13622462|gb|AAK34181.1| conserved hypothetical protein [Streptococcus pyogenes M1 GAS]
 gi|71853697|gb|AAZ51720.1| ribonuclease BN [Streptococcus pyogenes MGAS5005]
          Length = 321

 Score = 55.5 bits (132), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 64/272 (23%), Positives = 127/272 (46%), Gaps = 21/272 (7%)

Query: 13  YDAIEHFVEEDGWAMASHISLSAL-------LSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
           Y+ I+ F+       ++ + LSA+       L+ FP IV  AN+  +L     +  ++ +
Sbjct: 16  YEPIQVFMRH---LQSAEMDLSAIAVAYYLILTAFPLIVIAANIFPYLNID--IADLLRL 70

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           +    P+ I +P +  +  + + P+  +  ++ L   +  S  + +L+ ++N+AY   + 
Sbjct: 71  MKQNLPKDIFRPASAIVENIFSKPSGSVLGVATLTGLWTMSRSLTSLQKAINKAYGASQH 130

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFV-AI--PLALAYVRKFFPALGNLLLIIWNGRI 182
           R ++I  L+    +L + + L +++F  + +I    A+  + K +    N+  I      
Sbjct: 131 RDFFIGHLVG---LLTSLIILFLLAFALIFSIFSKAAIQVLDKHYHLSDNITTIFLLLIQ 187

Query: 183 YATMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
             T+L +F+GL+ ++  LP  K  KI  ILPG +FT       + L  +Y+V        
Sbjct: 188 PITVLIIFVGLMLLYFLLPNVKIKKIRYILPGTLFTSFVMTFLSNLVGNYVVYNVERMVD 247

Query: 242 YAGLASIMTCLVFLY--MLGVFFILGAELNAS 271
                S+M  ++ L+   L    ILGA  NA+
Sbjct: 248 IKMFGSVMIFIIMLWFIFLARILILGAIFNAT 279


>gi|126729991|ref|ZP_01745803.1| ribonuclease BN, putative [Sagittula stellata E-37]
 gi|126709371|gb|EBA08425.1| ribonuclease BN, putative [Sagittula stellata E-37]
          Length = 322

 Score = 55.5 bits (132), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 61/261 (23%), Positives = 115/261 (44%), Gaps = 30/261 (11%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVL 86
           +A+ I+  ALLS+FP I     LAG      F+    D +    P    + +  ++ +V+
Sbjct: 37  LAAGIAFYALLSLFPGITAAVALAGLFTDPSFMVETSDALADVVPTAAEEIMLGQLREVV 96

Query: 87  AVPAK--GLFTISALAAAYFS-SNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLAS 143
              +   G   + ++  A FS S   +   I LN  Y   E R +   RL++    L   
Sbjct: 97  TTSSSSLGWAVLLSIGLALFSASRATQNFIIGLNVIYGEKERRGFIKLRLLNIALTLGLI 156

Query: 144 VTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI-----------G 192
           + LVI   +  A+P A +++               + R + T L L++           G
Sbjct: 157 IGLVIAIAIVAAMPAAASFI---------------SNRTWVTDLVLYLRWPVLFIVGAFG 201

Query: 193 LIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
           + FV    P+ + ++   + PG +     WV+G++ F+ Y+ +F TY+  +  L  ++  
Sbjct: 202 IAFVFRVGPSRRYARWRWLTPGALLACALWVIGSIGFSRYVASFGTYNETFGALGGVIVL 261

Query: 252 LVFLYMLGVFFILGAELNASM 272
           L +L++     +LGA ++A +
Sbjct: 262 LTWLWLTAYIVLLGAAVDAEL 282


>gi|255038759|ref|YP_003089380.1| ribonuclease BN [Dyadobacter fermentans DSM 18053]
 gi|254951515|gb|ACT96215.1| ribonuclease BN [Dyadobacter fermentans DSM 18053]
          Length = 310

 Score = 55.5 bits (132), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 56/272 (20%), Positives = 125/272 (45%), Gaps = 17/272 (6%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
           + I+ +++    +H +++   A+A  ++L+A    FP I+F   L  ++        ++ 
Sbjct: 31  YDIILNLVASNRKHEIDQRASAVAYSLTLAA----FPGIIFLFTLIPYIPIENLDQQILV 86

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
           ++    P+   +     IL +++ P  G+ ++  + A   S+NG+ +L  S +  Y   E
Sbjct: 87  LLRNNMPQGTFEAADQTILDIVSRPRSGVLSLGFIFAMIASTNGMMSLMRSFDMVYDDKE 146

Query: 125 MRSWYITR------LISFGYVLLASVTLVIMSFVFVAIPLALAYVR-KFFPALGNLLLII 177
            R +   R       +    VL  SV L+I+    ++I      +R  +  AL N+L   
Sbjct: 147 TRGFLAIRGIATLLTLLLIAVLCLSVVLLIVGDAVMSIVGDWHIIRDNWLIALLNIL--- 203

Query: 178 WNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
              R   +  +L + +  ++ F P+   +   +  G +   +  +     F+ Y+  FS+
Sbjct: 204 ---RYLISFGSLMLTISIIYRFAPSHGRQFTFVNAGSVIASVLILAATYGFSFYLSRFSS 260

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
           Y+ +Y  + +++  ++++Y+L    ILG E+N
Sbjct: 261 YNKLYGSIGTMIALMIWIYLLAFVIILGFEIN 292


>gi|327474796|gb|EGF20201.1| ribonuclease BN [Streptococcus sanguinis SK408]
 gi|332362522|gb|EGJ40322.1| ribonuclease BN [Streptococcus sanguinis SK1056]
          Length = 302

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 116/243 (47%), Gaps = 11/243 (4%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           L+SVFP ++   N+  +   H  V   +  +    PE +   +   + +VL  P+ GL +
Sbjct: 43  LISVFPLLLIVVNILPYF--HIPVADFLTAIKDMLPETLYDVVAKVMREVLTQPSTGLLS 100

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
            S L+A +  S  +  L+I+ N+AY V + R     R++S    L   +   +  F+ + 
Sbjct: 101 FSVLSALWTFSKSMNFLQIAFNKAYGVAKSRGLISHRVMSLFVSLGLQILFALALFLTMF 160

Query: 156 IPLALAYVRKFFPALGNL---LLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIMSIL 211
             ++L ++R ++     L   L       IYA + A+ + L F   FLP  K +K   +L
Sbjct: 161 GHMSLDFLRTYWKLDNQLYQHLQHFTEPLIYALLFAVLVMLYF---FLPNVKINKKRYVL 217

Query: 212 PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI-MTCLVFLY-MLGVFFILGAELN 269
           PG  F +++ +    +F+ Y+  +  +       +SI M  ++F + M+    I+GA LN
Sbjct: 218 PGSAFVFLTILALLNIFSVYMDNYLNHLVDVRFFSSIIMVVMMFWFIMIAKILIVGAVLN 277

Query: 270 ASM 272
           AS+
Sbjct: 278 ASI 280


>gi|271961924|ref|YP_003336120.1| ribonuclease BN [Streptosporangium roseum DSM 43021]
 gi|270505099|gb|ACZ83377.1| ribonuclease BN [Streptosporangium roseum DSM 43021]
          Length = 334

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/272 (22%), Positives = 125/272 (45%), Gaps = 14/272 (5%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           +D++   ++ F E++    A+ ++  A+LS+FP ++   ++ G  G      +++D   G
Sbjct: 41  WDVLKRTVKEFQEDNLTDWAAALTYYAVLSIFPALLAVISVLGLFG-QSATQSLVDN-LG 98

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALA---AAYFSSNGVEALRISLNRAYRVVEM 125
           A     A+   D +LQ L    +     + +    A + +S+ V A   + N  Y + E 
Sbjct: 99  ALAPGPARQTIDTVLQALQSSQRAAGIAAIIGIAVALWSASSYVGAFMRAANVMYEMPEG 158

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAI--PLALAYVRKFFPALGNLLLIIWNGRIY 183
           R  + T  +  G   + +V +++M+   VA+     LA        +G   L +W G + 
Sbjct: 159 RPVWKTLPLRLG---ITAVLVILMAVGSVAVVFTGGLAEQAGKVLGVGETGLAVW-GVVK 214

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMS---ILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
             +L + + L+   L+  A   +      I PG +   + W+  +  F  Y+  F +YS 
Sbjct: 215 WPILVIIVALVLALLYWAAPNVQHPGFRWITPGSMIAVVLWIAASAAFGFYVANFGSYSK 274

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
            YA LA ++  L++L++  +  +LG E +A +
Sbjct: 275 TYAALAGVVVFLIWLWITNIAVLLGVEFDAEL 306


>gi|295136139|ref|YP_003586815.1| ribonuclease BN [Zunongwangia profunda SM-A87]
 gi|294984154|gb|ADF54619.1| ribonuclease BN [Zunongwangia profunda SM-A87]
          Length = 297

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 122/256 (47%), Gaps = 14/256 (5%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP----EVIAKPITDEI 82
           +++ ++  A L+VFP I+   +L G     Q +   I+ +    P    EV+ + + D  
Sbjct: 41  VSAGVAFYAFLAVFPAIMALISLYGLATDPQEIQRQINELSAMMPRQAFEVLQQRV-DVF 99

Query: 83  LQVLAVPAKGLFTISALAAAYFSSN-GVEALRISLNRAYRVVEMRSWYITRLISFGYVLL 141
           LQ       G  T+  +  + +S+N G   L   ++ AY  +E  + +   L++  + + 
Sbjct: 100 LQTHG-DQLGWGTVFGIIFSIWSANKGTNGLLTGVDIAYDTIENHNIFKQYLMASVFTIG 158

Query: 142 ASVTLVIMSFVFVAIPLALAYVRKF-FPALGNLLLIIWNGRIYATMLALFIGLIFVHLFL 200
             + L++   + V  P   A V K   PA    L+      + A ++++F  L  V+ F 
Sbjct: 159 GLIMLILSMILIVGFP---ALVHKIGLPAKLEDLISWSRWLLLAFLVSIF--LCLVYKFA 213

Query: 201 PA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLG 259
           PA  K     ++PG +F+ I W+  +  F+ Y+  F  Y  +Y  +++++  L++LY+  
Sbjct: 214 PARPKPTTRWVIPGALFSTIVWLAASYGFSFYVSNFGNYGEVYGSISAVVVLLLWLYITC 273

Query: 260 VFFILGAELNASMIIY 275
              +LGAE+N  ++ Y
Sbjct: 274 FIILLGAEINTEIVDY 289


>gi|210620881|ref|ZP_03292298.1| hypothetical protein CLOHIR_00241 [Clostridium hiranonis DSM 13275]
 gi|210155093|gb|EEA86099.1| hypothetical protein CLOHIR_00241 [Clostridium hiranonis DSM 13275]
          Length = 284

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/253 (24%), Positives = 113/253 (44%), Gaps = 17/253 (6%)

Query: 26  AMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQV 85
           + A+ ++    +S+FPF++F  +   ++   Q +   +D++    P V A    D +++ 
Sbjct: 26  SKAAEVAFFLTMSIFPFLMFTVSTVAYVPVLQ-ITKYVDMIEQVVP-VKAIGFVDLVIKS 83

Query: 86  LAVPAKGLFTISALAAAYFS-SNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASV 144
                   + I +     ++ S  V+AL   +N A+   E RS+    +IS  +      
Sbjct: 84  AVEKRNTHYMIVSFCLTMWTFSRAVKALIKGMNAAFYSPETRSFLKVMMISMIF------ 137

Query: 145 TLVIMSFVFVAIPLALAYVRKF----FPALG--NLLLIIWNGRIYAT-MLALFIGLIFVH 197
           TL+++  +F ++ L L Y  K     F  LG   +   +WN   YA   +A  I    ++
Sbjct: 138 TLMLLVLIFTSMIL-LVYGEKIGVVIFSYLGFDKVFFNLWNITRYAVGTVATIIVFTLLY 196

Query: 198 LFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
            + P        + PG IF    W + + L+++Y   FS YS +Y     I+  L +LY 
Sbjct: 197 KYTPNINLSAKRVAPGAIFATFGWFLMSYLYSYYTNNFSNYSAIYGSFREIIVLLTWLYF 256

Query: 258 LGVFFILGAELNA 270
                ++G E+NA
Sbjct: 257 SSWVIVIGYEINA 269


>gi|325696058|gb|EGD37949.1| ribonuclease BN [Streptococcus sanguinis SK160]
          Length = 313

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 115/244 (47%), Gaps = 13/244 (5%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           L+SVFP ++   N+  +   H  V   +  +    PE +   +   + +VL  P+ GL +
Sbjct: 48  LISVFPLLLIVVNILPYF--HIPVADFLTAIKDMLPETLYDVVAKVMREVLTQPSTGLLS 105

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL----ISFGYVLLASVTLVIMSF 151
            S L+A +  S  +  L+I+ N+AY V + R     R+    +S G  +L ++TL +  F
Sbjct: 106 FSVLSALWTFSKSMNFLQIAFNKAYGVAKSRGLISHRVMSLFVSLGLQILFALTLFLTMF 165

Query: 152 VFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIMSI 210
             +++     Y  K    L   L       IYA + A+   L+ ++ FLP  K  K   +
Sbjct: 166 GHMSLDFLRTY-WKLDNQLYQHLQHFTEPLIYALLFAV---LVMLYYFLPNVKIKKKRYV 221

Query: 211 LPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI-MTCLVFLY-MLGVFFILGAEL 268
           LPG  F  ++ +    +F+ Y+  +  +       +SI M  ++F + M+    I+GA L
Sbjct: 222 LPGSAFVLLTILALLNIFSVYMDNYLNHLVDVRFFSSIIMVVMMFWFIMIAKILIVGAVL 281

Query: 269 NASM 272
           NAS+
Sbjct: 282 NASI 285


>gi|325694920|gb|EGD36825.1| ribonuclease BN [Streptococcus sanguinis SK150]
          Length = 308

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 116/243 (47%), Gaps = 11/243 (4%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           L+SVFP ++   N+  +   H  V   +  +    PE +   +   + +VL  P+ GL +
Sbjct: 43  LISVFPLLLIVVNILPYF--HIPVADFLTAIKDMLPETLYDVVAKVMREVLTQPSTGLLS 100

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
            S L+A +  S  +  L+I+ N+AY V + R     R++S    L   +      F+ + 
Sbjct: 101 FSVLSALWTFSKSMNFLQIAFNKAYGVAKSRGLISHRVMSLFVSLGLQILFAFALFLTMF 160

Query: 156 IPLALAYVRKFFPALGNLLLIIWN---GRIYATMLALFIGLIFVHLFLPAAK-SKIMSIL 211
             ++L ++R ++     L   + N     IYA + A+   L+ ++ FLP  K +K   +L
Sbjct: 161 GHMSLDFLRTYWKLDSQLYQHLQNFTEPLIYALLFAV---LVMLYYFLPNVKINKKRYVL 217

Query: 212 PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI-MTCLVFLY-MLGVFFILGAELN 269
           PG  F  ++ +    +F+ Y+  +  +       +SI M  ++F + M+    I+GA LN
Sbjct: 218 PGSAFVLLTILALLNIFSVYMDNYLNHLVDVRFFSSIIMVVMMFWFIMIAKILIVGAVLN 277

Query: 270 ASM 272
           AS+
Sbjct: 278 ASI 280


>gi|55823460|ref|YP_141901.1| tRNA-processing ribonuclease BN [Streptococcus thermophilus
           CNRZ1066]
 gi|55739445|gb|AAV63086.1| tRNA-processing ribonuclease BN,putative [Streptococcus
           thermophilus CNRZ1066]
          Length = 319

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 112/244 (45%), Gaps = 15/244 (6%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           +L+VFP IV  AN+  +L        ++  +    P+    P  + I  + + P+  L  
Sbjct: 43  ILTVFPLIVIAANVFPYLNID--TTDLLKFMNEHLPKHFYAPAANVIQDIFSTPSGRLLG 100

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
           +S+L   +     + +L+ ++++ Y   E R  +I+ +I     L+    L     + + 
Sbjct: 101 VSSLTGFWTMIKSLSSLQKAIDKVYGASEHRDVFISHIIGGLLSLVILFLLTFALMLSII 160

Query: 156 IPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIMSILPGV 214
           I   L  + + +P   NL  +I N     ++  +F+G++ ++  LP  K  KI  I+PG 
Sbjct: 161 IQSVLRVINQTYPIGSNLTQLILNSIQPLSVAVVFLGMMVLYFILPNVKIRKIRYIMPGT 220

Query: 215 IFTWISWVVG--AVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFF-----ILGAE 267
           IFT  + V+G  + LF  Y++   +         SIM   +F++ML   F     I GA 
Sbjct: 221 IFT--TLVIGYLSNLFGTYVIHTLSRLVDIKLFGSIM---IFIFMLWFIFLARILIFGAI 275

Query: 268 LNAS 271
            NA+
Sbjct: 276 FNAT 279


>gi|269929219|ref|YP_003321540.1| ribonuclease BN [Sphaerobacter thermophilus DSM 20745]
 gi|269788576|gb|ACZ40718.1| ribonuclease BN [Sphaerobacter thermophilus DSM 20745]
          Length = 369

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 125/275 (45%), Gaps = 16/275 (5%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW--- 70
           + +  F ++D   MA+  +   + S+ P ++F A L+G +  +    T +DV FG     
Sbjct: 14  EVVREFSDDDVTGMAAQAAYQIIFSLPPLLIFFAALSGLVARY----TGVDV-FGQLLSL 68

Query: 71  -PEVIAKPITDEILQVLA----VPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
             E +   + D +  +L       + GL +   L A + +S  +  +    NRAY V + 
Sbjct: 69  AEEGLPASVFDTVEIILGGIQEQSSAGLLSFGFLLAIWSASGALNTMISLFNRAYDVDDT 128

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYA 184
           R +   RL++ G  +  +V LVI +FV       +      F  LG    ++WN  R  A
Sbjct: 129 RGFIKKRLLAIGLTIGLAV-LVIGAFVLFVFGQRIGLWIAEFAGLGEAFTLVWNIVRWPA 187

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
            ++ + + L  ++   PA +     I PG +F  + W++    F+ Y+  FS   + Y  
Sbjct: 188 IVIFMMLALAILYWAGPAIEQTFRWISPGAVFATLLWLLATFGFSLYL-RFSNPGSAYGI 246

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           L  ++  L FLY+  +  +LG E+NA +   Y  K
Sbjct: 247 LGGLVVLLFFLYLSSIVLLLGCEVNAVIDKRYDPK 281


>gi|317124596|ref|YP_004098708.1| ribonuclease BN [Intrasporangium calvum DSM 43043]
 gi|315588684|gb|ADU47981.1| ribonuclease BN [Intrasporangium calvum DSM 43043]
          Length = 355

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 127/270 (47%), Gaps = 21/270 (7%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG-AHQFVPTVIDVV----FGA 69
           A   F  ++   +A+ ++   +LS+FP ++   +L G  G     V +++D++     G 
Sbjct: 40  AAHEFGHDECTDLAAGLTYYGVLSIFPGLLALVSLLGVFGRGRSTVESLLDILEAVGQGD 99

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSW 128
             + +  PITD    ++   A GL  +  L  A +S++G V A   ++NR Y V E R +
Sbjct: 100 SADTLRGPITD----MVNSGAAGLTLVVGLVGAVWSASGYVGAFGRAMNRIYGVDEGRPF 155

Query: 129 YITRLISFG----YVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
              R ++      +V++A+  L+++  V       LA        LG   +  W+   + 
Sbjct: 156 IRLRPLNLALTVAFVIMAA--LILLGLVLTG---DLARAVGDTIGLGGAAVTTWSIAKWP 210

Query: 185 TMLALFIGLI-FVHLFLPAAKSKIMSILP-GVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
            +L L I ++  ++   P  K      L  G +   ++ +V +V F  Y+  FS Y   Y
Sbjct: 211 VILILVIAMVALLYWATPNVKQPRFRWLSVGAVIAILAAIVASVGFGFYVSGFSNYDKTY 270

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASM 272
             LA ++  L++++++ +  + GAE++A M
Sbjct: 271 GSLAGVIVFLLWMWLMNLALLFGAEVDAEM 300


>gi|228477289|ref|ZP_04061927.1| ribonuclease BN [Streptococcus salivarius SK126]
 gi|228251308|gb|EEK10479.1| ribonuclease BN [Streptococcus salivarius SK126]
          Length = 313

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 118/247 (47%), Gaps = 21/247 (8%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           +L+VFP IV  AN+  +L        ++  +    P+    P  + +  + + P+  L  
Sbjct: 37  ILTVFPLIVIAANVFPYLNID--TTDLLKFMNEHLPKQFYAPAANVVQDIFSTPSGQLLG 94

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFV- 154
           +++L   +     + +L+ ++N+ Y   E R  +I+ +I  G++ L  V L +++F  + 
Sbjct: 95  VASLTGFWTMIKSLSSLQKAINKVYGASEHRDVFISHIIG-GFMSL--VILFLLTFALML 151

Query: 155 --AIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIMSIL 211
              I   L  + + +P    +  +I N     ++  +F+G++ ++  LP  K  KI  ++
Sbjct: 152 STIIQSVLRVINQTYPIGSKMTQLILNSIQPLSIAVVFLGMMVLYFVLPNVKIRKIRYVM 211

Query: 212 PGVIFTWISWVVG--AVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFF-----IL 264
           PG IFT  + V+G  + LF  Y++   +         SIM   +F++ML   F     IL
Sbjct: 212 PGTIFT--TLVIGYLSNLFGTYVIRTLSRLVDIKLFGSIM---IFVFMLWFIFLARILIL 266

Query: 265 GAELNAS 271
           GA  NA+
Sbjct: 267 GAVFNAT 273


>gi|299137399|ref|ZP_07030581.1| ribonuclease BN [Acidobacterium sp. MP5ACTX8]
 gi|298600804|gb|EFI56960.1| ribonuclease BN [Acidobacterium sp. MP5ACTX8]
          Length = 343

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 91/201 (45%), Gaps = 20/201 (9%)

Query: 84  QVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLAS 143
           Q  A    G  T+  +AA + +S G  A++  +N  Y+V E R ++  R    G  +L +
Sbjct: 116 QTAAAATGGKITLGLVAALWSASVGFAAIQDGMNTVYKVRESRPYWKAR----GAAILVT 171

Query: 144 VTLVIMSFVFVAIPLA------LAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIF-- 195
           + L +M    + + L       L YVR +  AL     I+    ++     +  GL+   
Sbjct: 172 MLLSVMVTANLGVLLGGDLIAKLVYVRIWHHALATTTAIV----VHLVQWVVASGLLLLQ 227

Query: 196 ---VHLFLPAAKSKIMS-ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
              ++ F P  K+K    I PG       WV+ ++    Y+  F  +S  Y  L +++  
Sbjct: 228 FSTIYYFAPDLKAKRWHWITPGAAIGISGWVLASLGLRVYLHFFDNFSLTYGSLGAVIIL 287

Query: 252 LVFLYMLGVFFILGAELNASM 272
           L + Y+ G+  +LGAE+N+ +
Sbjct: 288 LTWFYITGLMLLLGAEINSEI 308


>gi|329116369|ref|ZP_08245086.1| YihY family protein [Streptococcus parauberis NCFD 2020]
 gi|326906774|gb|EGE53688.1| YihY family protein [Streptococcus parauberis NCFD 2020]
          Length = 310

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 113/246 (45%), Gaps = 19/246 (7%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           +L+VFP IV  AN+  +L     +  ++ ++  + P  I +     ++ + + PA G+  
Sbjct: 43  ILTVFPLIVIAANIFPYLNID--IRDLLQLMKQSLPNDIYQSARSVVINIFSKPAGGVLG 100

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASV-TLVIMSFVFV 154
           ++     +  S  + +L+ ++N+AY     R + +  L+     LLAS+  L +++FV +
Sbjct: 101 VATFTGLWTMSKSLTSLQRAINKAYDASPHRDFLLGHLVG----LLASIFILFLLAFVLI 156

Query: 155 AIPLALAYVR------KFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKI 207
               + A ++           L +L L +       T++ + +GL+ ++  LP  +  KI
Sbjct: 157 FSTFSKAAIQVMDNHYHLSDGLTSLFLTLIQP---VTIIIILLGLMALYFLLPNIRIKKI 213

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY--MLGVFFILG 265
             I+PG +FT       + L  HY+V             S+M  ++ L+   L    ILG
Sbjct: 214 RYIMPGALFTGFVMTFLSNLIGHYVVVNVEKMVDIKTFGSVMIFIIMLWFIFLARILILG 273

Query: 266 AELNAS 271
           A  NA+
Sbjct: 274 AIFNAT 279


>gi|306833155|ref|ZP_07466285.1| possible ribonuclease BN [Streptococcus bovis ATCC 700338]
 gi|304424729|gb|EFM27865.1| possible ribonuclease BN [Streptococcus bovis ATCC 700338]
          Length = 309

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 67/261 (25%), Positives = 122/261 (46%), Gaps = 24/261 (9%)

Query: 27  MASHISLSA-------LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPIT 79
            ++ I LSA       LL+ FP IV  AN+  +L     +  ++  +    P  +   ++
Sbjct: 27  QSAEIDLSAIAVAYYLLLTAFPLIVIAANIFPYLNID--ISVLLSFMEKNLPTNLYPSVS 84

Query: 80  DEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYV 139
                + + P+  +  ++ L A +  S  + +L+ ++N+AY V + R + I RLI    V
Sbjct: 85  AITTDIFSKPSGSILGVATLTAFWTMSKSLTSLQKAINKAYGVSQHRDFVIGRLIG---V 141

Query: 140 LLASVTLVIMSFVFVAIPL---ALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFV 196
           L + + L +++FV +       AL  +   +     +  ++ N     T+L +  GL+ +
Sbjct: 142 LASLLILFLLTFVLIFSTFSKAALQIISTHYDLSDTVATVVLNLSQPVTVLTIVFGLMLL 201

Query: 197 HLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFL 255
           +  LP  K  +   ILPG IFT    V    LF++YI+   T+  M   + +  + ++F+
Sbjct: 202 YFILPNVKIRRFRYILPGTIFTSFVIVFLNNLFSNYIL--RTFERM-VDIKTFGSVVIFV 258

Query: 256 YMLGVFF-----ILGAELNAS 271
            ML   F     ILGA  NA+
Sbjct: 259 LMLWFIFLAHILILGAIFNAT 279


>gi|227893136|ref|ZP_04010941.1| possible ribonuclease BN [Lactobacillus ultunensis DSM 16047]
 gi|227865002|gb|EEJ72423.1| possible ribonuclease BN [Lactobacillus ultunensis DSM 16047]
          Length = 307

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 107/217 (49%), Gaps = 9/217 (4%)

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
           ++VVF   P+ +++ I   +  +L   + G  +   + A +  SN V A+R+  NR Y V
Sbjct: 67  LNVVF---PDQVSEFIMPIVNSLLKTTSTGYMSFGIILAVWSFSNLVNAIRLGENRLYGV 123

Query: 123 --VEMR----SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLI 176
             VE++    ++  TR+I+  +  L  +    +S V V     L  ++  F    N +  
Sbjct: 124 HQVELKLSIVNFIWTRMITIAFTALMIIIFTAVSIVLVFGQQLLNVLQPIFHLPVNEINK 183

Query: 177 IWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFS 236
           I++ R    +L + + + +++  LP  K K   I PGVI T I W+  + LF+ Y+  F 
Sbjct: 184 IFSYRYPVVILVMVLAVSYLNYVLPNIKLKKRVIWPGVITTVIGWLGLSFLFSFYLHNFP 243

Query: 237 TYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
                Y  + + +  +++L +  V F++G  +NA++I
Sbjct: 244 ITWENYGIVGTFIIFMLWLNIAAVLFLVGVAVNAAII 280


>gi|184200660|ref|YP_001854867.1| hypothetical protein KRH_10140 [Kocuria rhizophila DC2201]
 gi|183580890|dbj|BAG29361.1| hypothetical membrane protein [Kocuria rhizophila DC2201]
          Length = 400

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/262 (23%), Positives = 122/262 (46%), Gaps = 5/262 (1%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVIDVVFGAWPEV 73
           A+  F ++    +A+ ++  A+LSVFP ++   +L G  G  +     ++D +    P  
Sbjct: 82  ALSEFTKDGCTDLAASLTYFAVLSVFPALLALVSLLGVFGQGEATTKAILDFLNQYAPSA 141

Query: 74  IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITR 132
           + + ++D I Q+      GL  +  +  A ++++G   A   +LNR Y V E R ++  +
Sbjct: 142 LVELLSDPISQLTTQSGAGLALVVGIVGALWTASGYTGAFSRALNRIYEVSEGRPFWKLK 201

Query: 133 LISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFI 191
            +    V L  V +V    V V +   LA        LG+  + +WN  +I   +L L +
Sbjct: 202 PVML-LVTLIVVLIVAAVMVMVLLSGDLAQTLGDAVGLGSTAVTVWNWVKIPVVLLLLVL 260

Query: 192 GLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
            +  +    P  +  K   + PG   + +  +V  + F  Y+  F+ Y+  Y  + S++ 
Sbjct: 261 LIAILFYATPNVQQPKFRWMSPGAAISLVFMIVAGLAFAFYVANFAKYNATYGVIGSVII 320

Query: 251 CLVFLYMLGVFFILGAELNASM 272
            L+ L+++    + GAE++A +
Sbjct: 321 LLLGLWIMNNALLFGAEVDAEL 342


>gi|150376889|ref|YP_001313485.1| putative ribonuclease BN [Sinorhizobium medicae WSM419]
 gi|150031436|gb|ABR63552.1| putative ribonuclease BN [Sinorhizobium medicae WSM419]
          Length = 328

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/272 (23%), Positives = 128/272 (47%), Gaps = 20/272 (7%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D+ +  +    E+    +A+ ++   LLSVFP +    ++ G +     +      +   
Sbjct: 36  DVFWRVVAQVSEDRISLVAAGVTFYVLLSVFPALASLVSIYGLVSDPGTIAEQASYLAAI 95

Query: 70  WPEVIAKPITDEILQVLAVPAKGL---FTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P    + +TD++  + +     L   F    L A + + NGV AL  ++N AY   E R
Sbjct: 96  LPAQSLQLMTDQLKALASQNTSSLSLGFIGGLLFALWSARNGVSALFEAMNIAYDETEKR 155

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI---- 182
            +    L+S G+ L     L++ + +  AI +         PAL + L +   G I    
Sbjct: 156 GFIRLALLSIGFTL---AGLILTAVLIGAIAV--------LPALLSFLDLKLQGIISFAR 204

Query: 183 YATMLALFIGLI-FVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           +  ML L   +I  ++ + P+ + +K+  +  G   + + W+V ++ F++YI  F+ Y+ 
Sbjct: 205 WPVMLLLIAAVITLIYRYGPSREPAKLRWLTWGAALSTVCWLVASLAFSYYIDNFANYNA 264

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
            Y  L +++  ++++++  +  I+GAELNA +
Sbjct: 265 TYGALGALIGFMLWIWISTMIVIVGAELNAEL 296


>gi|332359440|gb|EGJ37260.1| putative ribonuclease BN [Streptococcus sanguinis SK355]
          Length = 307

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 122/260 (46%), Gaps = 11/260 (4%)

Query: 19  FVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPI 78
           + E D    +  ++   L+SVFP ++   N+  +   H  +   +  +    PE +   +
Sbjct: 26  YKESDSELSSVAVAYYWLISVFPLLLIVVNILPYF--HIPIADFLTAIKDMLPETLYDVV 83

Query: 79  TDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGY 138
              + +VL  P+ GL + S L+A +  S  +  L+I+ N+AY V + R     R++S   
Sbjct: 84  AKVMREVLTQPSTGLLSFSVLSALWTFSKSMNFLQIAFNKAYGVAKSRGLISHRVMSLFV 143

Query: 139 VLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN---GRIYATMLALFIGLIF 195
            L   +   +  F+ +   ++L ++R ++     L   + N     IYA + A+   L+ 
Sbjct: 144 SLGLQILFALALFLTMFGHMSLDFLRTYWKLDSQLYQHLQNFTEPLIYALLFAV---LVM 200

Query: 196 VHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI-MTCLV 253
            + FLP  K +K   +LPG  F  ++ +    +F+ Y+  +  +       +SI M  ++
Sbjct: 201 FYYFLPNVKINKKRYVLPGSAFVLLTILALLNIFSVYMDNYLNHLVDVRFFSSIIMVVMM 260

Query: 254 FLY-MLGVFFILGAELNASM 272
           F + M+    I+GA LNAS+
Sbjct: 261 FWFIMIAKILIVGAVLNASI 280


>gi|223933150|ref|ZP_03625142.1| ribonuclease BN [Streptococcus suis 89/1591]
 gi|223898211|gb|EEF64580.1| ribonuclease BN [Streptococcus suis 89/1591]
          Length = 309

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 128/279 (45%), Gaps = 23/279 (8%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQF-VPT 61
           + FC+ F   Y +       D    +  ++   L+S+FP ++    LA  L  + F V  
Sbjct: 11  KTFCLTFFSFYRS------ADSDVTSVAVAYYLLISIFPILL---TLANLLPYYPFDVDM 61

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           ++ VV    P+ +   ++  I  VL  P+     IS L   +  S  +  L+ + N+AY 
Sbjct: 62  ILSVVAEFVPDKLYPSVSSFITSVLTKPSSSWLGISILTTLWTLSRSMTILQKAFNKAYG 121

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLAL-AYVRKFFPALGNLLLIIWNG 180
           + E R + I  LI   ++ +    +V++S   +    A+ +Y+ K  P     L  + + 
Sbjct: 122 INEHRDFIIGHLIGI-FLGIGLQVIVLLSITLLTFGQAVFSYINKLVPIEDAWLKGLLSQ 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                ++ALF  L+ ++ FLP  +  K+  + PG +F  ++      LF+ Y+  ++   
Sbjct: 181 TQLVGLMALFAALVMLYFFLPNVRIKKVRYVFPGTLFVLLTMTSIGKLFSIYVDNYANKL 240

Query: 240 TMYAGLASIMTCLVFL-YMLGVFF-----ILGAELNASM 272
             +     I+T +VFL +ML   F     I+GA +NA++
Sbjct: 241 LDF----RIVTAVVFLVFMLWFIFMAQVLIVGAMINATV 275


>gi|315223035|ref|ZP_07864914.1| YihY family protein [Streptococcus anginosus F0211]
 gi|315187985|gb|EFU21721.1| YihY family protein [Streptococcus anginosus F0211]
          Length = 316

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 137/301 (45%), Gaps = 55/301 (18%)

Query: 6   CIVFDIIYDAIEHFVEEDGWA----------MASHISLSA-------LLSVFPFIVFGAN 48
           CI   ++ D ++ FV + G             AS I L++       L+S+FP ++   N
Sbjct: 8   CI---LVGDEMKKFVSKIGQNPFLQSFFKFYQASEIDLTSIAVAYYLLISIFPLLLIVVN 64

Query: 49  LAGF--LGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSS 106
           +  +  +   +F+  + DV+  +  EV+AK   +    +L  P+ GL + S L+A +  S
Sbjct: 65  ILPYFQIPIAEFLEAMEDVLPESLYEVVAKVTRN----LLTQPSSGLLSFSILSALWAFS 120

Query: 107 NGVEALRISLNRAYRVVEMRSWYITRL----ISFGYVLLASVTLVIMSFVFVAIPLALAY 162
             +  L+ + N+AY V + R     RL    IS G   L +++L++  F  +++ L  ++
Sbjct: 121 QSMSFLQKAFNKAYGVAKDRGLISHRLFSLVISLGLQFLFALSLLLTMFGRMSLRLLHSF 180

Query: 163 VRKFFPALGNLLLIIWNGRIYATMLALFIGLIFV---------HLFLPAAK-SKIMSILP 212
                          ++G++YA++  +    I+          + FLP  K  KI  +LP
Sbjct: 181 WE-------------FDGQLYASLQRMTQPTIYTLLFLSLLMLYYFLPNVKIRKIRYVLP 227

Query: 213 GVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY--MLGVFFILGAELNA 270
           G IF   +  V   LF+ Y+ T+  +       +SI   +V ++   +    I+GA LNA
Sbjct: 228 GTIFVVFTIGVLLNLFSVYLDTYVNHLMDVRFFSSIFVVVVMIWFTFIAQIMIIGAILNA 287

Query: 271 S 271
           S
Sbjct: 288 S 288


>gi|288904981|ref|YP_003430203.1| Ribonuclease BN protein [Streptococcus gallolyticus UCN34]
 gi|306831051|ref|ZP_07464212.1| possible ribonuclease BN [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325977948|ref|YP_004287664.1| putative ribonuclease BN protein [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
 gi|288731707|emb|CBI13268.1| putative Ribonuclease BN protein [Streptococcus gallolyticus UCN34]
 gi|304426617|gb|EFM29728.1| possible ribonuclease BN [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325177876|emb|CBZ47920.1| putative ribonuclease BN protein [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 310

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 67/260 (25%), Positives = 122/260 (46%), Gaps = 24/260 (9%)

Query: 28  ASHISLSA-------LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           ++ I LSA       LL+ FP IV  AN+  +L     +  ++  +    P  +   ++ 
Sbjct: 28  SAEIDLSAIAVAYYLLLTAFPLIVIAANIFPYLNID--ISVLLSFMEKNLPTNLYPSVSA 85

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
               + + P+  +  ++ L A +  S  + +L+ ++N+AY V + R + I RLI    VL
Sbjct: 86  ITTDIFSKPSGSILGVATLTAFWTMSKSLTSLQKAINKAYGVSQHRDFVIGRLIG---VL 142

Query: 141 LASVTLVIMSFVFVAIPL---ALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVH 197
            + + L +++FV +       AL  +   +     +  ++ N     T+L +  GL+ ++
Sbjct: 143 ASLLILFLLTFVLIFSTFSKAALQIISAHYDLSDTVATVVLNLSQPVTVLTIVFGLMLLY 202

Query: 198 LFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
             LP  K  +   ILPG IFT    V    LF++YI+   T+  M   + +  + ++F+ 
Sbjct: 203 FILPNVKIRRFRYILPGTIFTSFVIVFLNNLFSNYIL--RTFERM-VDIKTFGSVVIFVL 259

Query: 257 MLGVFF-----ILGAELNAS 271
           ML   F     ILGA  NA+
Sbjct: 260 MLWFIFLAHILILGAIFNAT 279


>gi|27382587|ref|NP_774116.1| hypothetical protein blr7476 [Bradyrhizobium japonicum USDA 110]
 gi|27355759|dbj|BAC52741.1| blr7476 [Bradyrhizobium japonicum USDA 110]
          Length = 376

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/270 (23%), Positives = 122/270 (45%), Gaps = 14/270 (5%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI +   +   ++   A A  +    LL++FP +    +  G       +   +  +   
Sbjct: 81  DIFWRTYQRIDDDRLLATAGGVVFFGLLAIFPAVTALVSSYGLFADPSTISANLQTLATM 140

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTIS-----ALAAAYFSSN-GVEALRISLNRAYRVV 123
            PE   + + D++ +V++   KG  T+       L  A +S+N GV+++  +LN AY   
Sbjct: 141 LPEGSFQIVEDQVARVVS---KGNTTLGVTFLLGLLLAIWSANAGVKSIFDALNVAYEER 197

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E RS+     +S  +     V L++M    VA PLAL ++    P      LI+   R  
Sbjct: 198 EKRSFIRLNSVSLAFTAGGIVALLLMVGAVVAFPLALDHL-GLAP---ESKLIVALARWP 253

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILP-GVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
              L L + L  ++ F P+  +     L  G +   + W+ G+ L + Y+  F+ Y+  Y
Sbjct: 254 LLFLILLVALAILYRFAPSRDAPRWQWLSLGAVAAALLWIAGSALLSWYLSEFANYNATY 313

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASM 272
             L + +  +++++M  +  + GAELN+ +
Sbjct: 314 GSLGAAIGLMMWMWMSAIVIMFGAELNSEI 343


>gi|332361950|gb|EGJ39752.1| ribonuclease BN [Streptococcus sanguinis SK49]
          Length = 307

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 121/252 (48%), Gaps = 23/252 (9%)

Query: 36  LLSVFPFIVFGANLAGFLGA--HQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL 93
           L+SVFP ++   N+  +       F+  + D++    PE +   +   + +VL  P+ GL
Sbjct: 43  LISVFPLLLIVVNILPYFNIPIADFLTAIKDML----PETLYDVVAKVMREVLTQPSTGL 98

Query: 94  FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL----ISFGYVLLASVTLVIM 149
            + S L+A +  S  +  L+ + N+AY V + R     R+    +S G  +L + TL + 
Sbjct: 99  LSFSVLSALWTFSKSMNFLQFAFNKAYGVAKSRGLISHRVMSLVVSIGLQILFAFTLFLT 158

Query: 150 SFVFVAIPLALAYVRKFFPALGNLLLIIWN---GRIYATMLALFIGLIFVHLFLPAAK-S 205
            F      ++L ++R ++     L   + N     IYA + A+   L+  + FLP  K +
Sbjct: 159 MFG----HMSLDFLRTYWKLDNQLYQHLQNFTEPLIYALLFAV---LVMFYYFLPNVKIN 211

Query: 206 KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI-MTCLVFLY-MLGVFFI 263
           K   +LPG +F  ++ +    +F+ Y+  +  +       +SI M  ++F + M+    I
Sbjct: 212 KKRYVLPGSVFVILTILALMNIFSVYMDNYLNHLVDVRFFSSIIMVVMMFWFIMIAKILI 271

Query: 264 LGAELNASMIIY 275
           +GA LNAS+  Y
Sbjct: 272 VGAVLNASIQSY 283


>gi|330833243|ref|YP_004402068.1| ribonuclease BN [Streptococcus suis ST3]
 gi|329307466|gb|AEB81882.1| ribonuclease BN [Streptococcus suis ST3]
          Length = 309

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 115/251 (45%), Gaps = 27/251 (10%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQF-VPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLF 94
           L+S+FP ++  ANL   L  + F V  ++ VV    P+ +   ++  I  VL  P+    
Sbjct: 38  LISIFPILLTLANL---LPYYPFDVDMILSVVAEFVPDKLYPSVSSFITSVLTKPSSSWL 94

Query: 95  TISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS------FGYVLLASVTLVI 148
            IS L   +  S  +  L+ + N+AY + E R + I  LI          ++L S+TL+ 
Sbjct: 95  GISILTTLWTLSRSMTILQKAFNKAYGINEHRDFIIGHLIGIFLGIGLQVIILLSITLLT 154

Query: 149 MSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKI 207
                       +Y+ K  P     L  + +      ++ALF  L+ ++ FLP  +  K+
Sbjct: 155 FG------QAVFSYINKLVPIEDAWLKGLLSQTQLVGLMALFAALVMLYFFLPNVRIKKV 208

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFL-YMLGVFF---- 262
             + PG +F  ++      LF+ Y+  ++     +     I+T +VFL +ML   F    
Sbjct: 209 RYVFPGTLFVLLTMTSIGKLFSIYVDNYANKLLDF----RIVTAVVFLVFMLWFIFMAQV 264

Query: 263 -ILGAELNASM 272
            I+GA +NA++
Sbjct: 265 LIIGAMINATV 275


>gi|253752308|ref|YP_003025449.1| ribonuclease BN-like family protein [Streptococcus suis SC84]
 gi|253754134|ref|YP_003027275.1| ribonuclease BN-like family protein [Streptococcus suis P1/7]
 gi|253756068|ref|YP_003029208.1| ribonuclease BN-like family protein [Streptococcus suis BM407]
 gi|251816597|emb|CAZ52235.1| ribonuclease BN-like family protein [Streptococcus suis SC84]
 gi|251818532|emb|CAZ56363.1| ribonuclease BN-like family protein [Streptococcus suis BM407]
 gi|251820380|emb|CAR46967.1| ribonuclease BN-like family protein [Streptococcus suis P1/7]
 gi|319758704|gb|ADV70646.1| hypothetical protein SSUJS14_1586 [Streptococcus suis JS14]
          Length = 307

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 114/251 (45%), Gaps = 27/251 (10%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQF-VPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLF 94
           L+S+FP ++    LA  L  + F V  ++ VV    P+ +   ++  I  VL  P+    
Sbjct: 38  LISIFPILL---TLANLLPYYPFDVDMILSVVAEFVPDKLYPSVSSFITSVLTKPSSSWL 94

Query: 95  TISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS------FGYVLLASVTLVI 148
            IS L   +  S  +  L+ + N+AY + E R + I  LI          ++L S+TL+ 
Sbjct: 95  GISILTTLWTLSRSMTILQKAFNKAYGINEHRDFIIGHLIGIFLGIGLQVIILLSITLLT 154

Query: 149 MSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKI 207
                       +Y+ K  P     L  + +      ++ALF  L+ ++ FLP  +  K+
Sbjct: 155 FG------QAVFSYINKLVPIEDAWLKGLLSQTQLVGLMALFTALVMLYFFLPNVRIKKV 208

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFL-YMLGVFF---- 262
             + PG +F  ++      LF+ Y+  ++     +     I+T +VFL +ML   F    
Sbjct: 209 RYVFPGTLFVLLTMTSIGKLFSIYVDNYANKLLDF----RIVTAVVFLVFMLWFIFMAQV 264

Query: 263 -ILGAELNASM 272
            I+GA +NA++
Sbjct: 265 LIIGAMINATV 275


>gi|328956776|ref|YP_004374162.1| putative integral inner membrane protein with ribonuclease fold
           [Carnobacterium sp. 17-4]
 gi|328673100|gb|AEB29146.1| putative integral inner membrane protein with ribonuclease fold
           [Carnobacterium sp. 17-4]
          Length = 331

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 70/267 (26%), Positives = 124/267 (46%), Gaps = 14/267 (5%)

Query: 14  DAIEHFVE--EDGWAMA------SHISLSALLSVFPFIVFGANLAGF--LGAHQFVPTVI 63
           D  +HF+E  +  WA A      + ++   LLS+FP ++  AN+     + A   +P V 
Sbjct: 15  DKFKHFLEVFKPNWARAEVSANAAQLAYFTLLSLFPILLVVANVIPLFPIDAADILPMVE 74

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             V      V+A PI +  L   +  A  +  I++L +A   S    AL+  LN  Y V 
Sbjct: 75  TAVPPDIYNVLA-PILENYLSSSSGGAISIGLITSLWSA---SKAFNALQDVLNEVYGVE 130

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           +  ++ I RL+SF   L     + ++ FVFV     L ++  F     +L+L +++ +  
Sbjct: 131 KRNNFIIVRLVSFLVQLAIVAIVGVVIFVFVFGEFILLFLEDFVGIELDLVLQVFSYKWL 190

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
              + L + +  V+  +P  +  I   LPG +F  I W+V +  FT Y+      +   A
Sbjct: 191 VLFIVLILIITMVYFLVPNHRMHIKYALPGAVFATIGWMVLSQAFTLYVQFAGGEAAASA 250

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNA 270
                +  +++LY+  +  +LGA +NA
Sbjct: 251 TFGVFIVLMLWLYLSAIILLLGALINA 277


>gi|315037851|ref|YP_004031419.1| hypothetical protein LA2_03230 [Lactobacillus amylovorus GRL 1112]
 gi|325956325|ref|YP_004291737.1| hypothetical protein LAC30SC_03130 [Lactobacillus acidophilus 30SC]
 gi|312275984|gb|ADQ58624.1| hypothetical protein LA2_03230 [Lactobacillus amylovorus GRL 1112]
 gi|325332890|gb|ADZ06798.1| hypothetical protein LAC30SC_03130 [Lactobacillus acidophilus 30SC]
 gi|327183144|gb|AEA31591.1| hypothetical protein LAB52_03085 [Lactobacillus amylovorus GRL
           1118]
          Length = 305

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 107/224 (47%), Gaps = 23/224 (10%)

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY-- 120
           +D VF   P+ I+K I   I  +L   + G  +   + A +  S+ V A+R+  NR Y  
Sbjct: 67  LDFVF---PDQISKYIMPIINSLLKTTSTGYMSFGIVLAVWSFSSLVNAIRLGENRLYGV 123

Query: 121 RVVEMR----SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLI 176
           R +E++    ++  TR+I+  +  L       M  +F    LAL + ++    L  +  +
Sbjct: 124 RQIELKLSIVNFLWTRMITIAFTTL-------MIILFTGATLALVFGQQLLHFLSPIFQL 176

Query: 177 -------IWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFT 229
                  I++ R    +L + + + +++  LP  K K   I PGVI T I W+  + LF+
Sbjct: 177 PVEEIDKIFSYRYPVVLLMMILAVYYLNYVLPNIKLKKRVIWPGVIVTVIGWLALSFLFS 236

Query: 230 HYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
            Y+  F      Y  + + +  +++L +  + F+LG  +NA+++
Sbjct: 237 FYLHHFPITWENYGIIGTFIIFMLWLNIAAILFLLGVGVNATIV 280


>gi|218132840|ref|ZP_03461644.1| hypothetical protein BACPEC_00701 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991713|gb|EEC57717.1| hypothetical protein BACPEC_00701 [Bacteroides pectinophilus ATCC
           43243]
          Length = 283

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/266 (22%), Positives = 117/266 (43%), Gaps = 19/266 (7%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPE 72
           +  I     +D    A+  S   LLS FPFI         L    ++P   DV+     +
Sbjct: 15  FQIINKIKNDDLPGYAAQSSYFILLSFFPFITL------LLSLIHYLPLEYDVLMQVLND 68

Query: 73  VIAKPITDEILQVLAVPAKGLFTISALAAAYFSS--------NGVEALRISLNRAYRVVE 124
           +I     +  +  +     GL+  S+++   FS+         G  +L    N  + + E
Sbjct: 69  IIPAYFKEAAVSFVG----GLYNSSSISFTGFSAIVTLWAAGRGFMSLMKGFNAIHGIAE 124

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R++ + R IS    LL  + +  +    V     L +  ++FP L  ++  + + +   
Sbjct: 125 DRNFIVRRSISSVQTLLFIIIIAALLIFVVFGNKLLGFTSRYFPYLAIIIEAVIDIKWLF 184

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
             + L +  +F+  F+P+ +  + + LPG + + + W   ++++  Y V  +TY+ M+ G
Sbjct: 185 FPVLLTLAFLFMFKFIPSRRLPLFAQLPGAVISSVGWYGFSLIYAVY-VNNNTYTAMFGG 243

Query: 245 LASIMTCLVFLYMLGVFFILGAELNA 270
           L +++  LV+LY   +    GAE N+
Sbjct: 244 LGTLILALVWLYSCMMILFFGAEFNS 269


>gi|146319270|ref|YP_001198982.1| hypothetical protein SSU05_1616 [Streptococcus suis 05ZYH33]
 gi|146321474|ref|YP_001201185.1| hypothetical protein SSU98_1627 [Streptococcus suis 98HAH33]
 gi|145690076|gb|ABP90582.1| Predicted membrane protein [Streptococcus suis 05ZYH33]
 gi|145692280|gb|ABP92785.1| Predicted membrane protein [Streptococcus suis 98HAH33]
 gi|292558903|gb|ADE31904.1| RNase BN [Streptococcus suis GZ1]
          Length = 313

 Score = 53.9 bits (128), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 113/250 (45%), Gaps = 27/250 (10%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQF-VPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLF 94
           L+S+FP ++    LA  L  + F V  ++ VV    P+ +   ++  I  VL  P+    
Sbjct: 44  LISIFPILL---TLANLLPYYPFDVDMILSVVAEFVPDKLYPSVSSFITSVLTKPSSSWL 100

Query: 95  TISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS------FGYVLLASVTLVI 148
            IS L   +  S  +  L+ + N+AY + E R + I  LI          ++L S+TL+ 
Sbjct: 101 GISILTTLWTLSRSMTILQKAFNKAYGINEHRDFIIGHLIGIFLGIGLQVIILLSITLLT 160

Query: 149 MSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKI 207
                       +Y+ K  P     L  + +      ++ALF  L+ ++ FLP  +  K+
Sbjct: 161 FG------QAVFSYINKLVPIEDAWLKGLLSQTQLVGLMALFTALVMLYFFLPNVRIKKV 214

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFL-YMLGVFF---- 262
             + PG +F  ++      LF+ Y+  ++     +     I+T +VFL +ML   F    
Sbjct: 215 RYVFPGTLFVLLTMTSIGKLFSIYVDNYANKLLDF----RIVTAVVFLVFMLWFIFMAQV 270

Query: 263 -ILGAELNAS 271
            I+GA +NA+
Sbjct: 271 LIIGAMINAT 280


>gi|300114181|ref|YP_003760756.1| ribonuclease BN [Nitrosococcus watsonii C-113]
 gi|299540118|gb|ADJ28435.1| ribonuclease BN [Nitrosococcus watsonii C-113]
          Length = 447

 Score = 53.9 bits (128), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 130/277 (46%), Gaps = 28/277 (10%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D++        E+    +A+ ++  ALL++FP +    ++ G +     V   ++ + G 
Sbjct: 32  DVLLRVKNELSEDKLTVIAAGVAFYALLAIFPALTALVSIYGLVADPADVQQQLNTLSGF 91

Query: 70  WPEVIAKPITDEILQVLA--VPAKGLFTISA-LAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P      + D++  + A    A G+  I + L A + ++ G++ L  +LN  Y   E R
Sbjct: 92  IPAEAQTLLNDQLSSITAHSQTALGVGVIGSILLALWGATKGLKTLMEALNVVYDEKETR 151

Query: 127 SW---YITRLI-SFGYVLLASVTLVIMSFVFVAIPLAL------AYVRKFFPALGNLLLI 176
            +     T LI +FG ++L     VI   + VA+P  L      A VR +      + L+
Sbjct: 152 GFLKLNATALILTFGALMLG----VIAIGLVVALPALLGNFGLGADVRTW------VSLL 201

Query: 177 IWNGRIYATMLALFIGLIFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF 235
            W    +  ML    GL  V+ + P+ ++ +   +  G +   + W+  +V F++Y+  F
Sbjct: 202 RWPVLAFVAML----GLAVVYRYGPSRSQPRWHWVSWGAVLATVLWIAASVGFSYYVSNF 257

Query: 236 STYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           S+Y+  Y  L  ++  L++L++     +LGAELNA M
Sbjct: 258 SSYNETYGSLGGVVVFLMWLFITAFIILLGAELNAEM 294


>gi|261367968|ref|ZP_05980851.1| YihY family protein [Subdoligranulum variabile DSM 15176]
 gi|282569951|gb|EFB75486.1| YihY family protein [Subdoligranulum variabile DSM 15176]
          Length = 281

 Score = 53.9 bits (128), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 51/84 (60%)

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LF+ ++ ++ F+P  K  +   LPG IFT + W+V + +F+ YIV F   S +Y  L +I
Sbjct: 193 LFVLILLIYTFVPGGKRSLRGQLPGTIFTTVGWLVFSRIFSFYIVHFWKLSYIYGSLTAI 252

Query: 249 MTCLVFLYMLGVFFILGAELNASM 272
           +  +++L ++     LGA LNA++
Sbjct: 253 ILMILWLDIIINLLFLGAALNAAL 276


>gi|227819758|ref|YP_002823729.1| ribonuclease [Sinorhizobium fredii NGR234]
 gi|227338757|gb|ACP22976.1| putative ribonuclease protein [Sinorhizobium fredii NGR234]
          Length = 330

 Score = 53.9 bits (128), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/271 (21%), Positives = 128/271 (47%), Gaps = 12/271 (4%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           + D+ +  +    EE  + +A+ +S   LL++FP +    +L GF+     + + + V+ 
Sbjct: 34  IRDVFWRVVSEISEERVFLIAAGVSFYLLLALFPALGALVSLYGFVANPSDIGSHMAVLD 93

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGL---FTISALAAAYFSSNGVEALRISLNRAYRVVE 124
              P      I D++  +    A  L   F    L + + ++NG+ AL  ++N AY   E
Sbjct: 94  ELLPPGSFDLIADQLKSLTTQKASTLSLGFIGGLLVSLWSAANGIAALFDAMNVAYGEKE 153

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALGNLLLIIWNGRI 182
            R      L+   +   A +  VI+      +P  LAY+   ++   L  +       R 
Sbjct: 154 KRGIVSRTLLCLAFTFAALLFAVILIVAIGVLPAMLAYLWLDRWVEILTRV------ARW 207

Query: 183 YATMLALFIGLIFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
            A ++   +G + ++ + P+  ++K+  +  G +F+ + W+  + ++++Y+  F+ Y+  
Sbjct: 208 PAILILATLGTVLIYRYGPSRERAKLRWLNWGAVFSTLLWLAASWIYSYYLENFANYNAT 267

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           Y  L +++  ++++++  V  I GA LNA +
Sbjct: 268 YGALGALIGFMMWVWISMVILITGALLNAEL 298


>gi|298490493|ref|YP_003720670.1| ribonuclease BN ['Nostoc azollae' 0708]
 gi|298232411|gb|ADI63547.1| ribonuclease BN ['Nostoc azollae' 0708]
          Length = 291

 Score = 53.9 bits (128), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 121/259 (46%), Gaps = 25/259 (9%)

Query: 26  AMASHISLSALLSVFPFIVFGANLAGFLG---AHQFVPTVID----VVFGAWPEVIAKPI 78
            +AS I+ +A+LS+FP I+      G +     + F+   +     V   AW  +I++  
Sbjct: 32  GLASEIAFNAMLSLFPAIIAVLTAIGLVAESLQNTFIQATMQLSQIVPEEAW-SLISEFA 90

Query: 79  TDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV--EMRSWYITRLISF 136
           T EI +      +GLF++S + A + +S  V     + ++  ++    +R ++  +LIS 
Sbjct: 91  TKEIAES---KNRGLFSVSFVIAIWTASGAVSTAMTAFDQIEQISPENVRPFWKAKLISL 147

Query: 137 GYVLLASVTLVIMSF-VFVAIPLALAYVRKFFPALGN----LLLIIWNGRIYATMLALFI 191
           G  +   + L++ SF VF++  L    +R      GN     LL IW   ++   L +  
Sbjct: 148 GLTIGTILLLILASFLVFISDLLLGILIR------GNGYLAFLLHIWQLLLWPLALVIVA 201

Query: 192 GLI-FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
                V+ + P+       ++PG +   I W + + LF  Y+  F  Y+ +Y  + + + 
Sbjct: 202 ATFSLVYRYGPSLWKPGTPLMPGAVLAAIFWAIVSALFRFYVTNFGNYNKVYGTVGTFIV 261

Query: 251 CLVFLYMLGVFFILGAELN 269
            +++L+M     ++G +LN
Sbjct: 262 LMLWLWMGAFVLLVGKQLN 280


>gi|16264680|ref|NP_437472.1| hypothetical protein SM_b21356 [Sinorhizobium meliloti 1021]
 gi|307318683|ref|ZP_07598116.1| ribonuclease BN [Sinorhizobium meliloti AK83]
 gi|15140818|emb|CAC49332.1| conserved hypothetical membrane protein [Sinorhizobium meliloti
           1021]
 gi|306895710|gb|EFN26463.1| ribonuclease BN [Sinorhizobium meliloti AK83]
          Length = 330

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/278 (23%), Positives = 127/278 (45%), Gaps = 19/278 (6%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MR+ F  VF  I        EE    +A+ +S   LLS+FP +    ++ G +     + 
Sbjct: 34  MRDVFWRVFSEIG-------EERVMLIAAGVSFYLLLSLFPALGALVSIYGLVADPSEIG 86

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL---FTISALAAAYFSSNGVEALRISLN 117
           T + ++    P      I D++  +       L   F +S   + + ++NG+ AL  ++N
Sbjct: 87  THVGILQALLPADSYGLIMDQLETLTTQKPSTLGIGFFVSLSISLWLAANGIAALFDAMN 146

Query: 118 RAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALGNLLL 175
            AY   E R +    L+   +   A +  V +      +P  LAYV   ++        L
Sbjct: 147 VAYGEREKRGFLSRTLLCLAFTFAALLFAVALIAAIGVVPAVLAYVWVDRWVE------L 200

Query: 176 IIWNGRIYATMLALFIGLIFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVT 234
           +    R  A +L +  G I ++ F P+  ++K+  +  G +F+ + W+  + LF++Y+  
Sbjct: 201 VTRAARWPAVLLLVTFGTILIYRFGPSRERAKLRWLNWGAVFSTLFWLAASWLFSYYLEH 260

Query: 235 FSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           F+ Y+  Y  L ++   + ++++  +  I+GA +NA +
Sbjct: 261 FANYNATYGALGALAGLMTWVWISVMILIIGALINAEL 298


>gi|315125588|ref|YP_004067591.1| ribonuclease protein [Pseudoalteromonas sp. SM9913]
 gi|315014101|gb|ADT67439.1| ribonuclease protein [Pseudoalteromonas sp. SM9913]
          Length = 315

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 65/277 (23%), Positives = 132/277 (47%), Gaps = 26/277 (9%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           +DI    ++    ++   +A+ ++  ALL++FP I    ++  +  +   +   +     
Sbjct: 22  WDITRRIVKQMSRDNLSLVAAGVAFYALLAIFPAIAALVSVYAYFTSPNDISVYLSQFMA 81

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAA----YFSSNGVEALRISLNRAYRVVE 124
             P+   + I  ++   LA  ++   ++SAL       + SS G +AL  + N +Y   E
Sbjct: 82  LLPQSTQEIILSQV-SSLAQKSQTSLSLSALGTLLLTIWSSSKGSQALITACNISYHEYE 140

Query: 125 MRSWYITRLI----SFGYVLLASVTLVIMSFVFVAIPLALAY--VRKFFPALGNLLLIIW 178
            RS+   +L+    S G +++A + LVI+      +PLAL    +++    L  ++LI W
Sbjct: 141 KRSFLKAQLVRLLFSVGAIVVAVIALVIIGI----LPLALNLLGIKESIDFL--IMLISW 194

Query: 179 NGRIYATMLALFIG--LIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTF 235
                  +LAL     L+ ++ + P  K+ K   +  G     + W+V +  F+ Y+  F
Sbjct: 195 ------PLLALTFNFALLILYRYAPHRKAAKWRWVTVGSFTATVLWIVASFGFSFYVSHF 248

Query: 236 STYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           ++Y+  Y  L  ++  L++L++     ILGA +NA++
Sbjct: 249 ASYNETYGSLGGVVIMLMWLFISAYIIILGATINAAL 285


>gi|312863911|ref|ZP_07724149.1| YihY family protein [Streptococcus vestibularis F0396]
 gi|311101447|gb|EFQ59652.1| YihY family protein [Streptococcus vestibularis F0396]
          Length = 313

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 118/247 (47%), Gaps = 21/247 (8%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           +L+VFP IV  AN+  +L        ++  +    P+    P  + +  + + P+  L  
Sbjct: 37  ILTVFPLIVIAANVFPYLNID--TTDLLKFMNEHLPKQFYAPAANVVQDIFSTPSGQLLG 94

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFV- 154
           +++L   +     + +L+ ++N+ Y   E R  +I+ ++  G++ L  V L +++F  + 
Sbjct: 95  VASLTGFWTMIKSLSSLQKAINKVYGASEHRDVFISHIVG-GFMSL--VILFLLTFALML 151

Query: 155 --AIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIMSIL 211
              I   L  + + +P    +  +I N     ++  +F+G++ ++  LP  K  KI  ++
Sbjct: 152 STIIQSVLRVITQTYPIGSKMTQLILNSIQPLSIAVVFLGMMVLYFVLPNVKIRKIRYVM 211

Query: 212 PGVIFTWISWVVG--AVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFF-----IL 264
           PG IFT  + V+G  + LF  Y++   +         SIM   +F++ML   F     IL
Sbjct: 212 PGTIFT--TLVIGYLSNLFGTYVIRTLSRLVDIKLFGSIM---IFVFMLWFIFLARILIL 266

Query: 265 GAELNAS 271
           GA  NA+
Sbjct: 267 GAVFNAT 273


>gi|294499346|ref|YP_003563046.1| YihY family protein [Bacillus megaterium QM B1551]
 gi|295704699|ref|YP_003597774.1| YihY family protein [Bacillus megaterium DSM 319]
 gi|294349283|gb|ADE69612.1| YihY family protein [Bacillus megaterium QM B1551]
 gi|294802358|gb|ADF39424.1| YihY family protein [Bacillus megaterium DSM 319]
          Length = 276

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 121/263 (46%), Gaps = 16/263 (6%)

Query: 18  HFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF-GAWPEVIAK 76
            F  E  +  A+  +   LLS  PFI+F  +L  F      + T   ++F   +    A 
Sbjct: 11  RFFTERFFDQAAQTAYYFLLSFVPFIIFLFSLLSFFP----IDTNNLLIFIEPFTPKSAY 66

Query: 77  PITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY---ITRL 133
            + +  ++ +    K + + S LA  + +S  +++L  SLN AY +   +++    I  L
Sbjct: 67  DVIERSIETVNNSGKKVLSFSLLATFWLASMAIQSLVRSLNDAYHIQRKQTFLRGLINDL 126

Query: 134 I-SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG-RIYATMLALFI 191
           I +FG++++ +++L +     V   L L  V      + ++    W   R     L L  
Sbjct: 127 ILTFGFMVVVAISLFVPIIEEVIRHLVLTKVH-----VPDIWFQSWTTIRWGIGTLFLLG 181

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
             I  +  +P+A+     +LPG +F+ + W V +  F +Y V F +YS +Y  L SI+  
Sbjct: 182 FFILFYKLMPSARVTWKDVLPGAVFSTLGWQVVSTGFGYY-VQFGSYSQIYGQLGSIIIL 240

Query: 252 LVFLYMLGVFFILGAELNASMII 274
           +V+ Y+     ++G  +N +  I
Sbjct: 241 MVWFYLTAAILLIGGLINGNKFI 263


>gi|330991211|ref|ZP_08315163.1| Putative ribonuclease-like protein yfkH [Gluconacetobacter sp.
           SXCC-1]
 gi|329761704|gb|EGG78196.1| Putative ribonuclease-like protein yfkH [Gluconacetobacter sp.
           SXCC-1]
          Length = 313

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/274 (23%), Positives = 118/274 (43%), Gaps = 7/274 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           V  ++     + V +     A+  +  A LS+FP +    +L G L   Q V   + V+ 
Sbjct: 19  VRQVLRQVARNIVSDQITLAAAGCAFYATLSLFPAMSTLISLYGLLFDLQTVEPQLVVLR 78

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGL---FTISALAAAYFSSNGVEALRISLNRAYRVVE 124
              P      I D I  ++A     L     IS   A + +S    +L +++N AY   E
Sbjct: 79  NLLPPSAYGVIGDRIHLLVAESHSSLTLNLIISTTIATWSASAATRSLIMAMNVAYNTPE 138

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFF---PALGNL-LLIIWNG 180
            RS+   + ++ G    +    ++   + VA+P  + Y+ +     P  G++ LLI   G
Sbjct: 139 TRSFVRFQAMAMGLTFCSICGGILTLALMVALPFLIDYLPEHLSLAPPPGSVELLIHMGG 198

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
            I   +  L +  +          +    ILPG +   + W++ +  F++Y+   + YS 
Sbjct: 199 PILMLLFVLSLCSVLYRFGPNRPHTYWRCILPGSVGATLLWLLSSSGFSYYVSHIAGYSA 258

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMII 274
            Y  L + +  +++ Y+     +LGAELNA + I
Sbjct: 259 TYGPLGAFIAIMMWFYVSAYVVLLGAELNAGLEI 292


>gi|322516266|ref|ZP_08069196.1| YihY family protein [Streptococcus vestibularis ATCC 49124]
 gi|322125239|gb|EFX96612.1| YihY family protein [Streptococcus vestibularis ATCC 49124]
          Length = 319

 Score = 53.5 bits (127), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 118/247 (47%), Gaps = 21/247 (8%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           +L+VFP IV  AN+  +L        ++  +    P+    P  + +  + + P+  L  
Sbjct: 43  ILTVFPLIVIAANVFPYLNID--TTDLLKFMNEHLPKQFYAPAANVVQDIFSTPSGQLLG 100

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFV- 154
           +++L   +     + +L+ ++N+ Y   E R  +I+ ++  G++ L  V L +++F  + 
Sbjct: 101 VASLTGFWTMIKSLSSLQKAINKVYGASEHRDVFISHIVG-GFMSL--VILFLLTFALML 157

Query: 155 --AIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIMSIL 211
              I   L  + + +P    +  +I N     ++  +F+G++ ++  LP  K  KI  ++
Sbjct: 158 STIIQSVLRVITQTYPIGSKMTQLILNSIQPLSIAVVFLGMMVLYFVLPNVKIRKIRYVM 217

Query: 212 PGVIFTWISWVVG--AVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFF-----IL 264
           PG IFT  + V+G  + LF  Y++   +         SIM   +F++ML   F     IL
Sbjct: 218 PGTIFT--TLVIGYLSNLFGTYVIRTLSRLVDIKLFGSIM---IFVFMLWFIFLARILIL 272

Query: 265 GAELNAS 271
           GA  NA+
Sbjct: 273 GAVFNAT 279


>gi|328946554|gb|EGG40693.1| ribonuclease BN [Streptococcus sanguinis SK1087]
          Length = 313

 Score = 53.5 bits (127), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 114/243 (46%), Gaps = 11/243 (4%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           L+SVFP ++   N+  +   H  +   +  +    PE +   +   + +VL  P+ GL +
Sbjct: 48  LISVFPLLLIVVNILPYF--HIPIADFLTAIKDMLPETLYDVVAKVMREVLTQPSTGLLS 105

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
            S L+A +  S  +  L+I+ N+AY V + R     R++S    L   +   +  F+ + 
Sbjct: 106 FSVLSALWTFSKSMNFLQIAFNKAYGVAKSRGLISHRVMSLFVSLGLQILFALALFLTMF 165

Query: 156 IPLALAYVRKFFPALGNLLLIIWN---GRIYATMLALFIGLIFVHLFLPAAK-SKIMSIL 211
             ++L ++R ++     L   + N     IYA    LF  L+  + FLP  K +K   +L
Sbjct: 166 GHMSLDFLRTYWKLDSQLYQHLQNFTEPLIYAL---LFSVLVMFYYFLPNVKINKKRYVL 222

Query: 212 PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI-MTCLVFLY-MLGVFFILGAELN 269
           PG  F  +  +    +F+ Y+  +  +       +SI M  ++F + M+    I+GA LN
Sbjct: 223 PGSAFVLLIILALLNIFSVYMDNYLNHLVDVRFFSSIIMVVMMFWFIMIAKILIVGAVLN 282

Query: 270 ASM 272
           AS+
Sbjct: 283 ASI 285


>gi|325844530|ref|ZP_08168226.1| YihY family protein [Turicibacter sp. HGF1]
 gi|325489063|gb|EGC91448.1| YihY family protein [Turicibacter sp. HGF1]
          Length = 309

 Score = 53.5 bits (127), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 56/260 (21%), Positives = 125/260 (48%), Gaps = 13/260 (5%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAK 76
           E   + +   +   I+ + ++++ P +V    L  +L  +     +++ +  A+     K
Sbjct: 15  EQLKKREIKGLPEQIAFNLVMAIVPLLVVIVQLGTYLSLN---TDLVEYLIMAYAPNELK 71

Query: 77  PITDEILQVLAVPAKGLFTI--SALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
            +   +    + P+  +F +  + ++  +  S G   +  + N  Y+V  M+  Y+ R+ 
Sbjct: 72  LLLMNLFSTTSTPSGNIFFLITTGISFMWLISKGFYGIAAAANTTYQVPYMKFAYLERIF 131

Query: 135 SFGYVLLASVTLVIMS-FVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGL 193
           SF  V+   ++L +++ F      L +   +     + + LL+I+N  I  ++++ F+G 
Sbjct: 132 SFLIVIFMILSLALVTVFALFGQGLIILIFKLLNIHIQSHLLLIFN--IIKSLIS-FLGY 188

Query: 194 I--FVHLFL--PAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
              F+ LF   P+ K ++  I+PG + T I W V ++ FT Y    + Y+  Y  L+ I+
Sbjct: 189 FSFFLSLFYLAPSIKMRVGEIIPGALVTSIGWSVSSIGFTFYANHIANYNKFYGSLSVII 248

Query: 250 TCLVFLYMLGVFFILGAELN 269
             L +L++LG   ++G ++N
Sbjct: 249 MLLFWLFILGYTIMIGLQVN 268


>gi|312137801|ref|YP_004005137.1| ribonuclease bn [Rhodococcus equi 103S]
 gi|311887140|emb|CBH46449.1| ribonuclease BN [Rhodococcus equi 103S]
          Length = 362

 Score = 53.5 bits (127), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 60/277 (21%), Positives = 126/277 (45%), Gaps = 27/277 (9%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQF-VPTVIDVVFGA 69
           ++      F  +    +A+ ++  A+L++FP ++   +L G  G  Q  V  V+++V   
Sbjct: 37  VLRKTAREFGTDQCTDLAAALTYYAVLALFPALLVIVSLLGVFGQGQRTVDAVMEMVGQL 96

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSW 128
            P      + + + Q++A P+ G+  +  +  A +S++G V A   ++NR Y + E R  
Sbjct: 97  GPTNAVDTLREPVEQLVAAPSAGIALVIGVLGALWSASGYVGAFARAMNRIYEIEEGRPI 156

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAI-----------PLALAYVRKFFPALGNLLLII 177
           +  R + F          V+ +F  VA+           P+A +        LG+  +  
Sbjct: 157 WKLRPLMF----------VVTAFCLVAVGASGLMLVISGPVARSVGDVL--GLGDAAVTA 204

Query: 178 WN-GRIYATMLALFIGLIFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF 235
           W+  +    +L + + +  ++   P  ++ K   I PG     + W+  + LF  Y+  F
Sbjct: 205 WDIAKWPVLLLVVGVLVAVLYYVTPNVSQPKFRWISPGAAIAIVVWIGASALFAVYVSNF 264

Query: 236 STYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           ++Y+  Y  LA  +  L++L++  +  + GAE +A +
Sbjct: 265 ASYNKTYGSLAGAVVFLLWLWITNLALLFGAEFDAEL 301


>gi|325676097|ref|ZP_08155779.1| tRNA processing ribonuclease BN [Rhodococcus equi ATCC 33707]
 gi|325553137|gb|EGD22817.1| tRNA processing ribonuclease BN [Rhodococcus equi ATCC 33707]
          Length = 362

 Score = 53.5 bits (127), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 60/277 (21%), Positives = 126/277 (45%), Gaps = 27/277 (9%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQF-VPTVIDVVFGA 69
           ++      F  +    +A+ ++  A+L++FP ++   +L G  G  Q  V  V+++V   
Sbjct: 37  VLRKTAREFGTDQCTDLAAALTYYAVLALFPALLVIVSLLGVFGQGQRTVDAVMEMVGQL 96

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSW 128
            P      + + + Q++A P+ G+  +  +  A +S++G V A   ++NR Y + E R  
Sbjct: 97  GPTNAVDTLREPVEQLVAAPSAGIALVIGVLGALWSASGYVGAFARAMNRIYEIEEGRPI 156

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAI-----------PLALAYVRKFFPALGNLLLII 177
           +  R + F          V+ +F  VA+           P+A +        LG+  +  
Sbjct: 157 WKLRPLMF----------VVTAFCLVAVGASGLMLVISGPVARSVGDVL--GLGDAAVTA 204

Query: 178 WN-GRIYATMLALFIGLIFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF 235
           W+  +    +L + + +  ++   P  ++ K   I PG     + W+  + LF  Y+  F
Sbjct: 205 WDIAKWPVLLLVVGVLVAVLYYVTPNVSQPKFRWISPGAAIAIVVWIGASALFAVYVSNF 264

Query: 236 STYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           ++Y+  Y  LA  +  L++L++  +  + GAE +A +
Sbjct: 265 ASYNKTYGSLAGAVVFLLWLWITNLALLFGAEFDAEL 301


>gi|91215702|ref|ZP_01252672.1| hypothetical protein P700755_02257 [Psychroflexus torquis ATCC
           700755]
 gi|91186168|gb|EAS72541.1| hypothetical protein P700755_02257 [Psychroflexus torquis ATCC
           700755]
          Length = 307

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 60/279 (21%), Positives = 126/279 (45%), Gaps = 14/279 (5%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFL-GAHQFVPTVIDVV 66
           ++D++   I   ++      A  I+ S  +++FPF++F  NL  F+     F   +++  
Sbjct: 35  LYDLLSLYISGIIKGTFSTRAGSIAFSFFMAIFPFLLFVLNLIPFVWFIDDFQQELLNYF 94

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               P   +    D    +   P  GL +   + + +  SNGV A+      +Y      
Sbjct: 95  EELLPPQTSGLFQDIFFDIANNPRAGLLSFVFVLSIFLMSNGVNAIFTGFEFSYHTK--- 151

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAI--PLALAYVRKFFPALG---NLLLIIWNGR 181
              I R I   Y+    V +++   + +A+   +  ++V   F ++G   + L++   GR
Sbjct: 152 ---INRTIIRQYIAAVGVAIIVAILLLIAVIATVYFSFVIDQFTSIGVVGDSLVLARYGR 208

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
               ++ L +G+  ++ F      K   + PG  FT I  V+   LF+ Y+  FS Y+ +
Sbjct: 209 FAILIIVLILGISILYYFGTREGRKTRFLSPGSFFTTILIVLTTYLFSIYVENFSAYNKL 268

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           Y  + +++  ++++++     +LG ELN ++  Y  ++K
Sbjct: 269 YGSIGALLILMLYIWLNSNILLLGFELNGAL--YNLKRK 305


>gi|260907006|ref|ZP_05915328.1| putative ribonuclease BN [Brevibacterium linens BL2]
          Length = 312

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 137/281 (48%), Gaps = 22/281 (7%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           I+ + I H + + G  +A+ ++  ALLS+ P  +   ++ G +G  +   +  + V G  
Sbjct: 42  ILTNTIRHVISDQGLDLAAGLAFYALLSMAPATLALVSMLGVVGEAK---STTEAVLGLT 98

Query: 71  PEV---IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMR 126
            ++    A+ I   + ++++ PA GL  I ++A A +SS+  V A   + NRAY V E R
Sbjct: 99  SDLSTEAAQAIRPIVTELVSSPAAGLTLIVSVAVAIWSSSKYVGAFGRAANRAYAVEETR 158

Query: 127 S-WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GR--- 181
             W +  ++    ++L  +   +   + V+ P+A +  +     LG + ++IW+  R   
Sbjct: 159 PLWKLKPMMLLITLVLLLLMAGLGLLLVVSGPIAESIGK--LVGLGPVAVMIWSIARWPV 216

Query: 182 -IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
            I+  MLA+ + L +    +   K +  SI  G     ++ +V ++ F  YI  F  Y+ 
Sbjct: 217 VIFFVMLAIAL-LYYATPNVKKVKFRWSSI--GAFVAPMTLIVVSLGFVLYINNFDNYNA 273

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
            Y  +  ++    +L+M+ +  I G+EL+A +     R +P
Sbjct: 274 TYGAIGGVIVGFAWLWMVNLALIFGSELDAEIR----RSRP 310


>gi|325690874|gb|EGD32875.1| ribonuclease BN [Streptococcus sanguinis SK115]
          Length = 307

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 116/246 (47%), Gaps = 11/246 (4%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           L+SVFP ++   N+  +   H  V   +  +    PE +   +   + +VL  P+  L +
Sbjct: 43  LISVFPLLLIVVNILPYF--HIPVADFLTAIKDMLPETLYDVVAKVMREVLTQPSTSLLS 100

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
            S L+A +  S  +  L+I+ N+AY V + R     R++S    L   +   +  F+ + 
Sbjct: 101 FSVLSALWTFSKSMNFLQIAFNKAYGVAKSRGLISHRVMSLFVSLGLQILFALALFLTMF 160

Query: 156 IPLALAYVRKFFPALGNLLLIIWN---GRIYATMLALFIGLIFVHLFLPAAK-SKIMSIL 211
             ++L ++R ++     L   + N     IYA + A+   L+  + FLP  K +K   +L
Sbjct: 161 GHMSLDFLRTYWKLDNQLYQHLQNFTEPLIYALLFAV---LVMFYYFLPNVKINKKRYVL 217

Query: 212 PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI-MTCLVFLY-MLGVFFILGAELN 269
           PG  F  ++ +    +F+ Y+  +  +       +SI M  ++F + M+    I+GA LN
Sbjct: 218 PGSAFVLLTILALLNIFSVYMDNYLNHLVDVRFFSSIIMVVMMFWFIMIAKILIVGAVLN 277

Query: 270 ASMIIY 275
           AS+  Y
Sbjct: 278 ASIQSY 283


>gi|293374361|ref|ZP_06620688.1| YihY family protein [Turicibacter sanguinis PC909]
 gi|292647024|gb|EFF65007.1| YihY family protein [Turicibacter sanguinis PC909]
          Length = 309

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 56/260 (21%), Positives = 125/260 (48%), Gaps = 13/260 (5%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAK 76
           E   + +   +   I+ + ++++ P +V    L  +L  +     +++ +  A+     K
Sbjct: 15  EQLKKREIKGLPEQIAFNLVMAIVPLLVVIVQLGTYLSLN---TDLVEYLIMAYAPNELK 71

Query: 77  PITDEILQVLAVPAKGLFTI--SALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
            +   +    + P+  +F +  + ++  +  S G   +  + N  Y+V  M+  Y+ R+ 
Sbjct: 72  LLLMNLFSTTSTPSGNIFFLITTGISFMWLISKGFYGIAAAANTTYQVPYMKFAYLERIF 131

Query: 135 SFGYVLLASVTLVIMS-FVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGL 193
           SF  V+   ++L +++ F      L +   +     + + LL+I+N  I  ++++ F+G 
Sbjct: 132 SFLIVIFMILSLALVTVFALFGQGLIILIFKILNIHIQSHLLLIFN--IIKSLIS-FLGY 188

Query: 194 I--FVHLFL--PAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
              F+ LF   P+ K ++  I+PG + T I W V ++ FT Y    + Y+  Y  L+ I+
Sbjct: 189 FSFFLSLFYLAPSIKMRVGEIIPGALVTSIGWSVSSIGFTFYANHIANYNKFYGSLSVII 248

Query: 250 TCLVFLYMLGVFFILGAELN 269
             L +L++LG   ++G ++N
Sbjct: 249 MLLFWLFILGYTIMIGLQVN 268


>gi|163745189|ref|ZP_02152549.1| ribonuclease BN, putative [Oceanibulbus indolifex HEL-45]
 gi|161382007|gb|EDQ06416.1| ribonuclease BN, putative [Oceanibulbus indolifex HEL-45]
          Length = 309

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 132/286 (46%), Gaps = 24/286 (8%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
            I +D    +++    ++   +++ ++  A+LS+FP +     L G +     V   ++ 
Sbjct: 11  AIYWDAFKASLKQAASDNLALISAGVAFFAMLSLFPALAALIALLGLISDPVVVIAQLED 70

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRV 122
           V G  P+ +   I  ++  ++   A  L     +S L A + +  GV A+ I LN  Y  
Sbjct: 71  VRGLLPDDVYDIINTQVTGLVTARADTLGWAGIVSLLVALWSARAGVGAMVIGLNSVY-- 128

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFV----FVAIPLALAYVR--KFFPALGNLLLI 176
              R+    +   + + LL +V+LV +  V     V  P+ LA++    F  A+ +LL  
Sbjct: 129 -NERNRNAAK--HYLHALLLTVSLVAVGIVALLAVVVAPIILAFIPLGPFGNAVADLL-- 183

Query: 177 IWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILP-GVIFTWISWVVGAVLFTHYIVTF 235
               R     + LF G+  ++ F P  ++  +  L  G I   +SW V ++ F++Y+  F
Sbjct: 184 ----RWTVATVVLFAGVGVLYRFGPNRRAARLPWLSSGAILAVLSWAVISIGFSYYVANF 239

Query: 236 STYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
             Y+ +Y  + +++  LV+L++     + GA LNA +     R KP
Sbjct: 240 GNYNQVYGSIGAVIAMLVWLWISSFLILFGAALNAQV---ERRTKP 282


>gi|58038914|ref|YP_190878.1| t-RNA-processing ribonuclease BN [Gluconobacter oxydans 621H]
 gi|58001328|gb|AAW60222.1| t-RNA-processing ribonuclease BN [Gluconobacter oxydans 621H]
          Length = 348

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 123/279 (44%), Gaps = 26/279 (9%)

Query: 17  EHFVEEDGWAMASHISLSA-------LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           +H   E G   +S  SLSA        LS+FP I    +L G     Q V   ++V+   
Sbjct: 56  KHLFAEVG---SSQTSLSAAGCAFYATLSLFPAISSLISLYGLAFDLQTVEPQLEVLRHL 112

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFT--ISALAAAYFS-SNGVEALRISLNRAYRVVEMR 126
            P      I D I ++++ P   L    I +LA A +S S   +++  +LN AY   E R
Sbjct: 113 LPPSAYDLIGDRIHELISQPHSSLTIGLIFSLAIALWSASASTKSILSALNMAYNAQETR 172

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFF-----PALGNLLLIIWNGR 181
           S+   + I+    L A +   +   + VA P  + Y+ +       P     LL+ +   
Sbjct: 173 SFLKFQAIALSTTLTAILGAALTLALMVAAPALVDYLPRHVSFLSDPPFPVDLLLSYGAP 232

Query: 182 IYATMLA-------LFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIV 233
           +    LA       +FI +  ++ F P    ++   I PG     I WV+ ++ F+ Y+ 
Sbjct: 233 MVVHTLAPLLMLLFVFIAVTLLYRFAPCRVHTQWRWIFPGSALATILWVITSLGFSWYVA 292

Query: 234 TFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
            F++Y   Y  L ++   +++ ++     + GAELNAS+
Sbjct: 293 HFASYGATYGPLGAVAAIMMWFFVSAYVVLFGAELNASL 331


>gi|110632679|ref|YP_672887.1| putative ribonuclease BN [Mesorhizobium sp. BNC1]
 gi|110283663|gb|ABG61722.1| putative ribonuclease BN [Chelativorans sp. BNC1]
          Length = 322

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 88/180 (48%), Gaps = 5/180 (2%)

Query: 94  FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVF 153
           F I    A + ++NG++AL  ++N AY   E R +    L+S  + L A++ L IM  + 
Sbjct: 115 FLIGLAIALWSANNGIKALFEAMNVAYDETEKRGFIKLNLLSLSFTL-ATLVLGIMLIIA 173

Query: 154 VAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILP- 212
           V +  A+  +    P    L+      R    +L    G++ ++ F P+ +      L  
Sbjct: 174 VGVVPAVLAILGLSPWAETLIAF---ARWPTLLLVSMFGILMLYRFGPSRERPKWRWLSW 230

Query: 213 GVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           G +   + W+  +V F++Y+  F+ Y   Y  L +I+  +++ ++  V  I+GAE++A +
Sbjct: 231 GAVIATLVWLAASVAFSYYLQNFADYDATYGSLGAIIGLMMWTWISVVVLIVGAEIDAEI 290


>gi|300114541|ref|YP_003761116.1| ribonuclease BN [Nitrosococcus watsonii C-113]
 gi|299540478|gb|ADJ28795.1| ribonuclease BN [Nitrosococcus watsonii C-113]
          Length = 328

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 59/268 (22%), Positives = 125/268 (46%), Gaps = 10/268 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI Y   +   +++   +A+ ++  ALL++FP +V   ++ G +     V    D + G 
Sbjct: 28  DIAYRIKDSLNDDNISIVAAGVAFYALLAIFPALVAMVSIYGIIADPADVQRQFDALSGI 87

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALA----AAYFSSNGVEALRISLNRAYRVVEM 125
            P   A+ +  E L+ +   A    ++   A    A + ++ G +A  I+LN  Y   E 
Sbjct: 88  LP-TEAQVLLSEQLRRITSQASTALSVGVGAGVILALWSATRGTKAFMIALNIVYGEKEK 146

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R +     I+    L A V  ++   + V +P+ L+Y+    P +  +L  +    + A 
Sbjct: 147 RGFLKLNAIALILTLGAIVLAILALGMIVVLPILLSYLD--LPEIFQVLASLLPWLLLA- 203

Query: 186 MLALFIGLIFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
                +GL  ++ + P+ ++++   +  G +   + W+ G+ LF+ Y+  F+ Y+  Y  
Sbjct: 204 -FTFILGLAVLYRYGPSRSEARWRWVSWGAVAATVLWIAGSALFSFYVANFAQYNKTYGS 262

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASM 272
           + +++  L++ ++     +L AE NA M
Sbjct: 263 VGALIILLMWFFVTAYIILLAAEFNAEM 290


>gi|225378186|ref|ZP_03755407.1| hypothetical protein ROSEINA2194_03846 [Roseburia inulinivorans DSM
           16841]
 gi|225209992|gb|EEG92346.1| hypothetical protein ROSEINA2194_03846 [Roseburia inulinivorans DSM
           16841]
          Length = 290

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 115/245 (46%), Gaps = 26/245 (10%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVP----TVIDVVFGAWPEVIAK---PITDEILQVLAV 88
           +LS  PF++  ++L       Q+ P    T++ +   A P+ I+     ITDE+      
Sbjct: 38  ILSTIPFLMVFSSLL------QYTPITEGTLLKMYQTALPDYISAFLISITDEVYN---- 87

Query: 89  PAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYV---LLASVT 145
            + G+ +I+A+ A + ++ G++ +   LN    + E R+W++ RL +  Y    L A V 
Sbjct: 88  RSVGIISITAIVAIWSAAKGIQYMTDGLNSVNDLEENRNWFVLRLWAIVYTIVFLFAVVF 147

Query: 146 LVIMSFVFVAI-PLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK 204
            +++      +  LA+ Y+    P L +L  +I   R +     LF+    +   LP  K
Sbjct: 148 TLVVLVFGNTLHDLAVEYI----PLLQSLTDLIVRLRGFVLFGILFVFFDIIFTMLPNKK 203

Query: 205 SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFIL 264
               S +PG     ++W V +   + Y+  F+ +S MY  L +I   +++LY      ++
Sbjct: 204 LTFKSQIPGAAICAVAWYVFSFALSIYVDYFNGFS-MYGSLTTIALIMLWLYFCMYIMMM 262

Query: 265 GAELN 269
            AE+N
Sbjct: 263 SAEVN 267


>gi|229916047|ref|YP_002884693.1| ribonuclease BN [Exiguobacterium sp. AT1b]
 gi|229467476|gb|ACQ69248.1| ribonuclease BN [Exiguobacterium sp. AT1b]
          Length = 273

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 67/263 (25%), Positives = 119/263 (45%), Gaps = 10/263 (3%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIA 75
           ++ F  E  +  A+ ++   +LS FPF++F   + GFL        VI  +    PE   
Sbjct: 9   VKRFFTERFFDQAAMLAYYFILSTFPFLLFVLGIVGFLPFTS--GDVIQALSLIMPEASY 66

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
           K +   I  V       L + S L A + SS  V++L  +LN AYR V  ++++   L  
Sbjct: 67  KLLEGNIEAVFDNSKLKLASFSILPALWISSMAVQSLVRALNDAYRAVRNKAFWRGVLQD 126

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLI---IWN--GRIYATMLALF 190
              + LA + ++  S +   I  AL  +  +   +  ++     IW     I  T L LF
Sbjct: 127 IA-ITLALMFVLPFSLLVPVIETALREISSYVLFIDEIVTTYAQIWFYFRWIIGTSL-LF 184

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
              +FV+ +LP+      +   G  F  +  ++ + +F++Y   F+ Y   Y  L + + 
Sbjct: 185 TVFVFVYKWLPSVSGTFKNSWAGAAFATVGILLVSNVFSYY-SQFANYEQFYGQLGAFIV 243

Query: 251 CLVFLYMLGVFFILGAELNASMI 273
            L++ Y+     +LG  LNA++I
Sbjct: 244 LLIWFYLAASVILLGGLLNATLI 266


>gi|116619409|ref|YP_821565.1| putative ribonuclease BN [Candidatus Solibacter usitatus Ellin6076]
 gi|116222571|gb|ABJ81280.1| putative ribonuclease BN [Candidatus Solibacter usitatus Ellin6076]
          Length = 283

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 65/274 (23%), Positives = 123/274 (44%), Gaps = 39/274 (14%)

Query: 22  EDG-WAMASHISLSALLSVFPFIVFGANL-----AGFLGA--HQFVPTVIDVVFGAWPEV 73
           +DG +  A   + SALLS FP +   A +     AGF+ A    F+  ++          
Sbjct: 21  DDGCFGFAKGAAYSALLSFFPVLTSAATILVQTRAGFVSATLQSFLSQIVP--------- 71

Query: 74  IAKPITDEIL----QVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
              P T++++    +V+     GL  ++ L + + +S  +++L      AYRV   RS+ 
Sbjct: 72  ---PGTEDLVVQQFRVMGERPFGLLVVAGLISLWAASGVIKSLIEGFQAAYRVPRNRSFL 128

Query: 130 ITRLISFGYVLLASVTLVIMSFVFV---AIPLALAYVRKFFPALGNLLLIIWN--GRI-- 182
               ++   VLL++V L+  S + V    +  A+    K  P L N +  +W    R+  
Sbjct: 129 HQSGVAMSLVLLSAVPLICASLLLVFGNQVERAVLNWMKVDPFL-NPVAWVWQFVSRMAR 187

Query: 183 ----YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTY 238
               +AT +A+   L +   + P  K +   +  G I   + W    + F  Y+   + Y
Sbjct: 188 YLLAFATTIAVTASLYY---YGPYRKQRWRYVWRGAILATVLWFFATLGFAWYVRNIARY 244

Query: 239 STMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           + MY  + + +  LV++Y++ +  ++G E NA +
Sbjct: 245 NVMYGSIGAGIALLVWMYLIALIALMGCEFNAEL 278


>gi|27383151|ref|NP_774680.1| hypothetical protein blr8040 [Bradyrhizobium japonicum USDA 110]
 gi|27356325|dbj|BAC53305.1| blr8040 [Bradyrhizobium japonicum USDA 110]
          Length = 392

 Score = 52.8 bits (125), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 119/260 (45%), Gaps = 26/260 (10%)

Query: 26  AMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQV 85
           A+A+ ++  +LL++FP I     + G       +   +D V    P    +   +++ +V
Sbjct: 114 ALAAGMTYYSLLAIFPAIAALVAIYGLFSDPSSITKHLDDVSSFIPGGAVEVAREQLTRV 173

Query: 86  LAVPAKGL-FTIS-ALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITRLISFGYVLLA 142
                + L FT +  LA + +S+N  +++L  +LN  Y   E R ++    +S G+ + A
Sbjct: 174 ATKSNRTLGFTFAIGLAISLWSANAAMKSLFDTLNIVYGEQEKRGFFKLNAMSLGFTVGA 233

Query: 143 SVTLVIMSFVFVAIPLALAYVRKFFPALGNLL-LIIWNGRIYATMLALFIGLIFVHLFLP 201
              +V      V IP+ L YV      L N   L++  GR  A  +AL   L  ++ F P
Sbjct: 234 IAFVVAALGAVVVIPVVLHYV-----GLSNATDLLVRIGRWPALFVALAFALACIYRFGP 288

Query: 202 AAKSKIMSILPGVIFTWISWVVGAVL---------FTHYIVTFSTYSTMYAGLASIMTCL 252
           + ++          +TWI+W   A           F+ Y   F T++  Y  L +++  +
Sbjct: 289 SRQAPR--------WTWITWGSAAAALLWLAASGLFSFYAANFGTFNATYGSLGAVVGFM 340

Query: 253 VFLYMLGVFFILGAELNASM 272
            +L++  +  +LGAELNA M
Sbjct: 341 TWLWISAIVILLGAELNAEM 360


>gi|320546458|ref|ZP_08040773.1| YihY family protein [Streptococcus equinus ATCC 9812]
 gi|320448843|gb|EFW89571.1| YihY family protein [Streptococcus equinus ATCC 9812]
          Length = 305

 Score = 52.8 bits (125), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 118/257 (45%), Gaps = 18/257 (7%)

Query: 28  ASHISLSA-------LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
           ++ I LSA       LL+ FP IV  AN+  +L     V  ++  +    P  +   ++ 
Sbjct: 28  SAEIDLSAIAVAYYLLLTAFPLIVIAANIFPYLNID--VNILLAFMKKNLPTNLYPSVSA 85

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
             + + + P+  +  ++ L A +  S  + +L+ ++N+AY V + R   I RL+     L
Sbjct: 86  ITIDIFSKPSGSILGVATLTAFWTMSKSLTSLQKAINKAYGVAQHRDVVIGRLVGVIGSL 145

Query: 141 LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFL 200
           L    L  +      + + L  +   +     +  +I +     T++ + IGL+ ++  L
Sbjct: 146 LILFLLTFVLLFSTFLKVVLQIINSNYDLSDTMATVILHLSQPVTVITIVIGLMLLYFIL 205

Query: 201 PAAKSKIMS-ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLG 259
           P  K K +  ILPG IFT +  V    LF+ YI+   T+  M   + +  + ++F+ ML 
Sbjct: 206 PNVKIKRLRYILPGTIFTSVVIVFLNSLFSSYIL--RTFERM-VDIKTFGSVVIFVLMLW 262

Query: 260 VFF-----ILGAELNAS 271
             F     ILGA  NA+
Sbjct: 263 FIFLAHILILGAIFNAT 279


>gi|150376885|ref|YP_001313481.1| putative ribonuclease BN [Sinorhizobium medicae WSM419]
 gi|150031432|gb|ABR63548.1| putative ribonuclease BN [Sinorhizobium medicae WSM419]
          Length = 330

 Score = 52.8 bits (125), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 60/270 (22%), Positives = 128/270 (47%), Gaps = 14/270 (5%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D+ +  +    EE    +A+ +S   LLS+FP +    ++ G +     + T + ++   
Sbjct: 36  DVFWRVVSEIAEERVVLIAAGVSFYLLLSLFPALGALVSIYGLVADPSEIGTHMGILQAL 95

Query: 70  WPEVIAKPITDEILQVLAVPAKGL---FTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P+     I D++  +       L   F IS   + + ++NG+ AL  ++N AY   E R
Sbjct: 96  LPQDSYGLIMDQLKTLTTQKPSTLGMGFFISLSISLWLAANGIAALFDAMNVAYGEREKR 155

Query: 127 SWYITRLISFGYV---LLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
            +    ++   +    LL +V L++   V  A+ LA  +V ++        L+    R  
Sbjct: 156 GFLFRTVLCIAFTFAALLFAVALIVAIGVVPAV-LAHLWVDRWVE------LVTRVARWP 208

Query: 184 ATMLALFIGLIFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
           A +L +  G + ++ F P+  ++K+  +  G +F+ + W   + LF++Y+  F+ Y+  Y
Sbjct: 209 ALLLLVTFGTVLIYRFGPSRERAKLRWLNWGAVFSTLFWFAASWLFSYYLEHFANYNATY 268

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASM 272
             L ++   + ++++  +  I+GA +NA +
Sbjct: 269 GALGALAGLMTWVWISVMILIIGALINAEL 298


>gi|262047121|ref|ZP_06020080.1| methionine aminopeptidase [Lactobacillus crispatus MV-3A-US]
 gi|295692490|ref|YP_003601100.1| hypothetical protein LCRIS_00628 [Lactobacillus crispatus ST1]
 gi|312977780|ref|ZP_07789527.1| putative membrane protein [Lactobacillus crispatus CTV-05]
 gi|260572698|gb|EEX29259.1| methionine aminopeptidase [Lactobacillus crispatus MV-3A-US]
 gi|295030596|emb|CBL50075.1| Membrane protein [Lactobacillus crispatus ST1]
 gi|310895519|gb|EFQ44586.1| putative membrane protein [Lactobacillus crispatus CTV-05]
          Length = 307

 Score = 52.8 bits (125), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 99/209 (47%), Gaps = 6/209 (2%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV--VEMR-- 126
           P+ ++K I   I  +L   + G  +   + A +  SN V A+R+  NR Y V  VE++  
Sbjct: 73  PDQVSKFIMPIINSLLKTTSTGYISFGIVFAVWSLSNMVNAIRLGENRLYGVHQVELKLS 132

Query: 127 --SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
             ++  TR I+F +  L  +   I +   V     L ++   F    N +  I++ R   
Sbjct: 133 MLNFLWTRTITFVFTGLMILVFTIATLALVFGQQVLNFLGPIFQLPLNEISKIFSYRYPV 192

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
            +L + + L +++  LP  K K   I PGV  T + W+  + LF+ Y+  F      Y  
Sbjct: 193 LILVMMLALWYLNYVLPNIKLKKRVIWPGVFVTVVGWLALSFLFSFYLHHFPITWENYGI 252

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMI 273
           + + +  +++L +  V F+ G  +NA+++
Sbjct: 253 VGTFIIFMLWLNIAAVLFLFGVGVNAAIV 281


>gi|117927634|ref|YP_872185.1| putative ribonuclease BN [Acidothermus cellulolyticus 11B]
 gi|117648097|gb|ABK52199.1| putative ribonuclease BN [Acidothermus cellulolyticus 11B]
          Length = 300

 Score = 52.8 bits (125), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 67/283 (23%), Positives = 119/283 (42%), Gaps = 25/283 (8%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT-VIDVVFGA 69
           I   A+  F +     +A+ ++   L S FP  +    + G + +   V   V   + G 
Sbjct: 29  IFGGAVREFSDHRCTLLAAALAYHVLFSFFPLALVAVGIVGLVSSDPAVRNEVATRIVGI 88

Query: 70  WPEVIAKPITDEILQVLA--VPAKGLFTISALAAAYFSSNGV-EALRISLNRAYRVVEMR 126
            P   A    D++  +L     A+G      LA  ++S++GV  ALR  LN+A+ V   R
Sbjct: 89  VPLNTAG--RDQLANLLTSIAGARGAIGFVGLAGLWWSASGVMGALRGGLNQAFDVTAKR 146

Query: 127 SWYITRLISFGYVLLASV--------TLVIMSFVFVA--IPLALAYVRKFFPALGNLLLI 176
            ++  + +    VL A V        T+++  F  +A  +P  LA    +    G L + 
Sbjct: 147 RFWRAKFLDLVLVLGAVVVVGVSFGVTILVGIFQHIAHRLPGVLADAGSWLVDTGGLGI- 205

Query: 177 IWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFS 236
                    +L +F   + ++ ++P   S+I+ + PG +   +        F  Y+  F 
Sbjct: 206 --------ALLFIFTMCLLLYRYVPVQSSRIVDLWPGALVAAVGLEALQYGFAFYLSNFG 257

Query: 237 TYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            Y+ +Y  L  I+  L F+Y+ G  F  GAE+      Y  R+
Sbjct: 258 HYNRVYGTLGGIVAFLFFVYVAGAVFFFGAEVADGYARYRLRR 300


>gi|72160655|ref|YP_288312.1| ribonuclease BN [Thermobifida fusca YX]
 gi|71914387|gb|AAZ54289.1| ribonuclease BN [Thermobifida fusca YX]
          Length = 333

 Score = 52.8 bits (125), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 123/258 (47%), Gaps = 5/258 (1%)

Query: 18  HFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKP 77
            F E++   +A+ ++  A+LS+FP ++   +L G  G      T+ D +    P+   + 
Sbjct: 42  EFKEDNLTDLAAGLTYYAVLSIFPALLVLVSLLGLAG-QSATDTISDQLSAVAPDETVEI 100

Query: 78  ITDEILQVLAVPAKG-LFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITRLIS 135
           +T  +  + A  A   L  + +LA A +S++  V A   + N  Y + E R ++ T  + 
Sbjct: 101 VTGVLTNLQANQATASLVGLLSLALAVWSASAYVAAFMRAANIVYDIREGRPFWKTLPVR 160

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIF 195
            G  LL  +TLV +S + V +   +A     F   G   + +WN   +  ++ L + ++ 
Sbjct: 161 VGITLLL-LTLVAISALAVILSGGVAQWVGNFIGAGPTAVTLWNIVKWPVLVLLMMFMVS 219

Query: 196 V-HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
           V +   P  K     + PG I   + W+  +  F  Y+  F+ Y+  Y  LA+++  LV+
Sbjct: 220 VLYWAAPNVKRPFRWVSPGGIVAVLIWLGASAAFAFYVANFANYNRTYGSLAAVVIFLVW 279

Query: 255 LYMLGVFFILGAELNASM 272
           L++  +  +LG E NA +
Sbjct: 280 LWISNIAILLGIEYNAEI 297


>gi|225868869|ref|YP_002744817.1| ribonuclease BN-like family protein [Streptococcus equi subsp.
           zooepidemicus]
 gi|225702145|emb|CAW99833.1| ribonuclease BN-like family protein [Streptococcus equi subsp.
           zooepidemicus]
          Length = 312

 Score = 52.4 bits (124), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 60/269 (22%), Positives = 117/269 (43%), Gaps = 15/269 (5%)

Query: 13  YDAIEHFVEEDGWAMASHISLSAL-------LSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
           Y+ I+ F+       ++ + LSA+       L+ FP IV  AN+  +L     +  ++ +
Sbjct: 16  YEPIQAFMRH---FQSAEMDLSAIAVAYYLILTAFPLIVIAANIFPYLNID--ISDLLRL 70

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           +    P+ I +  +  ++ + + P+ G+  I+ L   +  S  + +L+ + N+AY   E 
Sbjct: 71  MKEQLPKDIYRSASSIVVNIFSKPSGGVLGIATLTGLWTMSRSLASLQKAFNKAYDASEH 130

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R + +  L+     LL    L            A+  + + +    N+  +        T
Sbjct: 131 RDFLLGHLVGLLTSLLILFLLTFALIFSTFSKAAIQVLDRHYHLNDNITTLFLFLIQPIT 190

Query: 186 MLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
           +L +F+GL+ ++  LP  K  KI  ILPG  FT    +  + +  +Y+V           
Sbjct: 191 ILIIFVGLMLLYFLLPNIKIKKIRYILPGTFFTTFVMIFLSNMVGNYVVHNVERMVDIKT 250

Query: 245 LASIMTCLVFLY--MLGVFFILGAELNAS 271
             S+M  ++ L+   L    I+GA  NA+
Sbjct: 251 FGSVMVFIIMLWFIFLARILIMGAVFNAT 279


>gi|120435458|ref|YP_861144.1| ribonuclease BN [Gramella forsetii KT0803]
 gi|117577608|emb|CAL66077.1| ribonuclease BN [Gramella forsetii KT0803]
          Length = 307

 Score = 52.4 bits (124), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 66/264 (25%), Positives = 124/264 (46%), Gaps = 36/264 (13%)

Query: 28  ASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID---VVFGAWPEVIAKPITDEIL- 83
           AS I+ S  +++FPF++F  NL  ++       T ID   + F  + + +  P T +   
Sbjct: 55  ASSIAFSFFMAIFPFLLFVLNLIPYI-------TFIDDFQIEFLLFMDTLLPPETSDFFG 107

Query: 84  ----QVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYV 139
                + + P  GL +++ + + +  +NG+ A+      +Y     RS      ++ G  
Sbjct: 108 NIFEDIASTPRGGLLSVAFILSIFLMTNGINAIFTGFEFSYHTKTNRSIPRQYAVAVGVS 167

Query: 140 LLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIG---LIFV 196
           L+ ++ L+I     V I  A+         L NL L+  +G      L  +IG   LI+ 
Sbjct: 168 LILALLLLISVVGAVYITYAI-------DDLSNLGLVNADG--VGARLINYIGFVILIYT 218

Query: 197 HLFL-------PAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + +        A ++K  S+  G +FT I  ++  VLF+ YI  FS Y+ +Y  + +++
Sbjct: 219 AVAILYYFGTREARQAKFFSV--GALFTTILIMITTVLFSIYITNFSNYNELYGSIGALL 276

Query: 250 TCLVFLYMLGVFFILGAELNASMI 273
             + ++++     +LG ELNAS+I
Sbjct: 277 ILMFYIWLNSNMLLLGFELNASLI 300


>gi|17229562|ref|NP_486110.1| hypothetical protein all2070 [Nostoc sp. PCC 7120]
 gi|17131161|dbj|BAB73769.1| all2070 [Nostoc sp. PCC 7120]
          Length = 301

 Score = 52.4 bits (124), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 60/261 (22%), Positives = 122/261 (46%), Gaps = 23/261 (8%)

Query: 26  AMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEIL-- 83
            + S I+ +A+LS+FP I+      GF     F  ++ D  F      +++   +E +  
Sbjct: 32  GLGSEIAFNAMLSLFPAILAVLTAIGF-----FADSLQDT-FRQLAAQLSQVAPEEAMVL 85

Query: 84  -------QVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE--MRSWYITRLI 134
                  ++      GLF++S + A + +S  V     + ++ +++ +  MR ++ ++L+
Sbjct: 86  IREFAGREIANSRNSGLFSLSFVIAIWTASGAVSTAMTAFDQIHQIPQEKMRPFWKSKLV 145

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI--- 191
           S G  +   + LV+ SF+     L L  V     AL   LL +W  ++    LAL I   
Sbjct: 146 SLGLTVGTILLLVLASFLVFISDLLLGMVVNENGAL-IFLLHLW--QLLRWPLALGIVAT 202

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
              F++ +  +       I+PG I   I W + + LF  Y+  F  Y+ +Y  + +++  
Sbjct: 203 AFSFIYRYGTSVWKPGTPIMPGAIVAAIFWAILSALFRLYVANFGNYNKVYGAVGTVIVL 262

Query: 252 LVFLYMLGVFFILGAELNASM 272
           +++L+M     ++G +LN ++
Sbjct: 263 MLWLWMSAAVLLIGDQLNVTV 283


>gi|55821532|ref|YP_139974.1| tRNA-processing ribonuclease BN [Streptococcus thermophilus LMG
           18311]
 gi|55737517|gb|AAV61159.1| tRNA-processing ribonuclease BN,putative [Streptococcus
           thermophilus LMG 18311]
          Length = 321

 Score = 52.4 bits (124), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 111/244 (45%), Gaps = 13/244 (5%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           +L+VFP IV  AN+  +L        ++  +    P+    P  + +  + + P+  L  
Sbjct: 43  ILTVFPLIVIAANVFPYLNID--TTDLLKFMNEHLPKHFYAPAANVVQDIFSTPSGRLLG 100

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
           +++L   +     + +L+ ++++ Y   E R  +I+ +I     L+    L     +   
Sbjct: 101 VASLTGFWTMIKSLSSLQKAIDKVYGASEHRDVFISHIIGGLLSLVILFLLTFALMLSTI 160

Query: 156 IPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIMSILPGV 214
           I   L  + + +P   NL  +I N     ++  +F+G++ ++  LP  K  KI  I+PG 
Sbjct: 161 IQSVLRVINQTYPIGSNLTQLILNSIQPLSVAVVFLGMMVLYFILPNVKIRKIRYIMPGT 220

Query: 215 IFTWISWVVG--AVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFF-----ILGAE 267
           IFT  + V+G  + LF  Y++   +         SIM   +F++ML   F     I GA 
Sbjct: 221 IFT--TLVIGYLSNLFGTYVIHTLSRLIDIKLFGSIM-IFIFIFMLWFIFLARILIFGAV 277

Query: 268 LNAS 271
            NA+
Sbjct: 278 FNAT 281


>gi|312278870|gb|ADQ63527.1| Ribonuclease BN-like family enzyme [Streptococcus thermophilus
           ND03]
          Length = 315

 Score = 52.4 bits (124), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 111/244 (45%), Gaps = 13/244 (5%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           +L+VFP IV  AN+  +L        ++  +    P+    P  + +  + + P+  L  
Sbjct: 37  ILTVFPLIVIAANVFPYLNID--TTDLLKFMNEHLPKHFYAPAANVVQDIFSTPSGRLLG 94

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
           +++L   +     + +L+ ++++ Y   E R  +I+ +I     L+    L     +   
Sbjct: 95  VASLTGFWTMIKSLSSLQKAIDKVYGASEHRDVFISHIIGGLLSLVILFLLTFALMLSTI 154

Query: 156 IPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIMSILPGV 214
           I   L  + + +P   NL  +I N     ++  +F+G++ ++  LP  K  KI  I+PG 
Sbjct: 155 IQSVLRVINQTYPIGSNLTQLILNSIQPLSVAVVFLGMMVLYFILPNVKIRKIRYIMPGT 214

Query: 215 IFTWISWVVG--AVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFF-----ILGAE 267
           IFT  + V+G  + LF  Y++   +         SIM   +F++ML   F     I GA 
Sbjct: 215 IFT--TLVIGYLSNLFGTYVIHTLSRLIDIKLFGSIM-IFIFIFMLWFIFLARILIFGAV 271

Query: 268 LNAS 271
            NA+
Sbjct: 272 FNAT 275


>gi|266625409|ref|ZP_06118344.1| YihY family protein [Clostridium hathewayi DSM 13479]
 gi|288862689|gb|EFC94987.1| YihY family protein [Clostridium hathewayi DSM 13479]
          Length = 121

 Score = 52.4 bits (124), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 46/84 (54%)

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +L L I   F++ ++P  K      LPG +F+ + W+  +  F+ Y   FS +S MY  L
Sbjct: 22  LLILTICFTFLYTYVPEKKQHFKKQLPGAVFSTLGWIAFSFAFSIYFNNFSNFSVMYGSL 81

Query: 246 ASIMTCLVFLYMLGVFFILGAELN 269
            +I+  +++LY+      LGAE+N
Sbjct: 82  TAIVLLMLWLYVCICILFLGAEIN 105


>gi|89070971|ref|ZP_01158197.1| Ribonuclease BN [Oceanicola granulosus HTCC2516]
 gi|89043478|gb|EAR49692.1| Ribonuclease BN [Oceanicola granulosus HTCC2516]
          Length = 279

 Score = 52.4 bits (124), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 106/244 (43%), Gaps = 12/244 (4%)

Query: 35  ALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLF 94
            LL++FP I     +AG +     +   +  + G  P+  A  +  +  +V      GL 
Sbjct: 5   GLLALFPAITAMIAIAGLVMEPAQITEQLQALGGMLPQDAADILIGQAQEVAGSREGGLG 64

Query: 95  TISALA---AAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
             + L    A Y +S GV +L   +N AY   + R  +I R      + L  +  +++  
Sbjct: 65  LAAVLGILLALYSASKGVSSLMEGINVAYDEEDQRG-FIKRTALTLALTLVLIVGIVLGL 123

Query: 152 V-FVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIG-LIFVHLFLPAAKSKIMS 209
              V +P  L  V      LG +  I+     +A +L L +G    ++ F P   S  M 
Sbjct: 124 ASTVVLPAVLNVVD-----LGPVTEILIAAFRWALLLVLAVGGFALLYRFAPDRSSARMK 178

Query: 210 -ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAEL 268
            + PG I   I W+V  V F  Y   F +Y+  +  L  ++  L++L++     ++GAE+
Sbjct: 179 WLTPGAIVGCILWIVATVGFAIYADNFGSYNESFGALGGVIVLLMWLWLSSYAVLMGAEI 238

Query: 269 NASM 272
           N+ +
Sbjct: 239 NSEI 242


>gi|88812854|ref|ZP_01128099.1| Ribonuclease BN [Nitrococcus mobilis Nb-231]
 gi|88789924|gb|EAR21046.1| Ribonuclease BN [Nitrococcus mobilis Nb-231]
          Length = 322

 Score = 52.4 bits (124), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 62/255 (24%), Positives = 116/255 (45%), Gaps = 22/255 (8%)

Query: 28  ASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLA 87
           A+ ++  A+L++FP +    ++ G +   Q V   I  V G  P+  A  I  +  +V A
Sbjct: 46  AAGVAFYAMLALFPALAAIISIWGLVSDPQQVMQQIQSVSGMLPDQTAAIIKSQATKV-A 104

Query: 88  VPAKGLFTISALA----AAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLAS 143
             + G  +++AL     A Y +S G++AL   LN  Y   E R          G++ L  
Sbjct: 105 SASGGAVSLAALGSVLLAVYSASKGMKALIEGLNMVYDEEEKR----------GFIKLNL 154

Query: 144 VTLVIMSFVFVAIPLALAYVRKFFPALGNLLL--IIWNGRIYATMLALFI----GLIFVH 197
           V L++   + + +  AL  +      LG+L L  +     I+     LF+     L  ++
Sbjct: 155 VALILTIGLVLVMIAALGMIAAIPALLGSLGLGAVTKTAVIWLRWPLLFVVAIASLALIY 214

Query: 198 LFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
            + P+  + +   +  G +   + W+ G+  F+ Y   F +Y+  Y  L +++  L +L+
Sbjct: 215 RYAPSRTQPRWRWVSVGAVVATLLWIAGSFAFSFYTRNFGSYNETYGSLGAVIILLTWLW 274

Query: 257 MLGVFFILGAELNAS 271
           +     +LGAELN+ 
Sbjct: 275 LSAFVVLLGAELNSE 289


>gi|256844588|ref|ZP_05550073.1| methionine aminopeptidase Map [Lactobacillus crispatus 125-2-CHN]
 gi|293379910|ref|ZP_06626020.1| YihY family protein [Lactobacillus crispatus 214-1]
 gi|256613129|gb|EEU18333.1| methionine aminopeptidase Map [Lactobacillus crispatus 125-2-CHN]
 gi|290923530|gb|EFE00423.1| YihY family protein [Lactobacillus crispatus 214-1]
          Length = 307

 Score = 52.4 bits (124), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 99/209 (47%), Gaps = 6/209 (2%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV--VEMR-- 126
           P+ ++K I   I  +L   + G  +   + A +  SN V A+R+  NR Y V  VE++  
Sbjct: 73  PDQVSKFIMPIINSLLKTTSTGYISFGIVFAVWSLSNMVNAIRLGENRLYGVHQVELKLS 132

Query: 127 --SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
             ++  TR I+F +  L  +   I +   V     L ++   F    N +  I++ R   
Sbjct: 133 MLNFLWTRTITFIFTGLMILVFTIATLALVFGQQVLNFLGPIFQLPLNEISKIFSYRYPV 192

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
            +L + + L +++  LP  K K   I PGV  T + W+  + LF+ Y+  F      Y  
Sbjct: 193 LILVMMLALWYLNYVLPNIKLKKRVIWPGVFVTVVGWLALSFLFSFYLHHFPITWENYGI 252

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMI 273
           + + +  +++L +  V F+ G  +NA+++
Sbjct: 253 VGTFIIFMLWLNIAAVLFLFGVGVNAAIV 281


>gi|113474045|ref|YP_720106.1| putative ribonuclease BN [Trichodesmium erythraeum IMS101]
 gi|110165093|gb|ABG49633.1| putative ribonuclease BN [Trichodesmium erythraeum IMS101]
          Length = 371

 Score = 52.4 bits (124), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 59/297 (19%), Positives = 129/297 (43%), Gaps = 37/297 (12%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-----HQFVPTVI 63
           F  I +      ++    +++ ++ SA+L++FP ++      G   +      Q    +I
Sbjct: 69  FTTIKEVFNCVAKKRLSGLSAEMAYSAMLALFPALLTIIAAIGVFESLSSILFQMGSLLI 128

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV- 122
           D+V    P  +   I+  + ++   P K +F+ S + + +  S+ + +   +L+  ++V 
Sbjct: 129 DIV----PNQVQDLISSAVYEIQRSPNKKIFSFSFILSIWLFSSVLSSAMAALDEIHQVP 184

Query: 123 -VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRK---------------- 165
             + R ++  +L+S G  +   + L+I S + +   L +  + +                
Sbjct: 185 LDKKRPFWKAKLVSLGLTIGTLILLIIASGLVLVSDLIVYMISRQSCLLEILPNCPSDQV 244

Query: 166 ----FFPALGNL-----LLIIWNGRIYATMLALF-IGLIFVHLFLPAAKSKIMSILPGVI 215
               F   + N      LL  WN   +   L +  I   FV+ F P+ + K   I+PG I
Sbjct: 245 ASCLFQKPINNCVLKLRLLETWNQLRWPITLGIVSIAFAFVYRFGPSYRRKGTPIIPGAI 304

Query: 216 FTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
              + W   + LF  Y+  F  Y+ +Y  + + +  L++LY+     ++G++LN ++
Sbjct: 305 IAALMWAAASNLFRLYVFYFGNYNRIYGAIGTFIILLLWLYISSFVVLIGSQLNVTV 361


>gi|108804245|ref|YP_644182.1| ribonuclease BN [Rubrobacter xylanophilus DSM 9941]
 gi|108765488|gb|ABG04370.1| ribonuclease BN, putative [Rubrobacter xylanophilus DSM 9941]
          Length = 317

 Score = 52.4 bits (124), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 106/223 (47%), Gaps = 12/223 (5%)

Query: 55  AHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT----ISALAAAYFSSNGVE 110
           A   V T+++ +    P+   + +  ++L +    A+G FT    IS L A +  S  + 
Sbjct: 76  ATDLVRTMLENLSRVMPQSALRFVESQLLSITQSQAEGAFTAGAVISILLALWGVSGAMR 135

Query: 111 ALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFP-- 168
           ++  ++N  Y V E R ++    IS   +L++     ++    + +    A+        
Sbjct: 136 SVMEAMNVMYEVEENRPFWKVYGIS---ILISLAVAALLILALLLLVFGAAFGGGLASLV 192

Query: 169 ALGNLLLIIWNGRIYATMLALFIGLIF--VHLFLPAAKSKIMSILPGVIFTWISWVVGAV 226
            LG +   IW+   +  +LA F+   F  V+ F PA + +   I  G +  ++ W++ ++
Sbjct: 193 GLGPVFAAIWSVAQW-PILACFVLFAFALVYYFAPAVEQRWRWISAGSVLAFVFWLIFSL 251

Query: 227 LFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
            F+ Y+  F +Y+  Y  LA I+  L+++Y   +  +LGAELN
Sbjct: 252 AFSLYVANFGSYNATYGSLAGIIIFLLYVYYSSLIVLLGAELN 294


>gi|297204191|ref|ZP_06921588.1| ribonuclease BN family membrane protein [Streptomyces sviceus ATCC
           29083]
 gi|197714118|gb|EDY58152.1| ribonuclease BN family membrane protein [Streptomyces sviceus ATCC
           29083]
          Length = 359

 Score = 52.0 bits (123), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 62/267 (23%), Positives = 122/267 (45%), Gaps = 6/267 (2%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           ++  ++  F +++    A+ ++   LLS+FP I+   ++ G  G      TV+  +    
Sbjct: 53  VLRGSLREFKDDELTDRAAALTYYGLLSLFPAILVLVSMLGLTG-KSATDTVLKNLKQFT 111

Query: 71  PEVIAKPITDEILQVLAVPAKG-LFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSW 128
           P      IT  + Q+      G +  I  L  A +S++G V A   S NR Y + E R  
Sbjct: 112 PGSARDIITGAVEQLQGNAGVGSVMAIVGLVLAVWSASGYVAAFMRSANRVYDMPEGRPI 171

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +    +  G  ++  V L ++S + V     LA+       +G+  L +W    +  ++ 
Sbjct: 172 WKILPVRVGLTVVLMV-LAVVSALIVVFTGTLAHKAGTALGIGDTALTVWAIAKWPVLVV 230

Query: 189 LFIGLI-FVHLFLPAAKSKIMS-ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           L   +I  ++   P A+ K    I PG +   + W++ +  F  Y+  F++Y+  Y  +A
Sbjct: 231 LVTIMIALLYWATPNARVKGFRWITPGSVLALLIWLIASAGFAFYVANFASYNKTYGTMA 290

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMI 273
            ++  LV+L++  +  +LG E +A  +
Sbjct: 291 GVIVFLVWLWISNLAILLGLEFDAETV 317


>gi|146339131|ref|YP_001204179.1| putative ribonuclease [Bradyrhizobium sp. ORS278]
 gi|146191937|emb|CAL75942.1| conserved hypothetical protein; putative membrane protein; putative
           ribonuclease [Bradyrhizobium sp. ORS278]
          Length = 353

 Score = 52.0 bits (123), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 63/271 (23%), Positives = 128/271 (47%), Gaps = 16/271 (5%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D++Y   E+  +    A+A+ ++   LL++FP +     + G       +   ++ + G 
Sbjct: 60  DVLYRVYENVGDHRIVALAAGMTFYTLLAIFPALAAMVAIYGLFSDPAKITGHLEQLQGL 119

Query: 70  WPEVIAKPITDEILQVLAVPAK--GLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMR 126
            P        D++ +V A  ++  G+  + +LA + +S+N  +++L  +LN  YR  E R
Sbjct: 120 MPGGAIDIARDQLTRVSAKGSQALGVTFLVSLAISLWSANAAMKSLFDTLNVVYREPERR 179

Query: 127 SW----YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            +     I+ L + G +L A + +       V +P+ L YV        +LLL I  GR 
Sbjct: 180 GFIKLNAISLLFTGGAILFALLAIA----AIVVVPVILQYV--GLSDAADLLLRI--GRW 231

Query: 183 YATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
            A  + + +GL  ++ + P  +  K   I  G       W+ G+ LF+ Y   F +++  
Sbjct: 232 PAIFICVSLGLALIYRYGPDREEPKWRWISWGSALAAALWLGGSALFSWYAANFGSFNAT 291

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           Y  L + +  + ++++  +  ++GAEL+A +
Sbjct: 292 YGSLGAAVGFMTWIWISAIVILIGAELDAEL 322


>gi|326803368|ref|YP_004321186.1| YihY family protein [Aerococcus urinae ACS-120-V-Col10a]
 gi|326651129|gb|AEA01312.1| YihY family protein [Aerococcus urinae ACS-120-V-Col10a]
          Length = 320

 Score = 52.0 bits (123), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 61/253 (24%), Positives = 119/253 (47%), Gaps = 7/253 (2%)

Query: 28  ASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLA 87
           A+ ++  ALL++FP ++  AN+   L         ++ +    P  I   +   +   L 
Sbjct: 25  AAELAYYALLAIFPMLLLVANIIPLLPFDS--AQAVEWITAILPNEIEPLLIPTLKSYLD 82

Query: 88  VPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLV 147
             + G  +I+ +   + SS G  AL+  LNR Y   + ++  ITR+ SF    L  +++ 
Sbjct: 83  STSAGSLSINTILVIWSSSAGFSALQRVLNRVYGNPDHKNAVITRIASFLIAFLLVLSVG 142

Query: 148 IMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKI 207
           + S  FV     L  +  F P   + + ++   +    ++++FI ++F+++ +P     +
Sbjct: 143 VFSLFFVFGETLLQIINNFVPLPLDFVELLLGLKWPVLLVSVFILMLFIYIVVPNQPMTL 202

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL-VFLYMLGVFFILGA 266
              LPG +   I  ++ + LF  Y V F+  S++  G   +   L ++LY+ G+  I+G 
Sbjct: 203 KYALPGSVTAAIIVLLISSLFGVY-VQFAGGSSVQNGTIGVFIALMLYLYLNGMALIVGG 261

Query: 267 ELNASMIIYYWRK 279
            +N    IYY  K
Sbjct: 262 LVNT---IYYRYK 271


>gi|312874248|ref|ZP_07734282.1| YihY family protein [Lactobacillus iners LEAF 2052A-d]
 gi|311090318|gb|EFQ48728.1| YihY family protein [Lactobacillus iners LEAF 2052A-d]
          Length = 306

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 118/251 (47%), Gaps = 24/251 (9%)

Query: 36  LLSVFPFIVFGANLAGFLGAH-QFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLF 94
           L S+FP I+   N+   L  +   + T ++V+F   PE IA+ I   +  +L   + G  
Sbjct: 38  LFSIFPVIMIVGNMLPLLQINTSSIATYLNVIF---PEQIAQFILPIVKSLLHQQSNGSI 94

Query: 95  TISALAAAYFSSNGVEALRISLNRAYRVVEMRS----WY--ITRLISFGYVLLASVTLVI 148
           ++  + A +  S  V ++RI++N+ Y V E       WY  +TR +    +LL S+    
Sbjct: 95  SLGIIFALWSFSGLVNSIRIAMNKIYGVYEQEKTCPWWYYFVTRTL----MLLLSI---F 147

Query: 149 MSFVFVAIPLALAYVRKFFPALGNLL--LIIWNGRI--YATMLALFIGLIF---VHLFLP 201
           M ++F+     +A+  +    LG  L   + W  ++  Y   L + + ++F   ++  +P
Sbjct: 148 MIYIFLLAIFVVAFGNQIMNFLGVTLNFSVEWLNQLLHYRWPLIILMTILFNTYINYTIP 207

Query: 202 AAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVF 261
               K     PG IFT I W   +  F  Y+  F T    Y  + + +  L++L +  + 
Sbjct: 208 NIGMKSRITFPGTIFTTICWCGLSYFFGLYLHEFGTRWENYGIIGTFIIFLMWLNLAAIL 267

Query: 262 FILGAELNASM 272
           F++G  LNA++
Sbjct: 268 FLIGVCLNATI 278


>gi|116628245|ref|YP_820864.1| ribonuclease BN-like family protein [Streptococcus thermophilus
           LMD-9]
 gi|116101522|gb|ABJ66668.1| Ribonuclease BN-like family enzyme [Streptococcus thermophilus
           LMD-9]
          Length = 314

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 111/244 (45%), Gaps = 15/244 (6%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           +L+VFP IV  AN+  +L        ++  +    P+    P  + +  + + P+  L  
Sbjct: 43  ILTVFPLIVIAANVFPYLNID--TTDLLKFMNEHLPKHFYAPAANVVQDIFSTPSGRLLG 100

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
           +++L   +     + +L+ ++++ Y   E R  +I+ +I     L+    L     +   
Sbjct: 101 VASLTGFWTMIKSLSSLQKAIDKVYGASEHRDVFISHIIGGLLSLVILFLLTFALMLSTI 160

Query: 156 IPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIMSILPGV 214
           I   L  + + +P   NL  +I N     ++  +F+G++ ++  LP  K  KI  I+PG 
Sbjct: 161 IQSVLRIINQTYPIGSNLTQLILNSIQPLSVAVVFLGMMVLYFILPNVKIRKIRYIMPGT 220

Query: 215 IFTWISWVVG--AVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFF-----ILGAE 267
           IFT  + V+G  + LF  Y++   +         SIM   +F++ML   F     I GA 
Sbjct: 221 IFT--TLVIGYLSNLFGTYVIHTLSRLVDIKLFGSIM---IFIFMLWFIFLARILIFGAI 275

Query: 268 LNAS 271
            NA+
Sbjct: 276 FNAT 279


>gi|110637484|ref|YP_677691.1| hypothetical protein CHU_1074 [Cytophaga hutchinsonii ATCC 33406]
 gi|110280165|gb|ABG58351.1| conserved hypothetical protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 313

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/266 (21%), Positives = 116/266 (43%), Gaps = 28/266 (10%)

Query: 21  EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITD 80
            +D    A  I+    LS+FP I+F   L  ++        ++  + G  P+ I   +  
Sbjct: 53  NDDINVRAKSITYDFFLSIFPGIIFLFTLIPYIPIPDLDKNILSAISGFLPQNIYVSVES 112

Query: 81  EILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
            +  ++ +P  GL +   L A Y ++NG+ ++  + N  Y+  + RS+     IS   + 
Sbjct: 113 TLTDIINIPRGGLLSFGFLFAFYAANNGIISVINTFNHCYKTTDDRSFIAKLGISISILF 172

Query: 141 LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGL--IFVHL 198
           L  + LV++  + +   L L Y              + NG   ++    F+    +FV  
Sbjct: 173 L--LFLVVVGGIVITWFLKLLYTN------------LENGFDVSSFQLYFVAFLRLFVMF 218

Query: 199 FLPAAKSKIMS-ILPGVIFTWISWVVGAVL-----------FTHYIVTFSTYSTMYAGLA 246
           FL      IM  I P +   W  + +G+V            F  YI  F++Y+ +Y  + 
Sbjct: 219 FLIIMSISIMYFIAPSIHKRWKFFSLGSVTASILCFVFNLGFGFYIEHFNSYNKVYGSIG 278

Query: 247 SIMTCLVFLYMLGVFFILGAELNASM 272
           +++  L+ +++  +  ++G ++NAS+
Sbjct: 279 ALIGFLLLIFVNILMLLVGFQINASL 304


>gi|307303467|ref|ZP_07583221.1| ribonuclease BN [Sinorhizobium meliloti BL225C]
 gi|306902858|gb|EFN33450.1| ribonuclease BN [Sinorhizobium meliloti BL225C]
          Length = 330

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 126/278 (45%), Gaps = 19/278 (6%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MR+ F  VF  I        EE    +A+ +S   LLS+FP +    ++ G +     + 
Sbjct: 34  MRDVFWRVFSEIG-------EERVMLIAAGVSFYLLLSLFPALGALVSIYGLVADPSEIG 86

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL---FTISALAAAYFSSNGVEALRISLN 117
           T + ++    P      I D++  +       L   F +S   + + ++NG+ A   ++N
Sbjct: 87  THVGILQALLPADSYGLIMDQLETLTTQKPSTLGIGFFVSLSISLWLAANGIAATFDAMN 146

Query: 118 RAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALGNLLL 175
            AY   E R +    L+   +   A +  V +      +P  LAYV   ++        L
Sbjct: 147 VAYGEREKRGFLSRTLLCLAFTFAALLFAVALIAAIGVVPAVLAYVWVDRWVE------L 200

Query: 176 IIWNGRIYATMLALFIGLIFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVT 234
           +    R  A +L +  G I ++ F P+  ++K+  +  G +F+ + W+  + LF++Y+  
Sbjct: 201 VTRAARWPAVLLLVTFGTILIYRFGPSRERAKLRWLNWGAVFSTLFWLAASWLFSYYLEH 260

Query: 235 FSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           F+ Y+  Y  L ++   + ++++  +  I+GA +NA +
Sbjct: 261 FANYNATYGALGALAGLMTWVWISVMILIIGALINAEL 298


>gi|300087710|ref|YP_003758232.1| ribonuclease BN [Dehalogenimonas lykanthroporepellens BL-DC-9]
 gi|299527443|gb|ADJ25911.1| ribonuclease BN [Dehalogenimonas lykanthroporepellens BL-DC-9]
          Length = 295

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/271 (22%), Positives = 124/271 (45%), Gaps = 25/271 (9%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAG-FLGAHQFVPTVIDVVFGA 69
           +I   IE    +D   +A+ ++  A+LS+FP ++   ++AG FL +      + D +   
Sbjct: 25  VIVGTIEALGRDDASHLAAGVAYFAVLSLFPLLLGFISIAGLFLPSEAVQQAIFDFMETN 84

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYF-SSNGVEALRISLNRAYRVVEMRSW 128
            P + ++ I + I  ++A  ++G+  I +L A ++ SSN   A+ ++LNR+  V E   +
Sbjct: 85  LP-IASEIIVENIDSIIA--SRGVIGIISLLALFWTSSNMFTAIAVALNRSCGVCERHPF 141

Query: 129 YITRLISFGYVLLASVTLV---IMSFVFVAIPLALAYVRKFFPALGN----LLLIIWNGR 181
           YI +       L A    +   ++  V   IP A        P +G+    +L +I  G 
Sbjct: 142 YIRKPRDMALSLAAGFLFLFSGVLPTVISLIPEA------HLPLVGSTTNVILFLIGAGL 195

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
            +   L L+        FLP  +     I PG +   +++      F  ++  F+ +  +
Sbjct: 196 SFLVFLVLYS-------FLPTHRRPWQFIWPGALLGTVAFEGLRYFFIMFLSNFANFKLV 248

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           Y  + S +  ++++Y+     ++GAE N  +
Sbjct: 249 YGTIGSAVALMIWIYLSAFILLIGAEFNGQL 279


>gi|325912154|ref|ZP_08174552.1| YihY family protein [Lactobacillus iners UPII 143-D]
 gi|325476104|gb|EGC79272.1| YihY family protein [Lactobacillus iners UPII 143-D]
          Length = 306

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 118/251 (47%), Gaps = 24/251 (9%)

Query: 36  LLSVFPFIVFGANLAGFLGAH-QFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLF 94
           L S+FP I+   N+   L  +   + T ++V+F   PE IA+ I   +  +L   + G  
Sbjct: 38  LFSIFPVIMIVGNMLPLLQINTSSIATYLNVIF---PEQIAQFILPIVKSLLHQHSNGSI 94

Query: 95  TISALAAAYFSSNGVEALRISLNRAYRVVEMRS----WY--ITRLISFGYVLLASVTLVI 148
           ++  + A +  S  V ++RI++N+ Y V E       WY  +TR +    +LL S+    
Sbjct: 95  SLGIIFALWSFSGLVNSIRIAMNKIYGVYEQEKTCPWWYYFVTRTL----MLLLSI---F 147

Query: 149 MSFVFVAIPLALAYVRKFFPALGNLL--LIIWNGRI--YATMLALFIGLIF---VHLFLP 201
           M ++F+     +A+  +    LG  L   + W  ++  Y   L + + ++F   ++  +P
Sbjct: 148 MIYIFLLAIFVVAFGNQIMNFLGVTLNFSVEWLNQLLHYRWPLIILMTILFNTYINYTIP 207

Query: 202 AAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVF 261
               K     PG IFT I W   +  F  Y+  F T    Y  + + +  L++L +  + 
Sbjct: 208 NIGMKSRITFPGTIFTTICWCGLSYFFGLYLHEFGTRWENYGIIGTFIIFLMWLNLAAIL 267

Query: 262 FILGAELNASM 272
           F++G  LNA++
Sbjct: 268 FLIGVCLNATI 278


>gi|254476019|ref|ZP_05089405.1| ribonuclease BN [Ruegeria sp. R11]
 gi|214030262|gb|EEB71097.1| ribonuclease BN [Ruegeria sp. R11]
          Length = 309

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 67/273 (24%), Positives = 124/273 (45%), Gaps = 24/273 (8%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           +++ A +      G  +A+ ++   LLSVFP +     L G        PTVI     AW
Sbjct: 43  LMWHAWQRMDRAKGGLLAAGVAFYGLLSVFPGMTAAVALFGMFAD----PTVI-TEQSAW 97

Query: 71  -----PEVIAKPITDEILQV-LAVPAK-GLFTISALAAAYFS-SNGVEALRISLNRAYRV 122
                P   A  +  +++ V +  P + G   I +++ A++S S    +L   LN  Y  
Sbjct: 98  LTRLLPPSAADLLNGQLVDVAMERPDRLGWAAILSISIAFWSASRAANSLMQGLNVIYNR 157

Query: 123 VEMRSW---YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
            E R     YI +LI     ++ ++ LV+   V  AIP ALA      P L ++  ++  
Sbjct: 158 AERRGMVMLYIRQLIITFAAIVGALFLVL---VVAAIPAALALFGDS-PLLSDIAQVV-- 211

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKI-MSILPGVIFTWISWVVGAVLFTHYIVTFSTY 238
            R     ++  +G+  ++ F P  + +    I PG   +   WV G++ F++Y+  F +Y
Sbjct: 212 -RWPLMFVSGMVGISLLYRFGPDRRGEEWHRITPGAFVSCSLWVAGSIGFSYYVRVFGSY 270

Query: 239 STMYAGLASIMTCLVFLYMLGVFFILGAELNAS 271
           S  +  L+ ++  L ++++     + GA ++A 
Sbjct: 271 SETFGTLSGVVLLLTWMWLSAFVVLYGAGIDAE 303


>gi|312872994|ref|ZP_07733054.1| YihY family protein [Lactobacillus iners LEAF 2062A-h1]
 gi|311091516|gb|EFQ49900.1| YihY family protein [Lactobacillus iners LEAF 2062A-h1]
          Length = 306

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 118/251 (47%), Gaps = 24/251 (9%)

Query: 36  LLSVFPFIVFGANLAGFLGAH-QFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLF 94
           L S+FP I+   N+   L  +   + T ++V+F   PE IA+ I   +  +L   + G  
Sbjct: 38  LFSIFPVIMIVGNMLPLLQINTSSIATYLNVIF---PEQIAQFILPIVKSLLHQHSNGSI 94

Query: 95  TISALAAAYFSSNGVEALRISLNRAYRVVEMRS----WY--ITRLISFGYVLLASVTLVI 148
           ++  + A +  S  V ++RI++N+ Y V E       WY  +TR +    +LL S+    
Sbjct: 95  SLGIIFALWSFSGLVNSIRIAMNKIYGVYEQEKTCPWWYYFVTRTL----MLLLSI---F 147

Query: 149 MSFVFVAIPLALAYVRKFFPALGNLL--LIIWNGRI--YATMLALFIGLIF---VHLFLP 201
           M ++F+     +A+  +    LG  L   + W  ++  Y   L + + ++F   ++  +P
Sbjct: 148 MIYIFLLAIFVVAFGNQIMNFLGVTLNFSVEWLNQLLHYRWPLIILMTILFNTYINYTIP 207

Query: 202 AAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVF 261
               K     PG IFT I W   +  F  Y+  F T    Y  + + +  L++L +  + 
Sbjct: 208 NIGMKSRITFPGTIFTTICWCGLSYFFGLYLHEFGTRWENYGIIGTFIIFLMWLNLAAIL 267

Query: 262 FILGAELNASM 272
           F++G  LNA++
Sbjct: 268 FLIGVCLNATI 278


>gi|163755344|ref|ZP_02162464.1| hypothetical protein KAOT1_07988 [Kordia algicida OT-1]
 gi|161324764|gb|EDP96093.1| hypothetical protein KAOT1_07988 [Kordia algicida OT-1]
          Length = 315

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/286 (19%), Positives = 130/286 (45%), Gaps = 24/286 (8%)

Query: 12  IYDAIEHFVEE--DG--WAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           IYD +E ++    +G   + A  I+ S  +++FP ++F  NL  ++    F  + I  + 
Sbjct: 35  IYDLMEMYIVGIINGALTSRAGSIAFSFFMAIFPSLLFLLNLLPYVPIDGFQGSFIRAIT 94

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P+     + + I+ ++     GL + + L + +  +NGV A+      +Y +++ R 
Sbjct: 95  SLLPDESGNFMNEIIVDIVKNKRGGLLSSTFLLSIFLMANGVSAIFAGFETSYYILKKRR 154

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT-- 185
           ++   L + G  L       I++ + ++  + L Y   +   + +  +     +I  T  
Sbjct: 155 FFQQYLYALGVGL-------ILALLLISTVIVLGYTEIYIVRISDFAVKTTGFKISQTNE 207

Query: 186 -----------MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVT 234
                      ++ +++G   ++ F      +     PG + T +  V+ + LF  YI  
Sbjct: 208 FWITIAKFSFLIVMVYLGTAILYYFGTHQGRRAKFFSPGALLTTVLIVLTSYLFGIYIAN 267

Query: 235 FSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           FS Y+ +Y  + +++  ++++++     +LG ELNAS+ +   +K+
Sbjct: 268 FSQYNELYGSIGALLILMMYIWLNANILLLGFELNASLDMLRIKKE 313


>gi|217979693|ref|YP_002363840.1| ribonuclease BN [Methylocella silvestris BL2]
 gi|217505069|gb|ACK52478.1| ribonuclease BN [Methylocella silvestris BL2]
          Length = 360

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 63/268 (23%), Positives = 117/268 (43%), Gaps = 29/268 (10%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVL 86
           +A+ ++   LL++FP +    +L GF      V   ID++ G  P      + DE  ++ 
Sbjct: 103 VAAGVTFYLLLAIFPAVSALVSLYGFFADRSGVGAQIDLLVGLLPAGGLDLLRDEATRIA 162

Query: 87  AVPAKGLFTISA-----LAAAYFSSN-GVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
                G  T+SA     LA + +S+N G++ L  ++N  Y   E RS+      S  +  
Sbjct: 163 T---SGQSTLSAVFLFGLAVSIWSANAGMKGLFEAMNVVYEEQENRSFIRLNAWSLAFTF 219

Query: 141 LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFL 200
            A +  +      V +P+ L YV         L L  W    ++ +LAL I    ++ + 
Sbjct: 220 GALLFALAALGAIVLVPIILDYVGLERSGAAILSLARWPLLFFSLVLALAI----LYRYG 275

Query: 201 PAAKSKIMSILPGVIFTWISW---------VVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
           P+         P   + WI+W         +V ++LF+ Y+  F +Y+  Y  L + +  
Sbjct: 276 PSRN-------PAPSWRWITWGSAAASALWLVASILFSWYVANFGSYNATYGSLGAAIGF 328

Query: 252 LVFLYMLGVFFILGAELNASMIIYYWRK 279
           + ++++     ++G ELN+ +     RK
Sbjct: 329 MTWIWISITVVLVGGELNSQIERQAGRK 356


>gi|319939194|ref|ZP_08013557.1| methionine aminopeptidase Map [Streptococcus anginosus 1_2_62CV]
 gi|319811590|gb|EFW07866.1| methionine aminopeptidase Map [Streptococcus anginosus 1_2_62CV]
          Length = 302

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 126/270 (46%), Gaps = 42/270 (15%)

Query: 27  MASHISLSA-------LLSVFPFIVFGANLAGF--LGAHQFVPTVIDVVFGAWPEVIAKP 77
            AS I L++       L+S+FP ++   N+  +  +   +F+  + DV+  +  EV+AK 
Sbjct: 22  QASEIDLTSIAVAYYLLISIFPLLLIVVNILPYFQIPIAEFLEAMEDVLPESLYEVVAKV 81

Query: 78  ITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL---- 133
             +    +L  P+ GL + S L+A +  S  +  L+ + N+AY V + R     RL    
Sbjct: 82  TRN----LLTQPSSGLLSFSILSALWAFSQSMSFLQKAFNKAYGVAKDRGLISHRLFSLV 137

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGL 193
           IS G   L +++L++  F  +++ L  ++               ++ ++YA++  +    
Sbjct: 138 ISLGLQFLFALSLLLTMFGRMSLRLLHSFWE-------------FDDQLYASLQRMTQPT 184

Query: 194 IFV---------HLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
           I+          + FLP  K  KI  +LPG IF   +  V   LF+ Y+ T+  +     
Sbjct: 185 IYTLLFLSLLMLYYFLPNVKIRKIRYVLPGTIFVVFTIGVLLNLFSVYLDTYVNHLMDVR 244

Query: 244 GLASIMTCLVFLY--MLGVFFILGAELNAS 271
             +SI   +V ++  ++    I+GA LNAS
Sbjct: 245 FFSSIFVVVVMIWFTLIAQIMIIGAILNAS 274


>gi|13476680|ref|NP_108249.1| hypothetical protein mll8068 [Mesorhizobium loti MAFF303099]
 gi|14027441|dbj|BAB53710.1| mll8068 [Mesorhizobium loti MAFF303099]
          Length = 353

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 94/195 (48%), Gaps = 9/195 (4%)

Query: 83  LQVLAVPAKGLFTIS---ALAAAYFSSN-GVEALRISLNRAYRVVEMRSWYITRLISFGY 138
           LQ LA+   G   I     L  A +SSN G++AL  ++N AY   E RS+    L+S  +
Sbjct: 131 LQALAMQKPGALGIGFFIGLGIALWSSNSGMKALFDAMNIAYEEREKRSFITLNLMSILF 190

Query: 139 VLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHL 198
            + A +  +++      +P  L Y   +  A    L+ +   R    + A+  G+  ++ 
Sbjct: 191 TVGALLIGIVLLLTVGVVPALLRYF--YLDAWTETLVAV--SRWPILVAAMLTGISLLYR 246

Query: 199 FLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
           F P+  ++K   +  G +    +W+  + LF+ Y+  F+ Y+  Y  L +++  +++ ++
Sbjct: 247 FGPSRERAKWRWLSSGALIATAAWIAASWLFSFYLQHFANYNATYGSLGAVVGLMMWTWI 306

Query: 258 LGVFFILGAELNASM 272
             +  I GA +NA M
Sbjct: 307 SVIILIAGAAINAEM 321


>gi|269929254|ref|YP_003321575.1| ribonuclease BN [Sphaerobacter thermophilus DSM 20745]
 gi|269788611|gb|ACZ40753.1| ribonuclease BN [Sphaerobacter thermophilus DSM 20745]
          Length = 313

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 97/218 (44%), Gaps = 20/218 (9%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGV-EALRISLNRAYRVVEMRSWY 129
           PE+  +   + +L  L  P  G+F +  L    ++++GV  ALR  LNR + V   RS+ 
Sbjct: 98  PELGLQEPVEGLLDDLGAPGGGVFGLIGLVGLAWTASGVFGALRRVLNRVFAVPSNRSFV 157

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPAL--GNLLLIIWNGRIY---- 183
             R I     LLA + +  +  +   + L L  VR F      G L+ + W G ++    
Sbjct: 158 HARAID----LLAMICVPTLLILSTLLTLGLRLVRTFASDYFDGLLIRVAW-GVVFLLVP 212

Query: 184 -ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
            AT  A+F+    ++  +P  + +   +  G +F  + + +    F  Y+     + T+Y
Sbjct: 213 LATSFAVFL---LLYRLVPNLRPEFADLWAGALFAAVGFELAKAGFGFYVTEVGDFQTLY 269

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             L   +T LVF+Y++    I G      ++   WR +
Sbjct: 270 GPLGGAVTFLVFVYLVANVVIFG----GGIVAERWRDR 303


>gi|227877143|ref|ZP_03995217.1| possible ribonuclease BN [Lactobacillus crispatus JV-V01]
 gi|256848992|ref|ZP_05554426.1| methionine aminopeptidase Map [Lactobacillus crispatus MV-1A-US]
 gi|227863197|gb|EEJ70642.1| possible ribonuclease BN [Lactobacillus crispatus JV-V01]
 gi|256714531|gb|EEU29518.1| methionine aminopeptidase Map [Lactobacillus crispatus MV-1A-US]
          Length = 307

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 99/209 (47%), Gaps = 6/209 (2%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV--VEMR-- 126
           P+ ++K I   I  +L   + G  +   + A +  SN V A+R+  N+ Y V  VE++  
Sbjct: 73  PDQVSKFIMPIINSLLKTTSTGYISFGIVFAVWSLSNMVNAIRLGENKLYGVHQVELKLS 132

Query: 127 --SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
             ++  TR I+F +  L  +   I +   V     L ++   F    N +  I++ R   
Sbjct: 133 MLNFLWTRTITFVFTGLMILVFTIATLALVFGQQVLNFLGPIFQLPLNEISKIFSYRYPV 192

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
            +L + + L +++  LP  K K   I PGV  T + W+  + LF+ Y+  F      Y  
Sbjct: 193 LILVMMLALWYLNYVLPNIKLKKRVIWPGVFVTVVGWLALSFLFSFYLHHFPITWENYGI 252

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMI 273
           + + +  +++L +  V F+ G  +NA+++
Sbjct: 253 VGTFIIFMLWLNIAAVLFLFGVGVNAAIV 281


>gi|195977831|ref|YP_002123075.1| methionine aminopeptidase Map [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|195974536|gb|ACG62062.1| methionine aminopeptidase Map [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
          Length = 599

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 105/239 (43%), Gaps = 5/239 (2%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           +L+ FP IV  AN+  +L     +  ++ ++    P+ I +  +  ++ + + P+ G+  
Sbjct: 330 ILTAFPLIVIAANIFPYLNID--ISDLLRLMKEQLPKDIYRSASSIVVNIFSKPSGGVLG 387

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
           I+ L   +  S  + +L+ + N+AY   E R + +  L+     LL    L         
Sbjct: 388 IATLTGLWTMSRSLASLQKAFNKAYDASEHRDFLLGHLVGLLTSLLILFLLTFALIFSTF 447

Query: 156 IPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIMSILPGV 214
              A+  + + +    N+  +        T+L +FIGL+ ++  LP  K  KI  ILPG 
Sbjct: 448 SKAAIQVLDRHYHLNDNITTLFLFLIQPITILIIFIGLMLLYFLLPNIKIKKIRYILPGT 507

Query: 215 IFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY--MLGVFFILGAELNAS 271
            FT    +  + +  +Y+V             S+M  ++ L+   L    I+GA  NA+
Sbjct: 508 FFTTFVMIFLSNMVGNYVVHNVERMVDIKTFGSVMVFIIMLWFIFLARILIMGAVFNAT 566


>gi|307706878|ref|ZP_07643680.1| ribonuclease BN-like family protein [Streptococcus mitis SK321]
 gi|307617751|gb|EFN96916.1| ribonuclease BN-like family protein [Streptococcus mitis SK321]
          Length = 286

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 122/246 (49%), Gaps = 17/246 (6%)

Query: 36  LLSVFPFIVFGANLAGF--LGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL 93
           L+S+FP ++   N+  +  +    F+  V + +     +V+AK IT    +VL  P+ GL
Sbjct: 38  LISIFPLLLVVVNILPYFQIPVSNFLKVVNEFLPDTMYDVVAKIIT----EVLTQPSTGL 93

Query: 94  FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL----ISFGYVLLASVTLVIM 149
            + + L+A +  S  +  L+ + N+AY V + R     +L    +SFG  +L ++ L + 
Sbjct: 94  LSFAVLSALWTFSKSMNFLQKAFNKAYGVAKNRGMISHQLMSLFVSFGLQILFALALFLS 153

Query: 150 SFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIM 208
            F  + + L  +Y +   P L + L  +    +YA + A+   L+ ++ FLP  K  +I 
Sbjct: 154 VFGRMLLNLIKSYWKSDSP-LFDYLQDLTGPLVYALIFAI---LVMLYYFLPNVKVRRIR 209

Query: 209 SILPGVIFTWISWVVGAVLFTHYIVTFSTY--STMYAGLASIMTCLVFLYMLGVFFILGA 266
           S+LPG  F  ++ V+   +F+ Y+  +  +     +     ++  + +  ++    I+GA
Sbjct: 210 SVLPGSAFVMLTLVLLLNIFSVYVNNYVNHLVDVRFFSSVVVVVMMFWFILIAKILIVGA 269

Query: 267 ELNASM 272
            +NAS+
Sbjct: 270 VINASV 275


>gi|283457804|ref|YP_003362396.1| hypothetical protein RMDY18_07440 [Rothia mucilaginosa DY-18]
 gi|283133811|dbj|BAI64576.1| predicted membrane protein [Rothia mucilaginosa DY-18]
          Length = 455

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 125/273 (45%), Gaps = 12/273 (4%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG-AHQFVPTVIDVVFGA 69
           I+  AI  F    G  MA+ ++   +LS+FP ++   +L G  G   +    ++  +   
Sbjct: 52  ILRRAIYKFGANGGTDMAAALTYFTVLSIFPALLAIVSLLGVFGHGEESAAVILAFLKDN 111

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSW 128
            P  +   + D I Q+      GL  ++ + +A +S++G   +   +LN  Y V E R  
Sbjct: 112 APAQMYAILEDPIKQITGDHGAGLVLLTGILSALWSASGYTGSFGRALNTVYNVREGRPG 171

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLI--IW-NGRIYAT 185
           +I + ++     +  + +V+M  + +     L  V ++ P   ++ LI  IW NGR    
Sbjct: 172 WILKPLNVFVTTVIIILVVLMMLMMLLGVTVLDMVGRYVPETVDMELIKLIWLNGRW--- 228

Query: 186 MLALFIGLIFVHLFLPAAKS----KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
           +L LF+ +  + L   A  +    K   + PG         +GA  FT Y   FS Y+  
Sbjct: 229 VLILFMAIALITLLYAATPNVRRYKAWRLSPGAALALFGMGLGAFGFTLYANNFSKYNAT 288

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMII 274
           Y  +  ++  L+F++++    + GA L+A +++
Sbjct: 289 YGLIGGVIVMLLFIWIMNNMLLFGAHLDAEIML 321


>gi|126661844|ref|ZP_01732843.1| hypothetical protein FBBAL38_00795 [Flavobacteria bacterium BAL38]
 gi|126625223|gb|EAZ95912.1| hypothetical protein FBBAL38_00795 [Flavobacteria bacterium BAL38]
          Length = 307

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/247 (21%), Positives = 113/247 (45%), Gaps = 6/247 (2%)

Query: 28  ASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLA 87
           AS I+ S  +++FPF +F  NL  F+    F    +  V    P    + I   +  ++ 
Sbjct: 55  ASAIAFSFFMALFPFALFILNLIPFIPLENFQADFLKFVENGVPPNTYEAIEMILKDIMG 114

Query: 88  VPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLV 147
              +GL +   + +    +NG+ A+      +  +   R ++    IS    L+ S+ L+
Sbjct: 115 TSHQGLLSSGFILSILLMTNGINAILGGFEMSAHITITRGFFKQYFISLAISLVLSLILI 174

Query: 148 IMSFVFVAIPLALAYVRKF--FPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKS 205
           I      AI +    ++K      + ++ +I W+ R    +L + I    ++ F     S
Sbjct: 175 I---TVAAIVITEVMIQKINVHGYVADVSVIEWS-RYGFIILMILITTSILYKFGAKETS 230

Query: 206 KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILG 265
           KI  I  G + T I  ++ + +F  Y+  F+ Y+ +Y  + +++  + ++++  +  +LG
Sbjct: 231 KISFISYGAVLTTILIILSSYIFGVYVEKFARYNELYGSIGTLLVLMFYIWINCMVLLLG 290

Query: 266 AELNASM 272
            ELNA++
Sbjct: 291 FELNATI 297


>gi|86142235|ref|ZP_01060745.1| hypothetical protein MED217_11334 [Leeuwenhoekiella blandensis
           MED217]
 gi|85830987|gb|EAQ49444.1| hypothetical protein MED217_11334 [Leeuwenhoekiella blandensis
           MED217]
          Length = 316

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/247 (20%), Positives = 117/247 (47%), Gaps = 4/247 (1%)

Query: 28  ASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLA 87
           AS I+ S  +++FPF +F  NL  ++  + F    +  +    P    +     +L + A
Sbjct: 55  ASAIAFSFFMALFPFFLFVLNLIPYVPINGFQSDFLSFINNLLPPQTQEFFDPILLDIAA 114

Query: 88  VPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLV 147
               GL + + + A +  +NGV A+      ++  +  RS      ++ G  ++ ++ L+
Sbjct: 115 NQRGGLLSFTLIFAIFLMANGVNAIFTGFEYSFHSITNRSIVKQYAVALGVSIMLALLLL 174

Query: 148 IMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLF--LPAAKS 205
           ++    + + + ++ +++      + L I   G   A ++ ++  +  ++ F       +
Sbjct: 175 LVVIAVLYLQITISELKRRGIVNEDNLWISQLGSYIALIVLIYTVVATLYYFGTKEGKDT 234

Query: 206 KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILG 265
           + +SI  G   T   ++V   LF  YI  F+TY+ +Y  + +++  +V++++     +LG
Sbjct: 235 RFLSI--GATLTTFLFIVTTYLFGVYINNFATYNQLYGSIGALLIMMVYIWLNANLLLLG 292

Query: 266 AELNASM 272
            ELNAS+
Sbjct: 293 FELNASL 299


>gi|91978756|ref|YP_571415.1| ribonuclease BN, putative [Rhodopseudomonas palustris BisB5]
 gi|91685212|gb|ABE41514.1| ribonuclease BN, putative [Rhodopseudomonas palustris BisB5]
          Length = 384

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 119/259 (45%), Gaps = 24/259 (9%)

Query: 26  AMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQV 85
           A+A+ ++  +LL++FP I     + G       +    D + G  P        D++ +V
Sbjct: 106 ALAAGMTYYSLLAIFPAIAALVAVYGLFADPSTIARHSDQLAGFLPGGALDVAQDQLTRV 165

Query: 86  LAVPAK--GLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITRLISFGYVLLA 142
            +  A+  GL  +  L  + +S+N  +++L  +LN  Y   E R +     IS G+ +  
Sbjct: 166 ASNGAQTLGLTFLIGLGISLWSANAAMKSLFDTLNVVYGEEEKRGFVKLNAISLGFTIGG 225

Query: 143 SVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPA 202
            + ++      V IP+ L +V     + G+ LL    GR  A  L L + L  ++ + P+
Sbjct: 226 VLFVLAALGCIVMIPVILGFV--GMSSFGDRLLSA--GRWPAMYLVLSVALAVIYRYGPS 281

Query: 203 AKSKIMSILPGVIFTWISW---------VVGAVLFTHYIVTFSTYSTMYAGLASIMTCLV 253
            ++          + WISW         +  + LF+ Y  +F  ++  Y  L +++  + 
Sbjct: 282 REA--------TPWRWISWGSATAAMVWLAASTLFSWYAASFGQFNETYGSLGAVVGFMT 333

Query: 254 FLYMLGVFFILGAELNASM 272
           +L+M  +  +LGAE++A++
Sbjct: 334 WLWMSAIVILLGAEIDAAL 352


>gi|90418256|ref|ZP_01226168.1| putative Ribonuclease BN, possibly membrane-associated
           [Aurantimonas manganoxydans SI85-9A1]
 gi|90337928|gb|EAS51579.1| putative Ribonuclease BN, possibly membrane-associated
           [Aurantimonas manganoxydans SI85-9A1]
          Length = 420

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 92/189 (48%), Gaps = 23/189 (12%)

Query: 94  FTISALAAAYFSSN-GVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFV 152
           F IS LA A +S+N G++AL  ++N AY   E RS+    L SF + L A V  ++   +
Sbjct: 165 FAIS-LAIALWSANAGMKALFEAMNVAYDEAEKRSFVTLTLTSFVFTLGAIVAAILFIGL 223

Query: 153 FVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFV---------HLFLPAA 203
            +A+PLAL             LL I     +   +A + G+  +         H      
Sbjct: 224 VIALPLALD------------LLGIGTDTKWLVSIASYAGIFLLVSFGIAALYHWGPSRT 271

Query: 204 KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFI 263
           ++K   I PG + T +  VV ++LF+ Y+  F +Y+  Y  L +++  + ++++     I
Sbjct: 272 RAKWRWITPGTVLTVVVIVVVSMLFSWYVANFGSYNATYGSLGALIGFMTWIWISTTILI 331

Query: 264 LGAELNASM 272
           +G E+NA M
Sbjct: 332 VGGEVNAEM 340


>gi|332142226|ref|YP_004427964.1| putative ribonuclease protein [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327552248|gb|AEA98966.1| putative ribonuclease protein [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 317

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/253 (22%), Positives = 121/253 (47%), Gaps = 14/253 (5%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT----VIDVVFGAWPEVIAKPITDEI 82
           +A+ ++   LL++FP +     L G + + Q + +    +++VV      +I + +T+ I
Sbjct: 39  IAAGVAFYCLLAIFPLLGATIALYGLMVSPQELQSHMTFLVNVVPTDSRYIIEEQLTNLI 98

Query: 83  LQVLAVPAKG-LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLL 141
            +  +    G LFT+  + + + SS G  AL  + N  Y   E R ++   L      + 
Sbjct: 99  EKSNSTLGWGFLFTL--VLSLWSSSKGANALIKACNITYGESEGRGFFKGILARVTCTVF 156

Query: 142 ASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF-IGLIFVHLFL 200
             +T+++       +P ++ ++     +    + + W       ML LF I L  ++ + 
Sbjct: 157 MILTVIVALACITILPESIQWLSGNTVSAKEAMWVTW-----PVMLGLFNIALSALYRYA 211

Query: 201 PAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLG 259
           P  + ++   + PG IF  + WVV +  F+ Y+  F +Y+  Y  +  I+  L++LY+  
Sbjct: 212 PHRREAQWRWVTPGSIFATVLWVVASYGFSIYLNEFGSYNKTYGSVGGIIILLMWLYLSA 271

Query: 260 VFFILGAELNASM 272
              ++GAE+N+++
Sbjct: 272 YIILIGAEVNSAI 284


>gi|218528864|ref|YP_002419680.1| ribonuclease BN [Methylobacterium chloromethanicum CM4]
 gi|218521167|gb|ACK81752.1| ribonuclease BN [Methylobacterium chloromethanicum CM4]
          Length = 388

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/275 (21%), Positives = 131/275 (47%), Gaps = 23/275 (8%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           +DI       F ++   ++A+ ++   LLS+FP I       G +     +   +  + G
Sbjct: 95  WDIATRVYLEFNKDRVLSVAAGVTFYTLLSLFPAIAALVTCYGLVADVNTINVHLSTLHG 154

Query: 69  AWPEVIAKPITDEILQVLAVPAKGL-FTI-SALAAAYFSSNG-VEALRISLNRAYRVVEM 125
             PE   + I +++ ++    +  L FT  ++L  + +S+N  ++A+  +LN  Y   E 
Sbjct: 155 VLPESAIEIIGEQVKRIATKGSGALGFTFFTSLTLSLWSANAAMKAMFDALNVVYEEEEK 214

Query: 126 RS--WYITRLISFG-----YVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIW 178
           R+  W   R ++F      +++LA +++V++  VF             F  LG+   +I 
Sbjct: 215 RNFFWLNVRSLTFTAGALLFIILALISIVVLPVVF------------NFLGLGDGARLIA 262

Query: 179 NGRIYATMLALFIGLIFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
            GR    +L L  GL  ++ + P+  +++   +  G +   + W++ ++LF+ Y+  F  
Sbjct: 263 MGRWPVLLLVLLGGLAVLYRYGPSRERARWRWVGAGSVVAGVLWLIASILFSWYVANFGN 322

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           Y+  Y  L +++  + ++++     +LG E+NA +
Sbjct: 323 YNETYGSLGAVIGFMTWIWISATIVLLGGEINAEI 357


>gi|309808686|ref|ZP_07702577.1| YihY family protein [Lactobacillus iners LactinV 01V1-a]
 gi|309810203|ref|ZP_07704048.1| YihY family protein [Lactobacillus iners SPIN 2503V10-D]
 gi|312875636|ref|ZP_07735637.1| YihY family protein [Lactobacillus iners LEAF 2053A-b]
 gi|315653664|ref|ZP_07906584.1| ribonuclease BN [Lactobacillus iners ATCC 55195]
 gi|308168065|gb|EFO70192.1| YihY family protein [Lactobacillus iners LactinV 01V1-a]
 gi|308169475|gb|EFO71523.1| YihY family protein [Lactobacillus iners SPIN 2503V10-D]
 gi|311088890|gb|EFQ47333.1| YihY family protein [Lactobacillus iners LEAF 2053A-b]
 gi|315489026|gb|EFU78668.1| ribonuclease BN [Lactobacillus iners ATCC 55195]
          Length = 306

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 117/251 (46%), Gaps = 24/251 (9%)

Query: 36  LLSVFPFIVFGANLAGFLGAH-QFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLF 94
           L S+FP I+   N+   L  +   + T ++V+F   PE IA+ I   +  +L   + G  
Sbjct: 38  LFSIFPVIMIVGNMLPLLQINTSSIATYLNVIF---PEQIAQFILPIVKSLLHQQSNGFI 94

Query: 95  TISALAAAYFSSNGVEALRISLNRAYRVVEMRS----WY--ITRLISFGYVLLASVTLVI 148
           ++  + A +  S  V ++RI++N+ Y V E       WY  +TR +    +LL S+    
Sbjct: 95  SLGIIFALWSFSGLVNSIRIAMNKIYGVYEQEKTCPWWYYFVTRTL----MLLLSI---F 147

Query: 149 MSFVFVAIPLALAYVRKFFPALGNLL--LIIWNGRI--YATMLALFIGLIF---VHLFLP 201
           M ++F+     +A+  +    LG  L   + W  ++  Y   L + + ++F   ++  +P
Sbjct: 148 MIYIFLLAIFVVAFGNQIMNFLGVTLNFSVEWLNQLLHYRWPLIILMTILFNTYINYTIP 207

Query: 202 AAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVF 261
               K     PG IFT I W   +  F  Y+  F      Y  + + +  L++L +  + 
Sbjct: 208 NISMKSRITFPGTIFTTICWCGLSYFFGLYLHEFGIRWENYGIIGTFIIFLMWLNLAAIL 267

Query: 262 FILGAELNASM 272
           F++G  LNA++
Sbjct: 268 FLIGVCLNATI 278


>gi|326334995|ref|ZP_08201195.1| YihY family protein [Capnocytophaga sp. oral taxon 338 str. F0234]
 gi|325692800|gb|EGD34739.1| YihY family protein [Capnocytophaga sp. oral taxon 338 str. F0234]
          Length = 304

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/249 (23%), Positives = 111/249 (44%), Gaps = 9/249 (3%)

Query: 28  ASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLA 87
           AS IS S  +++FPF++   NL  ++    F       +    P        D  L + +
Sbjct: 56  ASAISYSFFVAIFPFLLVVLNLIPYIPIADFQDDFWVFIDNLLPPGTHDFFKDIFLDIAS 115

Query: 88  VPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLV 147
               GL +   + + + ++NG+ A+    + +Y V   R       IS G  +L  V L+
Sbjct: 116 KKRAGLLSTVFVLSIFLTTNGINAVFGGFDTSYHVHNTRGVVKQYFISMGVAMLL-VFLI 174

Query: 148 IMSFVFVAIPLALAYVRK--FFPAL-GNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK 204
           + S   V + L+  Y+ +  FF  L  N  L +   +I+   +      I  H    +A+
Sbjct: 175 LFS---VILWLSFEYISRMGFFETLEANRYLFLLAKKIFFIFVTYLSISILFHF--GSAE 229

Query: 205 SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFIL 264
             I     G + T + +++    F  YI  F+ Y+ +Y  + +++  L+++++     +L
Sbjct: 230 RGIRFFSAGSLLTLVLFILTTYGFGIYIENFAQYNQLYGSIGALLIFLLYIWLNSTILLL 289

Query: 265 GAELNASMI 273
           G ELNAS++
Sbjct: 290 GFELNASLL 298


>gi|300768369|ref|ZP_07078271.1| ribonuclease BN [Lactobacillus plantarum subsp. plantarum ATCC
           14917]
 gi|308180130|ref|YP_003924258.1| ribonuclease BN [Lactobacillus plantarum subsp. plantarum ST-III]
 gi|300494047|gb|EFK29213.1| ribonuclease BN [Lactobacillus plantarum subsp. plantarum ATCC
           14917]
 gi|308045621|gb|ADN98164.1| ribonuclease BN [Lactobacillus plantarum subsp. plantarum ST-III]
          Length = 309

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 126/274 (45%), Gaps = 20/274 (7%)

Query: 12  IYDAIEHFVEEDGWAMASH----ISLSALLSVFPFIVFGANL-AGF-LGAHQFVPTVIDV 65
           I  ++E  +   G A  S+    ++  AL+S+ P I+   NL A F L + Q +    +V
Sbjct: 10  ITKSLEIIIRRYGQANVSNNAIVLAYYALMSIAPIILIAGNLIARFDLKSGQILAYAQEV 69

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           +    P  + +     ++  L+  +    +I  L   + +S  + A+R SLN AY V + 
Sbjct: 70  I----PSNVYQTFKPILVSFLSSGSSSSLSIGILVTVWSASKIIAAIRRSLNEAYGVTDA 125

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYV-------RKFFPALGNLLLIIW 178
           ++   TR+I+F   L   + +V ++  F    L L  +       R   P   N LL   
Sbjct: 126 QNAVWTRIIAFFLTLGLLLLIVGLAIFFTLSQLILDVILNLTNLTRAIIPNWINQLL--- 182

Query: 179 NGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTY 238
             +   T + +F+  + ++ F+P AK K+  I  G + T I W+V +  F  YI  F+  
Sbjct: 183 ENKNLITFVGMFVVAMLLYYFVPNAKVKLRYIWTGALVTTIGWIVISQGFRVYIELFAKR 242

Query: 239 STMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
            T Y  + S++  + +L   G+  + G  +NAS+
Sbjct: 243 ITTYQTIGSLIVLMFWLNFSGILLMFGGVVNASV 276


>gi|164688039|ref|ZP_02212067.1| hypothetical protein CLOBAR_01684 [Clostridium bartlettii DSM
           16795]
 gi|164602452|gb|EDQ95917.1| hypothetical protein CLOBAR_01684 [Clostridium bartlettii DSM
           16795]
          Length = 303

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 85/180 (47%), Gaps = 24/180 (13%)

Query: 106 SNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLV-----------IMSFVFV 154
           S  V++L   +NR+Y V E RS++    IS  + ++  + ++           I  FVF 
Sbjct: 111 SKAVKSLIRGINRSYGVNENRSFFKVLFISLIFSIMLLLLILISLVLLIGGEKIGIFVFD 170

Query: 155 AIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIG-LIFVHLFLPAAKSKIMSILPG 213
            I L      K+F       + IWN   Y+  +   I  L+ ++ ++P  K K+   +PG
Sbjct: 171 LIGLD-----KYF-------IYIWNILRYSVGILFVISILVILYTYMPNTKMKVRDSVPG 218

Query: 214 VIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
            + +   W++    ++ Y+  FS Y  +Y  L  ++  + +LY+     + G+ELNA ++
Sbjct: 219 AVLSTFLWIIVTYGYSFYVNNFSNYDVIYGSLGGVIVLITWLYLSSWTILAGSELNARLL 278


>gi|296284818|ref|ZP_06862816.1| hypothetical protein CbatJ_14416 [Citromicrobium bathyomarinum
           JL354]
          Length = 260

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 105/265 (39%), Gaps = 19/265 (7%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           + D++        E++   +A+ +S  A L++ P +     L G +     V   ID + 
Sbjct: 1   MLDLLKRTWRGASEDNAGLVAAGVSYYAFLAMVPLLAVCVLLYGLVATPDAVARDIDALG 60

Query: 68  GAWPEVIAKPITDEILQVLAVP--AKGLFTISALAAAYFSS-NGVEALRISLNRAYRVVE 124
              P   A  I D++  V      AKGL    ALA A F + N   ++   LN  + V E
Sbjct: 61  RGLPPSAASLIGDQLQSVTEAKDNAKGLGLAVALAIALFGARNAARSIIGGLNVVFNVEE 120

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R +  +  I+          +V +  VF     ALA           L         +A
Sbjct: 121 DRGFLKSNAIAL---------VVTLGAVF-----ALALAGTAISLAAALPGAAAPVASFA 166

Query: 185 TM-LALFIGLIFVHLFLPAAKSKIMS-ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
            M +A  +G  F++ F P       S +LPG     + WV    LF  Y+  F+ Y+  Y
Sbjct: 167 LMFIAGMLGAGFLYRFAPNRPDPPWSAVLPGAALFALVWVGATALFGSYVANFANYNATY 226

Query: 243 AGLASIMTCLVFLYMLGVFFILGAE 267
             L +++  L + Y+     +LG E
Sbjct: 227 GSLGAVVILLTWFYLSAFVLLLGGE 251


>gi|218530643|ref|YP_002421459.1| ribonuclease BN [Methylobacterium chloromethanicum CM4]
 gi|218522946|gb|ACK83531.1| ribonuclease BN [Methylobacterium chloromethanicum CM4]
          Length = 397

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/251 (23%), Positives = 121/251 (48%), Gaps = 29/251 (11%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP----EVIAKPITDEILQVLAVPAK 91
           LL++FP I    ++ G +     +   I+ + G  P    +++A+       QV  +  K
Sbjct: 131 LLAIFPAIAALVSVYGLIADVSTINHQIEALRGVLPSGGVDIVAE-------QVKRLTEK 183

Query: 92  GLFTIS-----ALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVT 145
           G  T+       +A + +S+NG V+ +  +LN  Y   E R ++   L+S  +   A + 
Sbjct: 184 GDTTLGLTALIGIALSVWSANGGVKHVFDALNLVYNEREQRGFFKLNLVSLAFTAGALLF 243

Query: 146 LVIMSFVFVAIPLALAYVRKFFPALGN---LLLIIWNGRIYATMLALFIGLIFVHLFLPA 202
           +V+     VA+P+A+    +F    G+   L L+ W   I   ++ L + +++   + P+
Sbjct: 244 VVLALAGIVAVPVAI----QFLGLSGDAWWLALLRWP--ILFVIVILMLAVLY--RYGPS 295

Query: 203 AKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVF 261
             + +   + PG +F    W+ G++LF+ Y+  F +Y   Y  L + +  + ++++    
Sbjct: 296 RDAPRWRWVTPGGMFAAFLWLAGSLLFSWYVSNFGSYDKTYGSLGAAIGFMTWIWLSTTI 355

Query: 262 FILGAELNASM 272
            +LGA+LNA +
Sbjct: 356 VLLGAQLNAEL 366


>gi|227510013|ref|ZP_03940062.1| ribonuclease BN [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
 gi|227190508|gb|EEI70575.1| ribonuclease BN [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
          Length = 299

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/264 (20%), Positives = 124/264 (46%), Gaps = 8/264 (3%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
           I   + H+ + D    A+ ++  +L+S+FP +  G ++      H     +++ V   +P
Sbjct: 13  IQTLVSHYSQGDVSDSAAVLAFYSLMSIFPILFIGGSILNLFHIH--TGDIMEYVRPIFP 70

Query: 72  E---VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
           +   V+ +P+ D  L+          +I  +   + +S  + A + S+N+AY V E ++ 
Sbjct: 71  DRIYVMLEPVIDSTLRS---GGTSQLSIGLIVTIWSASRAIAAFQRSINKAYGVAEDQTA 127

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
              R++SF ++LL  V +V +   F       +++        +++  +   +  +TM+ 
Sbjct: 128 ISNRILSFLWMLLLIVVVVAVMIAFALSQFVFSWLSPILHIPQSIISFVSTVKWPSTMIL 187

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           +++ L  +   +P AK K   +  G +FT +  +V A  F+ Y+  F+     Y  + + 
Sbjct: 188 VWLLLSVLFYIVPTAKVKFRYVWFGALFTTLGLMVLAQAFSIYVTFFAHRVDAYKTIGTF 247

Query: 249 MTCLVFLYMLGVFFILGAELNASM 272
           +  + +L   G+  +LG  +NA++
Sbjct: 248 IVLMFWLDFSGLIMLLGGVINATI 271


>gi|332293231|ref|YP_004431840.1| ribonuclease BN [Krokinobacter diaphorus 4H-3-7-5]
 gi|332171317|gb|AEE20572.1| ribonuclease BN [Krokinobacter diaphorus 4H-3-7-5]
          Length = 315

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 120/258 (46%), Gaps = 21/258 (8%)

Query: 26  AMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP-EVIA-------KP 77
           + AS I+ S  +++FP ++F  NL  ++    F     D+ F A+  E+I        KP
Sbjct: 55  SRASSIAYSFFMAIFPALLFLLNLVPYVPIENF-----DIKFMAFIYELIPAQSLDFFKP 109

Query: 78  ITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFG 137
           I  +I Q       GL + + L A + ++NGV A+      ++     R+++    ++ G
Sbjct: 110 IIIDISQN---ERAGLASFAGLLALFLTANGVNAIFSGFEGSHYNEISRNFFRQYAVALG 166

Query: 138 YVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNL---LLIIWNGRIYATMLALFIGLI 194
             ++ ++ LV    V +   L L  +R+      ++   LL I        M+   I  +
Sbjct: 167 TSIILALLLVTTISVVIYFELLLNSLRERDFMSNDMDIALLSIGKNLFLIIMIYSVIATL 226

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
           +        KS+  S  PG + T I +++   LF  YI  F TY+ +Y  + +++  +++
Sbjct: 227 YYFGTKEGRKSRFFS--PGALMTTILFMITTYLFGIYIDNFGTYNELYGSIGALLIMMLY 284

Query: 255 LYMLGVFFILGAELNASM 272
           +++     +LG ELNA++
Sbjct: 285 IWLNSNLILLGYELNATL 302


>gi|54023610|ref|YP_117852.1| putative ribonuclease [Nocardia farcinica IFM 10152]
 gi|54015118|dbj|BAD56488.1| putative ribonuclease [Nocardia farcinica IFM 10152]
          Length = 326

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/273 (24%), Positives = 124/273 (45%), Gaps = 16/273 (5%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           + ++   +  F  ++    A+ ++  ++LSVFP I+    L   LGA    PT  D +  
Sbjct: 28  WGVLRRTVTEFRADNVTDWAAALTYYSVLSVFPGIIV---LTALLGA--LSPTATDELVT 82

Query: 69  AWPEVIAKPIT----DEILQVLAVPA-KGLFTISALAAAYFSSNG-VEALRISLNRAYRV 122
           +  E+     T    D I ++    +  G   +  +A A ++++G + A   + N  Y V
Sbjct: 83  SIREIGPGSGTQLLVDAIEELRGASSLAGPMALFGVATALWTASGYIGAFMRAANAIYEV 142

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E R  + T  +  G +  A V L+ ++ V V     +A     +  LG   + +W    
Sbjct: 143 EEGRPLWKTVPVRVG-LTAAMVVLIAVTAVGVVATGGIARRVGDWLGLGPTAVAVWEVAK 201

Query: 183 YATMLALFIGLIFVHLF--LPAAKSKIMSIL-PGVIFTWISWVVGAVLFTHYIVTFSTYS 239
           +  +LA+ + L F  L+   P A+      L PG +   + WV+ +  F  Y+  F +Y+
Sbjct: 202 W-PVLAVLVSLAFALLYWVAPNARQPGFRWLSPGSVLAVLVWVLASAGFAFYVANFGSYN 260

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
            +Y  L  +   LV++++  V  +LGAE +A +
Sbjct: 261 KVYGSLGGVAVFLVWVWISNVAVLLGAEFDAEL 293


>gi|90418703|ref|ZP_01226614.1| possible membrane protein, ribonuclease [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336783|gb|EAS50488.1| possible membrane protein, ribonuclease [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 396

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 65/255 (25%), Positives = 125/255 (49%), Gaps = 36/255 (14%)

Query: 36  LLSVFP-FIVFGANLAGF------LGAH-----QFVPTVIDVVFGAWPEVIAKPITDEIL 83
           LL++FP F VF  +L GF      +G H     QF+PT       A  E++   +   + 
Sbjct: 107 LLALFPAFAVF-VSLYGFVADPVSIGEHIAFIGQFLPT-------AGTELLESQLARLVS 158

Query: 84  QVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLAS 143
           Q  +  + G F    L A + ++NG++ L  ++N AY   E RS++   L++F + L A 
Sbjct: 159 QDSSSLSLG-FVSGLLFALWSANNGIKTLFEAMNVAYGEREQRSFFKLNLVAFCFTLGA- 216

Query: 144 VTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFV-----HL 198
              + +  V +     +  V   F  L +   I+    I A    +  GLI V     + 
Sbjct: 217 ---IFIGIVLIVTVGVVPVVMAVF-GLQSFSEIM----IAAMRWPVVFGLIVVAIAMIYR 268

Query: 199 FLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
           + P+ + ++   ++ G +   + W++ ++ F+ Y+  F+ Y+ MY  L +++  ++++++
Sbjct: 269 YGPSRRRARWKWVVSGALLAAVVWLLASLGFSWYLQNFANYNAMYGSLGAVIGFMMWVWI 328

Query: 258 LGVFFILGAELNASM 272
             + FI+GAE+NA M
Sbjct: 329 SSLIFIIGAEINAEM 343


>gi|227512948|ref|ZP_03942997.1| ribonuclease BN [Lactobacillus buchneri ATCC 11577]
 gi|227523075|ref|ZP_03953124.1| ribonuclease BN [Lactobacillus hilgardii ATCC 8290]
 gi|227083807|gb|EEI19119.1| ribonuclease BN [Lactobacillus buchneri ATCC 11577]
 gi|227089756|gb|EEI25068.1| ribonuclease BN [Lactobacillus hilgardii ATCC 8290]
          Length = 299

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/264 (20%), Positives = 124/264 (46%), Gaps = 8/264 (3%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
           I   + H+ + D    A+ ++  +L+S+FP +  G ++      H     +++ V   +P
Sbjct: 13  IQTLVSHYSQGDVSDSAAVLAFYSLMSIFPILFIGGSILNLFQIH--TGDIMEYVRPIFP 70

Query: 72  E---VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
           +   V+ +P+ D  L+          +I  +   + +S  + A + S+N+AY V E ++ 
Sbjct: 71  DRIYVMLEPVIDSTLRS---GGTSQLSIGLIVTIWSASRAIAAFQRSINKAYGVAEDQTA 127

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
              R++SF ++LL  V +V +   F       +++        +++  +   +  +TM+ 
Sbjct: 128 ISNRILSFLWMLLLIVVVVAVMIAFALSQFVFSWLSPILHIPQSIISFVSTVKWPSTMIL 187

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           +++ L  +   +P AK K   +  G +FT +  ++ A  F+ Y+  F+     Y  + + 
Sbjct: 188 VWLLLSVLFYIVPTAKVKFRYVWFGALFTTLGLMILAQAFSIYVTFFAHRVDAYKTIGTF 247

Query: 249 MTCLVFLYMLGVFFILGAELNASM 272
           +  + +L   G+  +LG  +NA++
Sbjct: 248 IVLMFWLDFSGLIMLLGGVINATI 271


>gi|254561610|ref|YP_003068705.1| ribonuclease BN family protein [Methylobacterium extorquens DM4]
 gi|254268888|emb|CAX24849.1| Ribonuclease BN family protein [Methylobacterium extorquens DM4]
          Length = 397

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/251 (23%), Positives = 121/251 (48%), Gaps = 29/251 (11%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP----EVIAKPITDEILQVLAVPAK 91
           LL++FP I    ++ G +     +   I+ + G  P    +++A+       QV  +  K
Sbjct: 131 LLAIFPAIAALVSVYGLIADVSTINHQIEALRGVLPSGGVDIVAE-------QVKRLTEK 183

Query: 92  GLFTIS-----ALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVT 145
           G  T+       +A + +S+NG V+ +  +LN  Y   E R ++   L+S  +   A + 
Sbjct: 184 GDTTLGLTALIGIALSVWSANGGVKHVFDALNLVYNEREQRGFFKLNLVSLAFTAGALLF 243

Query: 146 LVIMSFVFVAIPLALAYVRKFFPALGN---LLLIIWNGRIYATMLALFIGLIFVHLFLPA 202
           +V+     VA+P+A+    +F    G+   L L+ W   I   ++ L + +++   + P+
Sbjct: 244 VVLALAGIVAVPVAI----QFLGLSGDAWWLALLRWP--ILFVIVILMLAVLY--RYGPS 295

Query: 203 AKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVF 261
             + +   + PG +F    W+ G++LF+ Y+  F +Y   Y  L + +  + ++++    
Sbjct: 296 RDAPRWRWVTPGGMFAAFLWLAGSLLFSWYVSNFGSYDKTYGSLGAAIGFMTWIWLSTTI 355

Query: 262 FILGAELNASM 272
            +LGA+LNA +
Sbjct: 356 VLLGAQLNAEL 366


>gi|240139015|ref|YP_002963490.1| Ribonuclease BN family protein [Methylobacterium extorquens AM1]
 gi|240008987|gb|ACS40213.1| Ribonuclease BN family protein [Methylobacterium extorquens AM1]
          Length = 397

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/244 (22%), Positives = 118/244 (48%), Gaps = 15/244 (6%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAK--GL 93
           LL++FP I    ++ G +     +   I+ + G  P      + +++ ++        GL
Sbjct: 131 LLAIFPAIAALVSVYGLIADVSTINHQIEALRGVLPSGGVDIVAEQVKRLTEKGDTTLGL 190

Query: 94  FTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFV 152
             +  +A + +S+NG V+ +  +LN  Y   E R ++   L+S  +   A + +V+    
Sbjct: 191 TALIGIALSVWSANGGVKHVFDALNLVYNEREQRGFFKLNLVSLAFTAGALLFVVLALAG 250

Query: 153 FVAIPLALAYVRKFFPALGN---LLLIIWNGRIYATMLALFIGLIFVHLFLPAAKS-KIM 208
            VA+P+A+    +F    G+   L L+ W   I   ++ L + +++   + P+  + +  
Sbjct: 251 IVAVPVAI----QFLGLSGDAWWLALLRWP--ILFVIVILMLAVLY--RYGPSRDAPRWR 302

Query: 209 SILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAEL 268
            + PG +F    W+ G++LF+ Y+  F +Y   Y  L + +  + ++++     +LGA+L
Sbjct: 303 WVTPGGMFAAFLWLAGSLLFSWYVSNFGSYDKTYGSLGAAIGFMTWIWLSTTIVLLGAQL 362

Query: 269 NASM 272
           NA +
Sbjct: 363 NAEL 366


>gi|28377948|ref|NP_784840.1| integral membrane protein [Lactobacillus plantarum WCFS1]
 gi|28270782|emb|CAD63687.1| integral membrane protein [Lactobacillus plantarum WCFS1]
          Length = 306

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 126/274 (45%), Gaps = 20/274 (7%)

Query: 12  IYDAIEHFVEEDGWAMASH----ISLSALLSVFPFIVFGANL-AGF-LGAHQFVPTVIDV 65
           I  ++E  +   G A  S+    ++  AL+S+ P I+   NL A F L + Q +    +V
Sbjct: 10  IAKSLEIIIRRYGQANVSNNAIVLAYYALMSIAPIILIAGNLIARFDLKSGQILAYAQEV 69

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           +    P  + +     ++  L+  +    +I  L   + +S  + A+R SLN AY V + 
Sbjct: 70  I----PSNVYQTFKPILVSFLSSGSSSSLSIGILVTVWSASKIIAAIRRSLNEAYGVTDA 125

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYV-------RKFFPALGNLLLIIW 178
           ++   TR+I+F   L   + +V ++  F    L L  +       R   P   N LL   
Sbjct: 126 QNAVWTRIIAFFLTLGLLLLIVGLAIFFTLSQLILDVILNLTNLTRAIIPNWINQLL--- 182

Query: 179 NGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTY 238
             +   T + +F+  + ++ F+P AK K+  I  G + T I W+V +  F  YI  F+  
Sbjct: 183 ENKNLITFVGMFVVAMLLYYFVPNAKVKLRYIWTGALVTTIGWIVISQGFRVYIELFAKR 242

Query: 239 STMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
            T Y  + S++  + +L   G+  + G  +NAS+
Sbjct: 243 ITTYQTIGSLIVLMFWLNFSGILLMFGGVVNASV 276


>gi|254556183|ref|YP_003062600.1| integral membrane protein [Lactobacillus plantarum JDM1]
 gi|254045110|gb|ACT61903.1| integral membrane protein [Lactobacillus plantarum JDM1]
          Length = 309

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 126/274 (45%), Gaps = 20/274 (7%)

Query: 12  IYDAIEHFVEEDGWAMASH----ISLSALLSVFPFIVFGANL-AGF-LGAHQFVPTVIDV 65
           I  ++E  +   G A  S+    ++  AL+S+ P I+   NL A F L + Q +    +V
Sbjct: 10  IAKSLEIIIRRYGQANVSNNAIVLAYYALMSIAPIILIAGNLIARFDLKSGQILAYAQEV 69

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           +    P  + +     ++  L+  +    +I  L   + +S  + A+R SLN AY V + 
Sbjct: 70  I----PSNVYQTFKPILVSFLSSGSSSSLSIGILVTVWSASKIIAAIRRSLNEAYGVTDA 125

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYV-------RKFFPALGNLLLIIW 178
           ++   TR+I+F   L   + +V ++  F    L L  +       R   P   N LL   
Sbjct: 126 QNAVWTRIIAFFLTLGLLLLIVGLAIFFTLSQLILDVILNLTNLTRAIIPNWINQLL--- 182

Query: 179 NGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTY 238
             +   T + +F+  + ++ F+P AK K+  I  G + T I W+V +  F  YI  F+  
Sbjct: 183 ENKNLITFVGMFVVAMLLYYFVPNAKVKLRYIWTGALVTTIGWIVISQGFRVYIELFAKR 242

Query: 239 STMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
            T Y  + S++  + +L   G+  + G  +NAS+
Sbjct: 243 ITTYQTIGSLIVLMFWLNFSGILLMFGGVVNASV 276


>gi|254504096|ref|ZP_05116247.1| YihY family protein [Labrenzia alexandrii DFL-11]
 gi|222440167|gb|EEE46846.1| YihY family protein [Labrenzia alexandrii DFL-11]
          Length = 305

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 78/160 (48%), Gaps = 15/160 (9%)

Query: 119 AYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVR-----KFFPALGNL 173
           AYR  E R  +   L + G  + A +  ++    F+A+P+AL+ +      +F   L   
Sbjct: 122 AYREEEDRPVWEFHLTALGLTIAALLIGLVAVIAFLALPVALSLLPLSGSSEFIARLLRW 181

Query: 174 LLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYI 232
            L+I         +A+  GL   + F P+ + +K   +  G I   + W+ G++LFT Y+
Sbjct: 182 PLLI---------VAVITGLSITYRFAPSRRQAKARWVTVGAIAGALMWIAGSLLFTTYV 232

Query: 233 VTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
              + Y  ++  L+SI+  L++ +   V  I GAELNA +
Sbjct: 233 EKVANYEEVHGALSSIVVLLLWFWFSAVVAIFGAELNAEL 272


>gi|188581649|ref|YP_001925094.1| ribonuclease BN [Methylobacterium populi BJ001]
 gi|179345147|gb|ACB80559.1| ribonuclease BN [Methylobacterium populi BJ001]
          Length = 396

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 93/183 (50%), Gaps = 7/183 (3%)

Query: 92  GLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMS 150
           GL  +  +A + +S+NG V+ +  +LN  Y   E R ++   L+S  +   A + +VI  
Sbjct: 188 GLTALFGIALSVWSANGGVKHVFDALNLVYNEREQRGFFKLNLVSLAFTAGALLFIVIAL 247

Query: 151 FVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKS-KIMS 209
              VA+P+A+ ++     A   L L+ W     A  + + + L  ++ + P+  + +   
Sbjct: 248 AGIVAVPVAIQFLGLSSDAWW-LALLRWP----ALFVVVILMLAVLYRYGPSRDAPRWRW 302

Query: 210 ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
           + PG +F    W+ G++LF+ Y+  F +Y   Y  L + +  + ++++     +LGA+LN
Sbjct: 303 VTPGGMFAAFLWLAGSLLFSWYVSNFGSYDKTYGSLGAAIGFMTWIWLSTTIVLLGAQLN 362

Query: 270 ASM 272
           A +
Sbjct: 363 AEL 365


>gi|332308360|ref|YP_004436211.1| ribonuclease BN [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332175689|gb|AEE24943.1| ribonuclease BN [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 318

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 63/273 (23%), Positives = 120/273 (43%), Gaps = 18/273 (6%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA----HQFVPTVID 64
           +DI+   ++  ++++   +A+ +    LL++FP +    ++ G + +     Q + ++I 
Sbjct: 21  WDILRRTVKKMLDDNLSLIAAGVGFYFLLAIFPMLAAFVSVYGLVVSPDELQQHLNSLIG 80

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
           VV     E+I K I++ I+             S L A + +S G +A+  + N  Y   E
Sbjct: 81  VVPAQGREIIQKQISN-IINKSQAELSASVVFSTLFAVWSASKGAQAMVTASNITYDQRE 139

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL--LIIWNGRI 182
            R   +  ++    VL  S  LV+   +     L +   +       + L  LI W    
Sbjct: 140 KRG--LIMMLVMRVVLTLSAVLVLAGALLAIALLPILLNQIGLKEHSSFLVKLITW---- 193

Query: 183 YATMLALFIGLIFVHLFL---PAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
               LA+   L     +      + +K   + PG I   ++WV+ +V F++Y+  F  Y 
Sbjct: 194 --PFLAIVFNLALASFYRYGPHRSSAKWRWVTPGSILASVTWVMFSVGFSYYLGQFGQYD 251

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
             Y  L S++  L++ Y+     +LGAE NA+M
Sbjct: 252 KTYGSLGSVVVLLMWFYLTAFIILLGAEFNAAM 284


>gi|110677503|ref|YP_680510.1| ribonuclease BN, putative [Roseobacter denitrificans OCh 114]
 gi|109453619|gb|ABG29824.1| ribonuclease BN, putative [Roseobacter denitrificans OCh 114]
          Length = 306

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 122/257 (47%), Gaps = 23/257 (8%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGAHQFV--PTVIDVVFGAWPEVIAKPITD---- 80
           +A+ ++  ++LS+FP       LA  +     +  P V+ V      E++ + + D    
Sbjct: 29  IAAGVAFYSMLSIFP------ALAALIAVLSLIADPEVVVVQLAELQELMPEDVYDILNA 82

Query: 81  EILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFG 137
           +I+ +++  +  L     +S + A + +  GV A+   LN  Y      +W       + 
Sbjct: 83  QIVGLVSTSSDTLGWTGLVSVIVALWSARAGVGAMMHGLNVVYATDSRGTWR-----HYL 137

Query: 138 YVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA-LFIGLIFV 196
             +L +V+LV +  + + + L +A V   F ALG    +I +   +   +A +F G+  +
Sbjct: 138 RAVLLTVSLVAIGIIAL-LALVVAPVILAFLALGGFTSVIIDLLRWGVGIAVIFAGIGLL 196

Query: 197 HLFLPAAKSKIMS-ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFL 255
           + F P  +  I   + PG +F  +SW   ++ F++Y+  F  Y+ +Y  + +++  LV+L
Sbjct: 197 YRFGPNRRPAITRFVTPGSVFAAVSWAALSIAFSYYVAHFGNYNEVYGSIGAVIAMLVWL 256

Query: 256 YMLGVFFILGAELNASM 272
           ++     + GA LNA +
Sbjct: 257 WISSFLVLFGAALNAEI 273


>gi|238063813|ref|ZP_04608522.1| ribonuclease BN [Micromonospora sp. ATCC 39149]
 gi|237885624|gb|EEP74452.1| ribonuclease BN [Micromonospora sp. ATCC 39149]
          Length = 340

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 123/272 (45%), Gaps = 26/272 (9%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG-AHQFVPTVIDVVFGAWPEVIA 75
            +FV+++    A+ ++   +L++FP  +    L G +    + V TVID+      EV A
Sbjct: 53  RNFVKDNCADWAAALTYYGVLALFPSAIVVVALVGLVSDGERTVDTVIDLAR----EVGA 108

Query: 76  KPITDEILQVLAVPA--------KGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
             +      V AV          K L +   L A + +S  + A   + N  Y V E R 
Sbjct: 109 GSVVGNDGFVSAVRGVVDQQSGTKALLSFGLLGALWSASGFIGAFTRASNAIYGVQEGRP 168

Query: 128 WYITRLISFGYVLLASVTLVIMSFV----FVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
            +  R +  G   LA+VTLV+++ V     V+ P+  A V +   A G L   +W G   
Sbjct: 169 VWKLRPLQIG---LAAVTLVLLAVVATGLIVSGPVTDA-VGELVGA-GGLARTVW-GVAK 222

Query: 184 ATMLALFIGLIFVHLFLPAA---KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
             +LA+ + ++   LF  A    + +   + PG     +SW + +  F  Y+  F +Y  
Sbjct: 223 WPVLAMVMMVLLSLLFWIAPNVRQPRFRWLTPGGAVALVSWALASFGFGLYVANFGSYDV 282

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
            Y  L +++  LV+LY+     +LG ++NA +
Sbjct: 283 TYGSLGAVIAFLVWLYLSNSALMLGVQINAEL 314


>gi|163851892|ref|YP_001639935.1| ribonuclease BN [Methylobacterium extorquens PA1]
 gi|163663497|gb|ABY30864.1| ribonuclease BN [Methylobacterium extorquens PA1]
          Length = 397

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 59/251 (23%), Positives = 121/251 (48%), Gaps = 29/251 (11%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP----EVIAKPITDEILQVLAVPAK 91
           LL++FP I    ++ G +     +   I+ + G  P    +++A+       QV  +  K
Sbjct: 131 LLAIFPAIAALVSVYGLIADVSTINHQIEALRGVLPSGGVDIVAE-------QVKRLTEK 183

Query: 92  GLFTIS-----ALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVT 145
           G  T+       +A + +S+NG V+ +  +LN  Y   E R ++   L+S  +   A + 
Sbjct: 184 GDTTLGLTALIGIALSVWSANGGVKHVFDALNLVYNEREQRGFFKLNLVSLAFTAGALLF 243

Query: 146 LVIMSFVFVAIPLALAYVRKFFPALGN---LLLIIWNGRIYATMLALFIGLIFVHLFLPA 202
           +V+     VA+P+A+    +F    G+   L L+ W   I   ++ L + +++   + P+
Sbjct: 244 VVLALAGIVAVPVAI----QFLGLSGDAWWLALLRWP--ILFVIVILMLAVLY--RYGPS 295

Query: 203 AKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVF 261
             + +   + PG +F    W+ G++LF+ Y+  F +Y   Y  L + +  + ++++    
Sbjct: 296 RDAPRWRWVTPGGMFAAFLWLAGSLLFSWYVSNFGSYDKTYGSLGAAIGFMTWIWLSTTI 355

Query: 262 FILGAELNASM 272
            +LGA+LNA +
Sbjct: 356 VLLGAQLNAEL 366


>gi|77361434|ref|YP_341009.1| ribonuclease protein [Pseudoalteromonas haloplanktis TAC125]
 gi|76876345|emb|CAI87567.1| putative ribonuclease protein [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 319

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 86/175 (49%), Gaps = 19/175 (10%)

Query: 105 SSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVR 164
           SS G +AL  + N +Y+  E RS++  +L+ F + +  ++ + I + + + I        
Sbjct: 121 SSKGSQALITACNISYQEYEKRSFFKAQLVRFLFSI-GAIVVAIFALLIIGI-------- 171

Query: 165 KFFPALGNLLLIIWNGRIYATMLA-------LFIGLIFVHLFLPAAK-SKIMSILPGVIF 216
              P + NL+ +  N  +  T ++           L+ ++ + P  K +K   I  G + 
Sbjct: 172 --LPVVLNLVGLKENIDLLITFISWPLLAFTFNFALVLLYRYAPHRKPAKWRWITLGSVI 229

Query: 217 TWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNAS 271
             I W+V ++ F+ Y+  F++Y+  Y  L  ++  L++LY+     ILGA +NA+
Sbjct: 230 ATILWIVASIGFSFYVSKFASYNETYGSLGGVVIMLMWLYISAYIVILGATINAA 284


>gi|220921071|ref|YP_002496372.1| ribonuclease BN [Methylobacterium nodulans ORS 2060]
 gi|219945677|gb|ACL56069.1| ribonuclease BN [Methylobacterium nodulans ORS 2060]
          Length = 386

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 62/271 (22%), Positives = 127/271 (46%), Gaps = 12/271 (4%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D++Y     F ++   ++A+ ++   LL++FP I    +L G +     +   I ++ G 
Sbjct: 89  DVLYRVYLEFQKDRVLSVAAGVTFYTLLAMFPAIAALVSLYGLIADPATINDHIALLQGV 148

Query: 70  WPEVIAKPITDEILQVLA--VPAKGLFTISALAAAYFSSN-GVEALRISLNRAYRVVEMR 126
            P      I +++ ++ +      GL   + LA + +S+N GV+A+  +LN  Y   E R
Sbjct: 149 LPSGALDIIGEQVKRISSKGGTTLGLTFFTTLALSLWSANAGVKAIFDALNIVYEEEEKR 208

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKF----FPALGNLLLIIWNGRI 182
           S+    L S  + L   + +V+     V +P+ L ++  F     P    + L+ W    
Sbjct: 209 SFIKLNLQSLTFTLGGLLFVVVALSGIVVLPVILNFIGNFGISISPKAWYIALLRWP--- 265

Query: 183 YATMLALFIGLIFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
              +  L   L  ++ + P+  + K   + PG +   + W+VG++ F+ Y+  F +Y+  
Sbjct: 266 -LLLAILLFALALLYRYGPSRDEPKWRWVTPGSLIAGVVWLVGSIAFSWYVAHFGSYNET 324

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           Y  L + +  + ++++     +LG E+NA M
Sbjct: 325 YGSLGAAIGFMTWIWISATIVLLGGEINAEM 355


>gi|239983428|ref|ZP_04705952.1| ribonuclease BN family membrane protein [Streptomyces albus J1074]
          Length = 297

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 84/183 (45%), Gaps = 5/183 (2%)

Query: 93  LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFV 152
           L  +  LAA + +S  V A   S N  Y + E R  +    +  G   +A V + + S +
Sbjct: 84  LAVVGVLAALWSASGYVGAFIRSSNAVYDMPEGRPVWKVLPVRVG-TTVALVVMAVGSAL 142

Query: 153 FVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMS--- 209
            V     LA        +G+  L +W+   +  +L L IG+I + LF  A  +K      
Sbjct: 143 IVVFTGDLARRAGSLLGIGDTALTVWSIAKWPVLLLLVIGMIAL-LFWAAPNTKGPGFRW 201

Query: 210 ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
           + PG     + W++ +  F  Y+  F +Y+  Y  LA ++  LV+L++  +  +LG E +
Sbjct: 202 VTPGSFLALVIWLLASAGFAVYVANFGSYNKTYGALAGVVVFLVWLWISNIAILLGLEFD 261

Query: 270 ASM 272
           A +
Sbjct: 262 AEL 264


>gi|259500503|ref|ZP_05743405.1| conserved hypothetical protein [Lactobacillus iners DSM 13335]
 gi|302191192|ref|ZP_07267446.1| hypothetical protein LineA_04212 [Lactobacillus iners AB-1]
 gi|309805277|ref|ZP_07699329.1| YihY family protein [Lactobacillus iners LactinV 09V1-c]
 gi|309806429|ref|ZP_07700437.1| YihY family protein [Lactobacillus iners LactinV 03V1-b]
 gi|325912603|ref|ZP_08174986.1| YihY family protein [Lactobacillus iners UPII 60-B]
 gi|259167887|gb|EEW52382.1| conserved hypothetical protein [Lactobacillus iners DSM 13335]
 gi|308165511|gb|EFO67742.1| YihY family protein [Lactobacillus iners LactinV 09V1-c]
 gi|308167182|gb|EFO69353.1| YihY family protein [Lactobacillus iners LactinV 03V1-b]
 gi|325478024|gb|EGC81153.1| YihY family protein [Lactobacillus iners UPII 60-B]
          Length = 306

 Score = 50.1 bits (118), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 117/251 (46%), Gaps = 24/251 (9%)

Query: 36  LLSVFPFIVFGANLAGFLGAH-QFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLF 94
           L S+FP I+   N+   L  +   + T ++V+F   PE IA+ I   +  +L   + G  
Sbjct: 38  LFSIFPVIMIVGNMLPLLQINTSSIATYLNVIF---PEQIAQFILPIVKSLLHQQSNGSI 94

Query: 95  TISALAAAYFSSNGVEALRISLNRAYRVVEMRS----WY--ITRLISFGYVLLASVTLVI 148
           ++  + A +  S  V ++RI++N+ Y V E       WY  +TR +    +LL S+    
Sbjct: 95  SLGIIFALWSFSGLVNSIRIAMNKIYGVYEQEKTCPWWYYFVTRTL----MLLLSI---F 147

Query: 149 MSFVFVAIPLALAYVRKFFPALGNLL--LIIWNGRI--YATMLALFIGLIF---VHLFLP 201
           M ++F+     +A+  +    LG  L   + W  ++  Y   L + + ++F   ++  +P
Sbjct: 148 MIYIFLLAIFVVAFGNQIMNFLGVTLNFSVEWLNQLLHYRWPLIILMTILFNTYINYTIP 207

Query: 202 AAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVF 261
               K     PG IFT I W   +  F  Y+  F      Y  + + +  L++L +  + 
Sbjct: 208 NISMKSRITFPGTIFTTICWCGLSYFFGLYLHEFGIRWENYGIIGTFIIFLMWLNLAAIL 267

Query: 262 FILGAELNASM 272
           F++G  LNA++
Sbjct: 268 FLIGVCLNATI 278


>gi|282866832|ref|ZP_06275868.1| ribonuclease BN [Streptomyces sp. ACTE]
 gi|282558324|gb|EFB63890.1| ribonuclease BN [Streptomyces sp. ACTE]
          Length = 360

 Score = 50.1 bits (118), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 63/272 (23%), Positives = 123/272 (45%), Gaps = 18/272 (6%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           ++   +  F +++    A+ ++   +LS+FP ++   +L G  G       V+D +    
Sbjct: 62  VLRRTVREFADDELADRAAALTYYGVLSLFPALLVLVSLLGIAG-ESATQQVMDNLRKLA 120

Query: 71  PEVIAKPITDEILQVLAVPAKG-LFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRS- 127
           P  +   ++D + Q+      G L  +  L  A +S++G + A   S N  Y + E R  
Sbjct: 121 PGPVRDILSDAVEQLQGNGGTGSLMAVLGLVLALWSASGYIAAFIRSSNAVYDIPEGRPV 180

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAI-----PLALAYVRKFFPALGNLLLIIWNGRI 182
           W +  L      L  +VTL++++ V   I     PLA          +G+  L  W+   
Sbjct: 181 WKVLPL-----RLALTVTLMVLAVVSALIVVFTGPLAQRAGSAL--GVGDTALTAWSIAK 233

Query: 183 YATMLALFIGLI-FVHLFLPAAKSKIMS-ILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           +  ++ L   +I  ++   P A+ +    + PG     + W++ +  F  Y+  FS+Y+ 
Sbjct: 234 WPVLVLLVTVMIALLYWAAPNARGRGFKWVTPGSFLALLLWMIASAGFALYVAYFSSYNK 293

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
            Y  LA ++  LV+L++  +  +LG E +A M
Sbjct: 294 TYGALAGVIVFLVWLWITNLAILLGLEFDAEM 325


>gi|322387480|ref|ZP_08061090.1| ribonuclease BN [Streptococcus infantis ATCC 700779]
 gi|321142009|gb|EFX37504.1| ribonuclease BN [Streptococcus infantis ATCC 700779]
          Length = 287

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 120/245 (48%), Gaps = 17/245 (6%)

Query: 36  LLSVFPFIVFGANLAGF--LGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL 93
           L+S+FP ++   N+  +  +    F+ T+ + +    P+ I + +   + +VL  P+ GL
Sbjct: 38  LISIFPLLMIVVNILPYFQIPISNFLLTIKEFL----PDTIYEVVAKIVREVLTQPSTGL 93

Query: 94  FTISALAAAYFSSNGVEALRISLNRAYRVVEMRS----WYITRLISFGYVLLASVTLVIM 149
            + + L+A +  S  ++ L+ + N+AY V + R       ++ L+SFG  +L ++ L + 
Sbjct: 94  LSFAILSALWTFSKSMDFLQKAFNKAYGVAKNRGIISHQLMSLLVSFGLQILFALALFLS 153

Query: 150 SFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIM 208
            F  + + L   Y +    AL + L       IYA    LF  +I ++ FLP  K SKI 
Sbjct: 154 MFGHMLLDLLKNYWKSE-SALFSYLQDFTGPLIYAF---LFATVIMLYYFLPNVKVSKIR 209

Query: 209 SILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY--MLGVFFILGA 266
            ++PG +F  ++ +    +F  Y   +  Y       +SI+  ++  +  ++    I+GA
Sbjct: 210 YVIPGSLFVLVTTIALLNIFAAYFNNYVNYLVDVRFFSSIVVVVMMFWFIIIAKILIIGA 269

Query: 267 ELNAS 271
            LNAS
Sbjct: 270 VLNAS 274


>gi|256394381|ref|YP_003115945.1| ribonuclease BN [Catenulispora acidiphila DSM 44928]
 gi|256360607|gb|ACU74104.1| ribonuclease BN [Catenulispora acidiphila DSM 44928]
          Length = 331

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 112/246 (45%), Gaps = 9/246 (3%)

Query: 37  LSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKG-LFT 95
           L+VFP ++   ++ G LG    V TV+D V    P  +   +   I QV A    G    
Sbjct: 81  LAVFPTLLLAISVLGLLGTST-VNTVLDNVQKLAPGSVHDVLRTAITQVRASGGTGGTLA 139

Query: 96  ISALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFV 154
           I+ +  A +S++G V A   + N  Y V E R  + T  +  G  +L  VT ++ S V V
Sbjct: 140 IAGVLGALWSASGYVGAFIRASNVVYGVRENRPMWKTTPLRIGLTMLMMVTSMV-SIVIV 198

Query: 155 AIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKS----KIMSI 210
                LA        LG+    IW+  +   +L   +  + V LF  A K+    +   I
Sbjct: 199 VFTGPLADRTSQILGLGHTAFTIWS-IVKWPVLVFLVAAMIVLLFWAAPKTHGVRRFRWI 257

Query: 211 LPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNA 270
            PG +   + W+V +  F  YI  F++Y+  Y  +A ++  L++L++  +  +LG E + 
Sbjct: 258 SPGSLLAVVLWLVLSTGFATYIANFASYNKTYGTVAGVIVFLLWLWLSNLAILLGLEFDV 317

Query: 271 SMIIYY 276
            +   +
Sbjct: 318 ELTAEH 323


>gi|182416151|ref|YP_001821217.1| ribonuclease BN [Opitutus terrae PB90-1]
 gi|177843365|gb|ACB77617.1| ribonuclease BN [Opitutus terrae PB90-1]
          Length = 331

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 88/206 (42%), Gaps = 20/206 (9%)

Query: 77  PITDEILQVL--AVPAKGLFT-ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
           P+  E +Q L  A  A G+   +S L A Y S+   +AL   LN AY   E R       
Sbjct: 104 PLLREQMQRLTSAGEAAGIGALVSLLLAVYASAKATKALITGLNIAYDEEERR------- 156

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG------RIYATML 187
              G+V L +V L +     +   LAL  V       G+L      G      R    + 
Sbjct: 157 ---GFVRLQAVALALTLGAVLGAVLALGLVAVLPSVAGHLGWSDAAGTAVNWLRWPLLVG 213

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILP-GVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
              +GL  ++ F P+        L  G +     W+V ++ F+ Y+ T   Y   Y  L 
Sbjct: 214 GFMLGLGVLYRFGPSRNPPQWRWLSAGAVVATGLWIVASLGFSFYVSTLGNYEKTYGSLG 273

Query: 247 SIMTCLVFLYMLGVFFILGAELNASM 272
           +++  L++LY+ G   +LGAELNA M
Sbjct: 274 ALVVFLLWLYLTGYVVLLGAELNAEM 299


>gi|148253887|ref|YP_001238472.1| hypothetical protein BBta_2397 [Bradyrhizobium sp. BTAi1]
 gi|146406060|gb|ABQ34566.1| putative membrane protein of unknown function with ribonuclease
           domain [Bradyrhizobium sp. BTAi1]
          Length = 352

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 130/275 (47%), Gaps = 24/275 (8%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D++Y   ++  E    A+A+ ++   LL++FP +     + G       +   ++ + G 
Sbjct: 59  DVLYRVYQNITEHRIVALAAGMTFYTLLAIFPALAALVAIYGLFSDPARITGHLEQLQGL 118

Query: 70  WPEVIAKPITDEILQVLAVPAKGL---FTISALAAAYFSSNG-VEALRISLNRAYRVVEM 125
            P        D++ +V A  ++ L   F IS LA + +S+N  +++L  +LN  YR  E 
Sbjct: 119 LPGGAIDIARDQLTRVSAKGSQALGLTFGIS-LAISLWSANAAMKSLFDTLNVVYREPET 177

Query: 126 RSWY----ITRLISFGYVLLASVTL---VIMSFVFVAIPLALAYVRKFFPALGNLLLIIW 178
           R ++    I+ L + G +L A V +   V++  V  ++ L+ A          +LLL I 
Sbjct: 178 RGFFKLNAISLLFTGGAILFALVAIGAIVVVPVVLHSMGLSDA---------ADLLLRI- 227

Query: 179 NGRIYATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
            GR  A  + + +GL  ++ + P  +  K   I  G       W+ G+ LF+ Y   F +
Sbjct: 228 -GRWPAIFVCVSLGLALIYRYGPDREEPKWRWISWGSALAAALWLGGSALFSWYAANFGS 286

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           ++  Y  L + +  + ++++  +  ++G EL+A +
Sbjct: 287 FNATYGSLGAAIGFMTWIWISAIVILIGGELDAEL 321


>gi|311742300|ref|ZP_07716109.1| ribonuclease BN [Aeromicrobium marinum DSM 15272]
 gi|311313928|gb|EFQ83836.1| ribonuclease BN [Aeromicrobium marinum DSM 15272]
          Length = 295

 Score = 49.7 bits (117), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 107/229 (46%), Gaps = 35/229 (15%)

Query: 53  LGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEAL 112
           L +    P+ +D       +VIA P  DE+L+       G F + ++       +G  AL
Sbjct: 79  LASQALTPSTVD-------QVIA-PTLDEVLE------GGRFDVVSIGFVLALWSGSRAL 124

Query: 113 RI---SLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALA---YVRKF 166
            +   ++   Y +   R    TR +SFG   L +V LVI     V +PL LA    VR  
Sbjct: 125 NVFIDTITIMYGLGGRRGIVKTRALSFG---LYAVALVIG---IVLVPLVLAGPEVVRAL 178

Query: 167 FPALGNLLLIIWNGRIYATMLALFIGLI--FVHLFLPAAKSKIMSILPGVIFTWISWVVG 224
            P     +  ++    +  +L + +G +    H  +P  KS     LPG  FT + WV+G
Sbjct: 179 VPDEATFMTALY----WPAVLLMSVGFLASLYHWAVPERKSWAAG-LPGAAFTLLMWVLG 233

Query: 225 AVLFTHYIVTFSTYST-MYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           A  F  + + FS+  T +Y  LA+ +  L+ LY+L +  ++GA +NA++
Sbjct: 234 A-YFVRWALGFSSGGTSIYGPLAAPIAVLLLLYVLSISVLIGAAINAAI 281


>gi|312871837|ref|ZP_07731925.1| YihY family protein [Lactobacillus iners LEAF 3008A-a]
 gi|329920156|ref|ZP_08276987.1| YihY family protein [Lactobacillus iners SPIN 1401G]
 gi|311092779|gb|EFQ51135.1| YihY family protein [Lactobacillus iners LEAF 3008A-a]
 gi|328936610|gb|EGG33054.1| YihY family protein [Lactobacillus iners SPIN 1401G]
          Length = 306

 Score = 49.7 bits (117), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 117/251 (46%), Gaps = 24/251 (9%)

Query: 36  LLSVFPFIVFGANLAGFLGAH-QFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLF 94
           L S+FP I+   N+   L  +   + T ++V+F   PE IA+ I   +  +L   + G  
Sbjct: 38  LFSIFPVIMIVGNMLPLLQINTSSIATYLNVIF---PEQIAQFILPIVKSLLHQHSNGSI 94

Query: 95  TISALAAAYFSSNGVEALRISLNRAYRVVEMRS----WY--ITRLISFGYVLLASVTLVI 148
           ++  + A +  S  V ++RI++N+ Y V E       WY  +TR +    +LL S+    
Sbjct: 95  SLGIIFALWSFSGLVNSIRIAMNKIYGVYEQEKTCPWWYYFVTRTL----MLLLSI---F 147

Query: 149 MSFVFVAIPLALAYVRKFFPALGNLL--LIIWNGRI--YATMLALFIGLIF---VHLFLP 201
           M ++F+     +A+  +    LG  L   + W  ++  Y   L + + ++F   ++  +P
Sbjct: 148 MIYIFLLAIFVVAFGNQIMNFLGVTLNFSVEWLNQLLHYRWPLIILMTILFNTYINYTIP 207

Query: 202 AAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVF 261
               K     PG IFT I W   +  F  Y+  F      Y  + + +  L++L +  + 
Sbjct: 208 NISMKSRITFPGTIFTTICWCGLSYFFGLYLHEFGIRWENYGIIGTFIIFLMWLNLAAIL 267

Query: 262 FILGAELNASM 272
           F++G  LNA++
Sbjct: 268 FLIGVCLNATI 278


>gi|297196223|ref|ZP_06913621.1| ribonuclease BN family membrane protein [Streptomyces
           pristinaespiralis ATCC 25486]
 gi|197720035|gb|EDY63943.1| ribonuclease BN family membrane protein [Streptomyces
           pristinaespiralis ATCC 25486]
          Length = 390

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 59/267 (22%), Positives = 123/267 (46%), Gaps = 6/267 (2%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           ++   ++ F +++    A+ ++   +L++FP ++   +L G +G       V++ +    
Sbjct: 92  VLRGTLKEFKDDELTDRAAALTYYGILALFPALLVLVSLLGIMG-QSTTQKVLENIQQLA 150

Query: 71  PEVIAKPITDEILQVLAVPAKG-LFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSW 128
           P      IT+ + Q+    + G +  I  L  A +S++G V A   S N  Y V E R  
Sbjct: 151 PGPARDVITNAVTQLQGSSSTGSILAIIGLLGALWSASGYVAAFIRSSNAVYDVPEGRPA 210

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATML 187
           +    +  G V LA + +  +S + V +   +A        +G+  + +W   +    ++
Sbjct: 211 WKVLPVRLG-VTLALMIMACVSALIVILSGGIAQQLGTALGVGDTAMTVWTYAKWPVLVV 269

Query: 188 ALFIGLIFVHLFLPAAKSKIMS-ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
            + + +  ++   P AK +    I PG     + W+V +  F  Y+  F +Y+  Y  LA
Sbjct: 270 LVSVMVALLYWATPNAKVRGFKWITPGSFIAVLIWLVASAGFAFYVANFGSYNKTYGTLA 329

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMI 273
            I+  LV+L++  +  +LG E +A ++
Sbjct: 330 GIIIFLVWLWITNLAILLGLEFDAELV 356


>gi|163735479|ref|ZP_02142912.1| ribonuclease BN, putative [Roseobacter litoralis Och 149]
 gi|161391292|gb|EDQ15628.1| ribonuclease BN, putative [Roseobacter litoralis Och 149]
          Length = 302

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 121/257 (47%), Gaps = 23/257 (8%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGAHQFV--PTVIDVVFGAWPEVIAKPITD---- 80
           +A+ ++  ++LS+FP       LA  +     +  P V+ V      E++   + D    
Sbjct: 29  IAAGVAFYSMLSIFP------ALAALIAVLSLIADPEVVIVQLSELQELMPDDVYDILNA 82

Query: 81  EILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFG 137
           +I+ +++  +  L     +S L A + +  GV A+   LN  Y      +W       + 
Sbjct: 83  QIVGLVSTSSDTLGWTGIVSVLVALWSARAGVGAMMHGLNVVYATDSRGTWR-----HYL 137

Query: 138 YVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA-LFIGLIFV 196
             +L +++LV +  V + + L +A V   F ALG    +I +   +   +A +F G+  +
Sbjct: 138 RAVLLTISLVAVGIVAL-LALVIAPVILAFLALGGFTSVIIDLLRWGLGIAVIFAGIGML 196

Query: 197 HLFLPAAKSKIMSIL-PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFL 255
           + F P  + +    L PG +F  +SW   ++ F++Y+  F  Y+ +Y  + +++  LV+L
Sbjct: 197 YRFGPNRRPENTRFLTPGSVFAAVSWAALSIAFSYYVTHFGNYNEVYGSIGAVIAMLVWL 256

Query: 256 YMLGVFFILGAELNASM 272
           ++     + GA LNA +
Sbjct: 257 WISSFLVLFGAALNAEI 273


>gi|119716581|ref|YP_923546.1| ribonuclease BN [Nocardioides sp. JS614]
 gi|119537242|gb|ABL81859.1| ribonuclease BN [Nocardioides sp. JS614]
          Length = 327

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 66/265 (24%), Positives = 125/265 (47%), Gaps = 19/265 (7%)

Query: 26  AMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQV 85
            +A+  +  A+LSV P I   A   G++   QF P  +  V  A  ++ A+ +TD  +  
Sbjct: 48  GLAAEAAFFAVLSVPPLIFAMAGAIGYV-TDQFSPAQVADVRAAVVDLSARALTDGAVHK 106

Query: 86  LAVPA------KGLFTISALAAAYFSSNGVEALRI---SLNRAYRVVEMRSWYITRLISF 136
           +  P        G F + +L       +G  AL +   ++   + +   R    TR +SF
Sbjct: 107 IIEPTIDDVLRGGRFDVISLGFVLALWSGSRALNVFVDTITIMHGLGGHRGIVKTRALSF 166

Query: 137 GYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLL-IIWNGRIYATMLALFIGLIF 195
              +LA VT V+   + +A P   + V  + P   +LL+   W   +   +   F+  ++
Sbjct: 167 LLYVLAMVTGVVTIPLVIAGP---SLVEDWLPERLDLLMGFYWP--VVTVVCICFLATLY 221

Query: 196 VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYI-VTFSTYSTMYAGLASIMTCLVF 254
            H+ +P  ++     LPG  F+   WVVG+ L   ++ VT +   ++Y  LA+ +  L++
Sbjct: 222 -HVSVPV-RTNWSFNLPGATFSLFCWVVGSYLLRWFLTVTATDSRSIYGPLAAPIAVLLW 279

Query: 255 LYMLGVFFILGAELNASMIIYYWRK 279
           LY++ +  ++GA +NA+    + +K
Sbjct: 280 LYLVSIAVLIGAAVNAAFDTVFPQK 304


>gi|291455251|ref|ZP_06594641.1| membrane protein [Streptomyces albus J1074]
 gi|291358200|gb|EFE85102.1| membrane protein [Streptomyces albus J1074]
          Length = 382

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 84/183 (45%), Gaps = 5/183 (2%)

Query: 93  LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFV 152
           L  +  LAA + +S  V A   S N  Y + E R  +    +  G   +A V + + S +
Sbjct: 169 LAVVGVLAALWSASGYVGAFIRSSNAVYDMPEGRPVWKVLPVRVG-TTVALVVMAVGSAL 227

Query: 153 FVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMS--- 209
            V     LA        +G+  L +W+   +  +L L IG+I + LF  A  +K      
Sbjct: 228 IVVFTGDLARRAGSLLGIGDTALTVWSIAKWPVLLLLVIGMIAL-LFWAAPNTKGPGFRW 286

Query: 210 ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
           + PG     + W++ +  F  Y+  F +Y+  Y  LA ++  LV+L++  +  +LG E +
Sbjct: 287 VTPGSFLALVIWLLASAGFAVYVANFGSYNKTYGALAGVVVFLVWLWISNIAILLGLEFD 346

Query: 270 ASM 272
           A +
Sbjct: 347 AEL 349


>gi|300771405|ref|ZP_07081281.1| probable ribonuclease BN [Sphingobacterium spiritivorum ATCC 33861]
 gi|300762075|gb|EFK58895.1| probable ribonuclease BN [Sphingobacterium spiritivorum ATCC 33861]
          Length = 336

 Score = 49.3 bits (116), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 129/294 (43%), Gaps = 43/294 (14%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIV---------FGANLAGFLGAHQFVPT 61
           ++ + I  F+++    M++ ++   + S+ P I+         +G  L G  GA      
Sbjct: 16  LMMNVINGFLDDKCMKMSASLAYYTVFSIGPLIIIIIWCIGFFYGTQLDGPTGAR----- 70

Query: 62  VIDVVFGAWPEVIAKPITDEI---LQVLAVPAK-------GLFTISALAAAYFSSNGVEA 111
             D VF  + E+  K +  ++   +Q ++   +       G+ T+   +   F       
Sbjct: 71  --DEVFKEFSELFGKDVAVQVQSTIQKISFENRSNIGIIVGIVTLIITSTTIFVD----- 123

Query: 112 LRISLNRAYRVVEM--RSWY---ITRLISFGYVLLASVTLVIMSFVFVAIPLALA-YVRK 165
           ++ S+N  ++V     + W    I RLISF  VL     L+I S +   I +AL  Y  +
Sbjct: 124 IQDSINTIWKVKAKAKKGWLKLIINRLISFSMVLGLGF-LLIASLMINGIIVALTNYFGQ 182

Query: 166 FFPALGNLLLIIW-NGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVG 224
           +F  + +L ++ W N  I  T++    G IF   FLP AK +   IL G IFT + ++ G
Sbjct: 183 YFENI-SLPMLDWINTGITFTVITALFGFIFS--FLPDAKVRFRDILGGAIFTALLFMFG 239

Query: 225 AVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
               + YI T S  ++ Y    SI+  L ++Y        GAE    + I Y +
Sbjct: 240 RYAISLYI-TQSATASAYGAAGSIIVLLGWVYYSSAILYFGAEFTKEIAIRYGK 292


>gi|258543569|ref|YP_003189002.1| t-RNA-processing ribonuclease BN [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634647|dbj|BAI00623.1| t-RNA-processing ribonuclease BN [Acetobacter pasteurianus IFO
           3283-01]
 gi|256637703|dbj|BAI03672.1| t-RNA-processing ribonuclease BN [Acetobacter pasteurianus IFO
           3283-03]
 gi|256640757|dbj|BAI06719.1| t-RNA-processing ribonuclease BN [Acetobacter pasteurianus IFO
           3283-07]
 gi|256643812|dbj|BAI09767.1| t-RNA-processing ribonuclease BN [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646867|dbj|BAI12815.1| t-RNA-processing ribonuclease BN [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649920|dbj|BAI15861.1| t-RNA-processing ribonuclease BN [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652910|dbj|BAI18844.1| t-RNA-processing ribonuclease BN [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655964|dbj|BAI21891.1| t-RNA-processing ribonuclease BN [Acetobacter pasteurianus IFO
           3283-12]
          Length = 356

 Score = 49.3 bits (116), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 58/249 (23%), Positives = 112/249 (44%), Gaps = 13/249 (5%)

Query: 37  LSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL--- 93
           LS+FP I    ++ G     Q V   ++V+    P      + D +  ++A P   L   
Sbjct: 100 LSLFPAISSLISIYGLAFDVQTVAPQMEVLRSLLPPNAFNLLYDRVQTLVAEPPSSLTFN 159

Query: 94  FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVF 153
             IS   A + +S    ++  +LN AY   E R+++I ++ +F   L   +  V+   + 
Sbjct: 160 LIISVSVALWSASAATRSIIAALNIAYNTRENRNFFIFQITAFALTLCGILGAVLTLALM 219

Query: 154 VAIPLALAYVRKFF---PALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMS- 209
           VA+PL L          P      +  W+G +   ++  F  L    L+       I + 
Sbjct: 220 VAMPLLLNLPALLHIPTPPGSIEFMARWSGPV---VMFTFETLALSALYRFGPNRHISTQ 276

Query: 210 ---ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGA 266
              +LPG + + ++W+  ++ F++Y+   ++YS  Y  L + +  +++ ++     ++GA
Sbjct: 277 WRWVLPGAVCSTLTWIAASLGFSYYVAHIASYSATYGPLGAFIAIMMWFFVTAWVVLMGA 336

Query: 267 ELNASMIIY 275
           ELNA M  Y
Sbjct: 337 ELNAEMESY 345


>gi|84501469|ref|ZP_00999674.1| Ribonuclease BN family protein [Oceanicola batsensis HTCC2597]
 gi|84390760|gb|EAQ03248.1| Ribonuclease BN family protein [Oceanicola batsensis HTCC2597]
          Length = 315

 Score = 49.3 bits (116), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 101/242 (41%), Gaps = 10/242 (4%)

Query: 35  ALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLF 94
            LL++FP I     LAG       V   I+ +    PE  A  I D+ + V      GL 
Sbjct: 49  GLLALFPAITALMALAGLTFDASQVTAQIESISQFVPEAAADIIIDQAVAVTGSQDGGLG 108

Query: 95  TISALA---AAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSF 151
             + L    A + +S GV +L   +N AY   E R +    L   G  L     +V    
Sbjct: 109 LAAILGFALAIWAASKGVGSLMEGINIAYDETETRGFVRLTLTRLGLTLFLVFGMVAGLG 168

Query: 152 VFVAIPLALAYVRKFFPALG-NLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMS- 209
             + +P  L+ +      LG    L+I   R  A +     G+  ++   P  K    S 
Sbjct: 169 ATIVLPSILSLIN-----LGATTELLIGLARWIALLAMTVAGITVLYRVAPDRKDATWSW 223

Query: 210 ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELN 269
           ++PG +   + W+  +  F  Y+  F +Y   +  LA ++  L++L++     +LGAELN
Sbjct: 224 LVPGAVLATLLWIGASAAFAIYVQNFGSYQETFGTLAGVVILLMWLWISAYVILLGAELN 283

Query: 270 AS 271
           A 
Sbjct: 284 AE 285


>gi|188579427|ref|YP_001922872.1| ribonuclease BN [Methylobacterium populi BJ001]
 gi|179342925|gb|ACB78337.1| ribonuclease BN [Methylobacterium populi BJ001]
          Length = 367

 Score = 49.3 bits (116), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 122/251 (48%), Gaps = 11/251 (4%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVL 86
           +A+ ++  A+L++FP +    ++ G +     + T ++ + G  P+     +  ++ +++
Sbjct: 92  VAAGVTFYAILALFPAVAALVSIYGAVADPSTISTHLNELRGILPDGAIDIVGGQVKRLV 151

Query: 87  --AVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITRLISFGYVLLAS 143
                A GL  + ++  + +S+NG ++A+  +LN AY   E RS+ +  L S  +   A 
Sbjct: 152 DKGDAALGLTALVSILLSLWSANGGMKAIFDALNIAYEEEEKRSFVMLNLQSLAFTAGAL 211

Query: 144 VTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFV-HLFLPA 202
           + +V+     V +P AL  +     A    LL       +  +LAL IG + V + + P+
Sbjct: 212 LFVVLALTGIVVVPAALQVLGLDQKAWYIALLR------FPALLALVIGTLAVLYRYGPS 265

Query: 203 A-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVF 261
             K K   +  G       W+V + LF+ Y+  F +Y+  Y  L + +  + ++++    
Sbjct: 266 RRKPKWRWVTWGSAVAGTLWLVASGLFSWYVANFGSYNETYGSLGAAIGFMTWIWISTTV 325

Query: 262 FILGAELNASM 272
            +LGAELNA M
Sbjct: 326 VLLGAELNAEM 336


>gi|148259057|ref|YP_001233184.1| putative ribonuclease BN [Acidiphilium cryptum JF-5]
 gi|326402184|ref|YP_004282265.1| putative ribonuclease [Acidiphilium multivorum AIU301]
 gi|146400738|gb|ABQ29265.1| putative ribonuclease BN [Acidiphilium cryptum JF-5]
 gi|325049045|dbj|BAJ79383.1| putative ribonuclease [Acidiphilium multivorum AIU301]
          Length = 283

 Score = 49.3 bits (116), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 89/172 (51%), Gaps = 7/172 (4%)

Query: 103 YFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAY 162
           Y S++G+++L  +LN  ++  E R ++  + ++    L+A +  VI   V V +PL LA+
Sbjct: 108 YSSASGIKSLIYALNVIHKRQETRGFFEFQAVTLAMTLIAMLGAVIAIAVLVGMPLVLAF 167

Query: 163 VR-KFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPA-AKSKIMSILPGVIFTWIS 220
           +     PA+   L ++    +    + L +GL++   F PA  +     ++PG +   + 
Sbjct: 168 LGLAKAPAV---LTVLPGFALLIGSMGLALGLLY--RFGPAFGRDAGHPVVPGALVAILV 222

Query: 221 WVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           W+V +  F  Y+  F+ YS  Y  LA+I+  +++ Y+     + GA  NA++
Sbjct: 223 WLVVSYGFAVYVGQFAAYSRTYGPLATIIGLMMWFYLSAYAVLFGALFNATL 274


>gi|225870127|ref|YP_002746074.1| ribonuclease BN-like family protein [Streptococcus equi subsp. equi
           4047]
 gi|225699531|emb|CAW93105.1| ribonuclease BN-like family protein [Streptococcus equi subsp. equi
           4047]
          Length = 312

 Score = 49.3 bits (116), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 58/269 (21%), Positives = 116/269 (43%), Gaps = 15/269 (5%)

Query: 13  YDAIEHFVEEDGWAMASHISLSAL-------LSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
           Y+ I+ F+       ++ + LSA+       L+ FP IV  AN+  +L     +  ++ +
Sbjct: 16  YEPIQAFMRH---FQSAEMDLSAIAVAYYLILTAFPLIVIAANIFPYLNID--ISDLLRL 70

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           +    P+ I +  +  ++ + + P+  +  ++ L   +  S  + +L+ + N+AY   E 
Sbjct: 71  MKEQLPKDIYRSASSIVVNIFSKPSGSVLGVATLTGLWTMSRSLTSLQKAFNKAYDASEH 130

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R + +  L+     LL    L            A+  + + +    N+  +        T
Sbjct: 131 RDFLLGHLVGLLTSLLILFLLTFALIFSTFSKAAIQVLDRHYHLNDNITTLFLFLIQPIT 190

Query: 186 MLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
           +L +F+GL+ ++  LP  K  KI  ILPG  FT    +  + +  +Y+V           
Sbjct: 191 ILIIFVGLMLLYFLLPNIKIKKIRYILPGTFFTTFVMIFLSNMVGNYVVHNVERMVDIKT 250

Query: 245 LASIMTCLVFLY--MLGVFFILGAELNAS 271
             S+M  ++ L+   L    I+GA  NA+
Sbjct: 251 FGSVMIFIIMLWFIFLARILIMGAVFNAT 279


>gi|146277245|ref|YP_001167404.1| putative ribonuclease BN [Rhodobacter sphaeroides ATCC 17025]
 gi|145555486|gb|ABP70099.1| putative ribonuclease BN [Rhodobacter sphaeroides ATCC 17025]
          Length = 322

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 114/241 (47%), Gaps = 8/241 (3%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL-- 93
           LL++FP +    +L G       +   ++ + G  P    + +T ++  +    +  L  
Sbjct: 54  LLALFPTLAAFVSLYGLFADPAVIADQVESLRGVLPAEGIELVTAQLRTLAGGQSASLTV 113

Query: 94  -FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFV 152
            F IS L A + +++G++AL  ++N A+   E RS+    L+SF   L A    + +S +
Sbjct: 114 GFAISFLIAFWSANSGMKALIEAMNIAHDEREKRSFLKLTLLSFALTLGA----MTLSIL 169

Query: 153 FVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMS-IL 211
            +     +  V   F       +++W  R    +L +   +  ++ + P+ K+     + 
Sbjct: 170 MITAVAVVPAVLAIFDLGSGASVLVWLVRWPLLLLVVAGAMAALYRWAPSRKAPEWRWVT 229

Query: 212 PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNAS 271
            G     + W+V ++ FT Y+  F+ YS  Y  L +++  L+++++  +  I+GAE+N+ 
Sbjct: 230 WGSGIATVVWLVASIAFTIYLENFANYSATYGSLGALVGLLLWIWIAVMILIIGAEINSE 289

Query: 272 M 272
           M
Sbjct: 290 M 290


>gi|116334154|ref|YP_795681.1| ribonuclease BN-like family protein [Lactobacillus brevis ATCC 367]
 gi|116099501|gb|ABJ64650.1| Ribonuclease BN-like family enzyme [Lactobacillus brevis ATCC 367]
          Length = 303

 Score = 48.9 bits (115), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 112/237 (47%), Gaps = 2/237 (0%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           LLS+FP ++  A+L  +L       TV++ +    PE I   +   I   L   + G+ +
Sbjct: 40  LLSLFPALLVIASLLPYLNIQ--TETVLESIEPMVPESIFSMLKPIIHSFLNTRSGGVLS 97

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
           I  + A + SS  V A + ++N AY V + ++  + R+++F +++     L ++   F  
Sbjct: 98  IGVIVALWSSSRAVAAFQRTVNGAYGVAKNQNALVNRIVAFFWMVALIAFLFVLMLFFSF 157

Query: 156 IPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVI 215
             + L  +  +      ++  I   +   T L + + L+ +  F+P+AK K   + PG +
Sbjct: 158 GQIILEQLAPYLHVPHEIIGYINAAKWPVTFLVVLLVLMILLYFVPSAKLKWRFVWPGAL 217

Query: 216 FTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
              + W++ +  F+ Y+  F      Y  + + +  + +L   G+  + GA LNA++
Sbjct: 218 TATVGWLLLSQAFSLYVKYFVHNMDSYRTIGTFIVLMFWLDFTGLILMFGAVLNAAI 274


>gi|319949392|ref|ZP_08023458.1| ribonuclease BN [Dietzia cinnamea P4]
 gi|319436939|gb|EFV91993.1| ribonuclease BN [Dietzia cinnamea P4]
          Length = 341

 Score = 48.9 bits (115), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 61/263 (23%), Positives = 122/263 (46%), Gaps = 23/263 (8%)

Query: 24  GWAMASHISLSALLSVFPFIVFGANLAGFLG-AHQFVPTVIDVVFGAWPEVIAKPITDEI 82
           G  +A  ++   +LS+FP ++   +L G  G   + V  V+D++    P  +  P+   +
Sbjct: 2   GPDLAGSLTYYGVLSLFPAVLVVVSLLGVFGQGSRTVDAVMDMLSDVAPPEVLDPVRGPV 61

Query: 83  LQVLAVPAKGLFTISALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITRLISFGYVLL 141
             ++  PA G   I   A A +S++  V AL  ++N  + + E R  +  RL+  G  L 
Sbjct: 62  EALVTTPAAGTALIVGTAVALWSASRYVRALGRAMNAMFGIEEGRPPW--RLLPAGLALT 119

Query: 142 A-SVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN-GRIYATMLALFIGLIFVHLF 199
           A  + LV +  V +A    +A     +  LG+  L +W   +  A ++A+ + L  ++ F
Sbjct: 120 ALLIVLVAVGGVALAFSGPVAETVGDWIGLGDTALAVWGVAKWPAAVIAVILALAILYRF 179

Query: 200 LPAAKSKIMSILPGVIFTWISWVVGAVL---------FTHYIVTFSTYSTMYAGLASIMT 250
            P         + G  F+W+S    A L          + ++  F  ++ +Y  LA ++ 
Sbjct: 180 APN--------ISGRRFSWVSLGAAAALAIMGVATAGLSFFVSNFGNFNRVYGSLAGVIV 231

Query: 251 CLVFLYMLGVFFILGAELNASMI 273
            L++L+++ +  + G  L+A ++
Sbjct: 232 FLLWLWLVNMAVVFGVRLDAEVL 254


>gi|84684451|ref|ZP_01012352.1| putative ribonuclease protein [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84667430|gb|EAQ13899.1| putative ribonuclease protein [Rhodobacterales bacterium HTCC2654]
          Length = 316

 Score = 48.9 bits (115), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 69/267 (25%), Positives = 113/267 (42%), Gaps = 18/267 (6%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVL 86
           +A+ ++  ALLS+FP I     +AG       +   +       P+  A  I D+   V 
Sbjct: 38  IAAGVAFFALLSLFPAITATIAVAGLFFDPAEITDPLQEFAAVLPDGAASIILDQATSVT 97

Query: 87  AVPAKGLFTISALAAA---YFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLAS 143
                GL   + L      Y +S GVE L + LN AY   + R     +L  F   +   
Sbjct: 98  GSDESGLGLAAILGLLLALYSASKGVENLMVGLNVAYAEKDERGLIRAKLTVFALTVFLV 157

Query: 144 VTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFL--P 201
           + ++    V V +P+ L       P LG ++  +     +  +L   IG  F  LF   P
Sbjct: 158 IGVIFSLGVMVVLPIVL----NVLP-LGGVVETVVRIVPWLVLLIFTIG-AFSILFRYGP 211

Query: 202 AAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGV 260
             +S + + ILPG +   + W   +V F+ Y   F +Y   +  LA  +  L++L++  +
Sbjct: 212 DRRSARWVYILPGAVLACLLWGAASVGFSIYADNFGSYQESFGTLAGAIVLLMWLWISAL 271

Query: 261 FFILGAELNAS------MIIYYWRKKP 281
             +LGA+LNA       M     R +P
Sbjct: 272 VVLLGAKLNAEIEAQHLMDTTVGRDRP 298


>gi|256820860|ref|YP_003142139.1| ribonuclease BN [Capnocytophaga ochracea DSM 7271]
 gi|256582443|gb|ACU93578.1| ribonuclease BN [Capnocytophaga ochracea DSM 7271]
          Length = 303

 Score = 48.9 bits (115), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 114/254 (44%), Gaps = 16/254 (6%)

Query: 28  ASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLA 87
           AS IS S  L++FPF++F  NL  ++    F       +    P       +D    +  
Sbjct: 52  ASAISYSFFLAIFPFLLFILNLIPYIPIENFQGDFWAFIEDMLPPGTHDFFSDIFFDIAD 111

Query: 88  VPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLV 147
               GL +     + +  +NG+ A+      +Y     R+ YI + +   Y L+ ++ L 
Sbjct: 112 KKRGGLLSSVFFLSIFLMTNGIMAIFGGFEYSYHRQITRT-YIKQYL---YALMVAIILA 167

Query: 148 IMSFVFVAIPLALAYVRKFFPALGNL-------LLIIWNGRIYATMLALF-IGLIFVHLF 199
           ++  V  A+ + + Y     P L  +        L+  +  ++  ++  F  GL+F    
Sbjct: 168 LL--VLFAVIVFIYYEVYLVPYLDKINFITDYETLLKISKIVFVALITYFGTGLLFYFGT 225

Query: 200 LPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLG 259
           +   +SK  S   G +FT + + V   LF  YI  FS Y+ +Y  + +++  L+++++  
Sbjct: 226 VEGRESKFFS--AGSLFTVLLFGVTTYLFGIYIENFSRYNQLYGSIGALLIFLLYIWLNA 283

Query: 260 VFFILGAELNASMI 273
              +LG ELNAS++
Sbjct: 284 NILLLGFELNASLL 297


>gi|225873491|ref|YP_002754950.1| YihY family protein [Acidobacterium capsulatum ATCC 51196]
 gi|225791248|gb|ACO31338.1| YihY family protein [Acidobacterium capsulatum ATCC 51196]
          Length = 316

 Score = 48.9 bits (115), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 97/211 (45%), Gaps = 19/211 (9%)

Query: 74  IAKPITDEILQVLAVPAKGL---FTISALAAAYFSSNGVE-ALRISLNRAYRVVEMR-SW 128
           I  P T  ++Q    P KG      + A   ++F++ G+  AL   L RA R+     ++
Sbjct: 63  ILPPDTMLLVQAYFQPGKGRSAHLVLIAFGISFFAAMGLMLALMEGLRRAERLPRSAWNF 122

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL----LIIWNGRIYA 184
           +  R+++   VLL + TLV M F  + I            + G+ L    L+ W  R+  
Sbjct: 123 WWQRVVA---VLLVAGTLVPMFFATLLITFGHFIEHWIVDSAGHELRFYVLLFW--RVIR 177

Query: 185 TMLALFIGLIFV----HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
             +A+   ++ +    H  +P  +      LPG +   ++W V  +LF  Y+  FS Y  
Sbjct: 178 WGIAVVTSVVMLAMIYHFGVPR-RRHWKHALPGAMMATVTWFVSTLLFGWYVTRFSHYQV 236

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNAS 271
           +Y  L + M  +V+LY++ +  + GAE NA 
Sbjct: 237 VYGSLGAGMATMVWLYIVSLSILFGAEFNAE 267


>gi|329113280|ref|ZP_08242063.1| Putative ribonuclease-like protein YfkH [Acetobacter pomorum DM001]
 gi|326697421|gb|EGE49079.1| Putative ribonuclease-like protein YfkH [Acetobacter pomorum DM001]
          Length = 356

 Score = 48.9 bits (115), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 58/249 (23%), Positives = 112/249 (44%), Gaps = 13/249 (5%)

Query: 37  LSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL--- 93
           LS+FP I    ++ G     Q V   ++V+    P      + D +  ++A P   L   
Sbjct: 100 LSLFPAISSLISIYGLAFDVQTVAPQMEVLRNLLPPNAFTLLYDRVQTLVAEPPSSLTFN 159

Query: 94  FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVF 153
             IS   A + +S    ++  +LN AY   E R+++I ++ +F   L   +  V+   + 
Sbjct: 160 LIISVSVALWSASAATRSIISALNIAYNTRENRNFFIFQITAFALTLCGILGAVLTLALM 219

Query: 154 VAIPLALAYVRKFF---PALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMS- 209
           VA+PL L          P      +  W+G +   ++  F  L    L+       I + 
Sbjct: 220 VAMPLLLNLPALLHIPTPPGSIEFMARWSGPV---VMFTFETLALSALYRFGPNRHISTQ 276

Query: 210 ---ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGA 266
              +LPG + + ++W+  ++ F++Y+   ++YS  Y  L + +  +++ ++     ++GA
Sbjct: 277 WRWVLPGAVCSTLTWIAASLGFSYYVAHIASYSATYGPLGAFIAIMMWFFVTAWVVLMGA 336

Query: 267 ELNASMIIY 275
           ELNA M  Y
Sbjct: 337 ELNAEMESY 345


>gi|24379941|ref|NP_721896.1| hypothetical protein SMU.1555c [Streptococcus mutans UA159]
 gi|290580080|ref|YP_003484472.1| hypothetical protein SmuNN2025_0554 [Streptococcus mutans NN2025]
 gi|24377923|gb|AAN59202.1|AE014987_1 conserved hypothetical protein [Streptococcus mutans UA159]
 gi|254996979|dbj|BAH87580.1| hypothetical protein [Streptococcus mutans NN2025]
          Length = 310

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 121/279 (43%), Gaps = 20/279 (7%)

Query: 16  IEHFVEEDGWAMASHISLSAL-------LSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           +++F+E   +  +S + LS++       L++FPF++  ANL  +L  H     ++  +  
Sbjct: 14  VQNFLE---YYKSSEMDLSSIAVAYYLILTIFPFLILLANLFPYL--HIDTSELLSFMKN 68

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
             PE + +  +  +  +   P+  L  ++ +   +  S  +  L+ S+N++Y +   R  
Sbjct: 69  NLPEQLYENTSGIVRGIFNKPSTSLLWLAIVTGLWTMSKSLTFLQKSMNKSYGIQNHRDL 128

Query: 129 YITRLISFGYVLLAS--VTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            +  ++     LL    + L IM   F    L   Y   F     +L  I+ N     T 
Sbjct: 129 ILGHIVGIFSSLLVIFFLALAIMLSTFGKTVLTFLYHNSFLNQ--DLYDILMNLTQPVTA 186

Query: 187 LALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYI--VTFSTYSTMYA 243
              F+ L  ++  LP  +  KI  ILPG IFT   +     LF  YI   T S  +    
Sbjct: 187 AIFFVALGVLYYILPNVRIKKIRYILPGTIFTSFLFFTMTSLFGTYINYATASMENLRVF 246

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK-KP 281
           G  ++   +++  +     ILGA LNAS    Y ++ KP
Sbjct: 247 GSVTLFVLMLWFIVFARILILGAVLNASYQKKYVKEFKP 285


>gi|332531931|ref|ZP_08407815.1| ribonuclease BN [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038558|gb|EGI75001.1| ribonuclease BN [Pseudoalteromonas haloplanktis ANT/505]
          Length = 317

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/276 (23%), Positives = 125/276 (45%), Gaps = 26/276 (9%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           +DI+    +   E++   +A+ ++  ALL++FP I    ++  +  +   +   +  +  
Sbjct: 22  WDIVKRIFKQMSEDNLSIVAAGVAFYALLAIFPAIAAMVSVYAYFSSPADISDHLSKIVT 81

Query: 69  AWPEVIAKPITDE-ILQVLAVPAKGLFTI-------SALAAAYFSSNGVEALRISLNRAY 120
             P     P T E IL  ++  AK            + +   + SS G +AL  + N +Y
Sbjct: 82  LLP-----PSTSELILSQVSSLAKTSSASLSLSAIGTLILTIWSSSKGSQALITACNISY 136

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALGNLLLIIW 178
           R  E RS++  +L+ F + + A V  +    +   +P+ L  V  ++    L  + LI W
Sbjct: 137 REYEKRSFFQAQLVRFLFSVGAIVVAIFALLIIGILPIVLNLVGLKESIDLL--IKLISW 194

Query: 179 NGRIYATMLALFIG--LIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTF 235
                  +LA      L+ ++ + P  K +K   I  G     + W++ ++ F+ Y+  F
Sbjct: 195 ------PLLAFTFNFALVLLYRYAPHRKPAKWRWITMGSSIATVLWILASIGFSFYVSRF 248

Query: 236 STYSTMYAGLASIMTCLVFLYMLGVFFILGAELNAS 271
           S+Y+  Y  L  ++  L++LY+      LGA +NA+
Sbjct: 249 SSYNETYGSLGGVVIMLMWLYISAYIITLGAVINAA 284


>gi|163794700|ref|ZP_02188670.1| putative ribonuclease protein [alpha proteobacterium BAL199]
 gi|159179973|gb|EDP64498.1| putative ribonuclease protein [alpha proteobacterium BAL199]
          Length = 297

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 83/189 (43%), Gaps = 13/189 (6%)

Query: 101 AAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLAL 160
           A + S+ G  AL  +++ AY       W   R+ +  + L A +   +++   +A   A 
Sbjct: 94  AIWSSAKGATALLSAMDIAYNETHRSGWIRPRITALAFTL-AGLVFAVLAIGLLAAVPAA 152

Query: 161 AYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWI 219
             +  F   + N+LL     R       + + L  ++ + P  +S + + I PG I   +
Sbjct: 153 VALLAFRDTVSNMLL---GARWLLLAGVVLVALGLLYRYGPNRRSARTVWITPGSILATV 209

Query: 220 SWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY---- 275
            W+  +  F  Y+    TY+  +  L +++  L++LY+      +GAELNA + ++    
Sbjct: 210 LWLAASWGFGRYVANVGTYNETFGALGAVVVLLMWLYISAYIVCIGAELNAELELHTSAD 269

Query: 276 ----YWRKK 280
                WR K
Sbjct: 270 TTTGRWRPK 278


>gi|260102705|ref|ZP_05752942.1| conserved hypothetical protein [Lactobacillus helveticus DSM 20075]
 gi|260083491|gb|EEW67611.1| conserved hypothetical protein [Lactobacillus helveticus DSM 20075]
          Length = 307

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 100/213 (46%), Gaps = 12/213 (5%)

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV--VEMRS 127
           +P+ ++  I   I  +L   + G  +   + A +  SN V A+R+  NR Y V  VE++ 
Sbjct: 72  FPDQVSSFIMPIINSLLKTTSTGYISFGIILAIWSFSNLVNAIRLGENRLYGVHQVELK- 130

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLI-------IWNG 180
             ++ L S    L+  +   +M  +F A+ + LA+ ++    +  +  I       I++ 
Sbjct: 131 --LSMLNSLWTRLIMVIFTTLMIIIFTAVGVVLAFGQELLDLMDAIFKIPVHEVGKIFSY 188

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R     L + + + +++  LP  K K   I PGV  T   W+  + LF+ Y+  F     
Sbjct: 189 RYPVIFLIIILAVFYLNYVLPNIKLKKRVIWPGVFVTSCGWIALSFLFSFYLHNFPITWK 248

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
            Y  + + +  +++L +  + F+ G  +NA++I
Sbjct: 249 NYGIVGTFIIFMLWLNIASLLFLFGVAVNATII 281


>gi|163850307|ref|YP_001638350.1| ribonuclease BN [Methylobacterium extorquens PA1]
 gi|240137378|ref|YP_002961849.1| Ribonuclease BN [Methylobacterium extorquens AM1]
 gi|163661912|gb|ABY29279.1| ribonuclease BN [Methylobacterium extorquens PA1]
 gi|240007346|gb|ACS38572.1| Ribonuclease BN [Methylobacterium extorquens AM1]
          Length = 388

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/275 (21%), Positives = 130/275 (47%), Gaps = 23/275 (8%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           +DI       F ++   ++A+ ++   LLS+FP I       G +     +   +  + G
Sbjct: 95  WDIATRVYLEFNKDRVLSVAAGVTFYTLLSLFPAIAALVTCYGLVADVNTINVHLSTLHG 154

Query: 69  AWPEVIAKPITDEILQVLAVPAKGL-FTI-SALAAAYFSSNG-VEALRISLNRAYRVVEM 125
             PE   + I +++ ++    +  L FT  ++L  + +S+N  ++A+  +LN  Y   E 
Sbjct: 155 VLPESAIEIIGEQVKRIATKGSGALGFTFFTSLTLSLWSANAAMKAMFDALNVVYEEEEK 214

Query: 126 RS--WYITRLISFG-----YVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIW 178
           R+  W   R ++F      +++LA +++V++  VF             F  LG+   +I 
Sbjct: 215 RNFFWLNVRSLTFTAGALLFIILALISIVVLPVVF------------NFLGLGDGARLIA 262

Query: 179 NGRIYATMLALFIGLIFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
             R    +L L  GL  ++ + P+  +++   +  G +   + W++ ++LF+ Y+  F  
Sbjct: 263 MARWPVLLLVLLGGLAVLYRYGPSRERARWRWVGAGSVVAGVLWLIASILFSWYVANFGN 322

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           Y+  Y  L +++  + ++++     +LG E+NA +
Sbjct: 323 YNETYGSLGAVIGFMTWIWISATIVLLGGEINAEI 357


>gi|325285231|ref|YP_004261021.1| ribonuclease BN [Cellulophaga lytica DSM 7489]
 gi|324320685|gb|ADY28150.1| ribonuclease BN [Cellulophaga lytica DSM 7489]
          Length = 328

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/267 (22%), Positives = 121/267 (45%), Gaps = 28/267 (10%)

Query: 28  ASHISLSALLSVFPFIVFGANLAGFLGAHQFVP--------TVIDVVFGAW-----PEVI 74
           AS I+ S  +++FP ++F   L  FL     +P        T ++  F A+     P  I
Sbjct: 55  ASAIAFSLFMALFPLLIFLVTLIPFL-----IPYVDSGNPDTNLNTEFIAYLEYVLPNAI 109

Query: 75  AKPITDEIL-QVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
                D+I  ++++    GL + + + + +  +NGV A+      +Y V   R +    L
Sbjct: 110 NDYFFDQIYDEIMSQKRGGLLSSTFVLSIFLIANGVNAIFSGFENSYHVSLNRHFLRQYL 169

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPL----ALAYVRKFFPALGNLLLIIWNGRI----YAT 185
            +    LL S+ +++ + V++   +     ++   + +   G     IW   I    Y T
Sbjct: 170 YALMVGLLLSILIIVSAIVYMYFEIYVIENISDTTQVYFGTGLEETDIWTTEIAKVVYFT 229

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
            L+ ++ +  ++ F  A   K      G + T I +V+ + LF  Y+  F+ Y+ +Y  L
Sbjct: 230 FLS-YLSISILYYFGTAEGKKTKFFSSGSLMTTILFVLTSYLFGVYVDKFARYNELYGAL 288

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASM 272
             ++  +V++++     +LG ELNA++
Sbjct: 289 GGLLILMVYIWLNANILLLGFELNATL 315


>gi|302532125|ref|ZP_07284467.1| ribonuclease BN family membrane protein [Streptomyces sp. C]
 gi|302441020|gb|EFL12836.1| ribonuclease BN family membrane protein [Streptomyces sp. C]
          Length = 343

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 56/107 (52%), Gaps = 2/107 (1%)

Query: 169 ALGNLLLIIWNGRIYATMLALFIGLI-FVHLFLPAAKSKIMS-ILPGVIFTWISWVVGAV 226
            +G+  + +W+   +  +L L  G+I  ++   P AK +    + PG +   + W+V + 
Sbjct: 203 GVGDTAMTVWSIAKWPVLLVLVTGMIALLYWAAPNAKGRGFRWVTPGSLLALVIWMVASA 262

Query: 227 LFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
            F  Y+  F +Y+  Y  LA ++  LV+L++  +  +LG E +A ++
Sbjct: 263 GFAFYVANFGSYNKTYGTLAGVIIFLVWLWITNLAVLLGLEFDAELV 309


>gi|290961371|ref|YP_003492553.1| hypothetical protein SCAB_70211 [Streptomyces scabiei 87.22]
 gi|260650897|emb|CBG74014.1| putative membrane protein, ribonuclease-like [Streptomyces scabiei
           87.22]
          Length = 365

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 63/268 (23%), Positives = 120/268 (44%), Gaps = 10/268 (3%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           ++    + F +++    A+ ++   +LS+FP I+   ++ G +G  +    ++D +    
Sbjct: 49  VVRRTAKEFQDDELSDRAAALTYYGVLSLFPAILVLVSMLGVVG-QRATDRILDNIGDLA 107

Query: 71  PEVIAKPITDEILQVLAVPAKG-LFTISALAAAYFSSNG-VEALRISLNRAYRVVEMR-S 127
           P      + D ++Q+      G L  I  L AA +S++G V A   + N  Y + E R +
Sbjct: 108 PGPARDILRDAVVQLSDSGGTGGLLAIVGLLAAVWSASGYVAAFIRTSNAVYDLPEGRPA 167

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFV-AIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           W +T L   G  L+  V L   + + V   PLA          LG   + +WN   +  +
Sbjct: 168 WKVTPL-RIGLTLVLMVMLAASALIVVFTGPLAERAGTTI--GLGGAAIAVWNIAKWPVL 224

Query: 187 LALFIGLI-FVHLFLPAAKSKIMS-ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
           L L   +I  ++   P  + +    + PG I   + W+  +  F  Y   F +Y+  Y  
Sbjct: 225 LVLVTLMIALLYWAAPNVRGRGFRWVSPGGIVATLIWLAASAGFAVYAANFGSYNKTYGT 284

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASM 272
           LA  +  L++L++  +  +LG E +A +
Sbjct: 285 LAGAVVFLIWLWLTNLAILLGLEFDAEL 312


>gi|315224046|ref|ZP_07865887.1| YihY family protein [Capnocytophaga ochracea F0287]
 gi|314946017|gb|EFS98025.1| YihY family protein [Capnocytophaga ochracea F0287]
          Length = 303

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 114/254 (44%), Gaps = 16/254 (6%)

Query: 28  ASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLA 87
           AS IS S  L++FPF++F  NL  ++    F       +    P       +D    +  
Sbjct: 52  ASAISYSFFLAIFPFLLFILNLIPYIPIENFQGDFWAFIEDMLPPGTHDFFSDIFFDIAD 111

Query: 88  VPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLV 147
               GL +     + +  +NG+ A+      +Y     R+ YI + +   Y L+ ++ L 
Sbjct: 112 KKRGGLLSSVFFLSIFLMTNGIMAIFGGFEYSYHRQITRT-YIKQYL---YALMVAIILA 167

Query: 148 IMSFVFVAIPLALAYVRKFFPALGNL-------LLIIWNGRIYATMLALF-IGLIFVHLF 199
           ++  V  A+ + + Y     P L  +        L+  +  ++  ++  F  GL+F    
Sbjct: 168 LL--VLFAVVVFIYYEVYLVPYLDKINFITDYETLLKISKIVFVALITYFGTGLLFYFGT 225

Query: 200 LPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLG 259
           +   +SK  S   G +FT + + +   LF  YI  FS Y+ +Y  + +++  L+++++  
Sbjct: 226 VEGKESKFFS--AGSLFTVLLFGLTTYLFGIYIENFSRYNQLYGSIGALLIFLLYIWLNA 283

Query: 260 VFFILGAELNASMI 273
              +LG ELNAS++
Sbjct: 284 NILLLGFELNASLL 297


>gi|120434656|ref|YP_860345.1| ribonuclease BN [Gramella forsetii KT0803]
 gi|117576806|emb|CAL65275.1| ribonuclease BN [Gramella forsetii KT0803]
          Length = 338

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 94/206 (45%), Gaps = 8/206 (3%)

Query: 71  PEVIAKPITDEILQVLAVPAKGL---FTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
           PE     ITD +  V+    K +     +S L + + ++ G  AL   +N AY   + R 
Sbjct: 103 PEQAYGMITDILNPVINQDRKEIGWGLLVSILVSIWSANKGTSALFQGVNIAYDETDNRG 162

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
                L++  + L   V  +I   + +  PL +  +    P L ++L   W   ++  ++
Sbjct: 163 LIKKNLLTLLFTLAGVVIGLISLLIVIFFPLLVKNI-GLTPGLEDML--TWLRWVFLGII 219

Query: 188 ALFIGLIFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
            L   L  V+   P  ++ K   +  G I   I W+ G++ F+ Y+  F +Y  +Y   A
Sbjct: 220 -LISTLSMVYKIAPNRSRPKFRWVSWGAILGTIFWLAGSMGFSWYVGNFGSYDDLYGSFA 278

Query: 247 SIMTCLVFLYMLGVFFILGAELNASM 272
           ++   +++L++     ++GAE+N+ M
Sbjct: 279 AVAILMLWLFLTAFIVLMGAEINSEM 304


>gi|241896536|ref|ZP_04783832.1| ribonuclease BN [Weissella paramesenteroides ATCC 33313]
 gi|241870258|gb|EER74009.1| ribonuclease BN [Weissella paramesenteroides ATCC 33313]
          Length = 295

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 114/240 (47%), Gaps = 8/240 (3%)

Query: 36  LLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT 95
           LLS+FP ++  A+L  +L       TV++ +    PE I   +   I   L   + G+ +
Sbjct: 40  LLSLFPALLVIASLLPYLNIQ--TETVLESIEPMVPESIFSMLKPSIHSFLNTRSGGVLS 97

Query: 96  ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA 155
           I  + A + SS  V A + ++N AY V + ++  + R+++F +++     L ++   F  
Sbjct: 98  IGVIVALWSSSRAVAAFQRTVNGAYGVAKNQNALVNRIVAFFWMVALITFLFVLMLFFSL 157

Query: 156 IPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVI 215
             + L  +  +      ++  I   +   T L + + L+ +  F+P+AK K   + PG +
Sbjct: 158 GQIILEQLAPYLHVPHEIIGYINAAKWPVTFLVVLLVLMILLYFVPSAKLKWRFVWPGAL 217

Query: 216 FTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS---IMTCLVFLYMLGVFFILGAELNASM 272
              + W++ +  F+ Y+  F      Y  + +   +M CL F  ++ +F   GA LNA++
Sbjct: 218 TATVGWLLLSQAFSLYVKYFMHNMDSYRTIGTFIVLMFCLDFTELILMF---GAVLNAAI 274


>gi|209964739|ref|YP_002297654.1| ribonuclease BN family protein [Rhodospirillum centenum SW]
 gi|209958205|gb|ACI98841.1| ribonuclease BN family protein [Rhodospirillum centenum SW]
          Length = 327

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/270 (22%), Positives = 122/270 (45%), Gaps = 12/270 (4%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           + I+   +     ++ W +A+ ++   LL++FP +    +L G +   Q V   +  +  
Sbjct: 35  WSILKRTLAESSRDNVWVVAAGVAFLTLLAIFPALTATFSLYGLVADPQQVEEQVAALAS 94

Query: 69  AWPEVIAKPITDEILQVLAVPAKGL---FTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
             P    + +  ++  +     + L     I    A + +S GV+AL  +LN  Y   E 
Sbjct: 95  VLPAQGREVLVGQLHALAGQSGEALGFGLVIGLGIALWSASGGVKALMSALNIVYEEEEK 154

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           RS+      +    L   + L+ +  V +A P+ L ++     A   + L+ W       
Sbjct: 155 RSFLHFTGTALALTLGFILLLIFLIAVVIATPVVLGFLGLGGTADVLVRLLRW------P 208

Query: 186 MLALFIG--LIFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
           +LA  I   L  ++ + P+ A+++   +  G     + W+VG++ F+ YI  F+ Y+  Y
Sbjct: 209 LLACGIAGALAVLYRYGPSRARARWRWVSWGSAAATLLWIVGSIAFSLYITHFADYNATY 268

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASM 272
             L + +  L++LY+     +LGAEL+A M
Sbjct: 269 GSLGAGIILLLWLYLGAYAVLLGAELDAEM 298


>gi|13488510|ref|NP_109517.1| hypothetical protein mll9669 [Mesorhizobium loti MAFF303099]
 gi|14028264|dbj|BAB54856.1| mll9669 [Mesorhizobium loti MAFF303099]
          Length = 356

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 93/195 (47%), Gaps = 9/195 (4%)

Query: 83  LQVLAVPAKGLFTIS---ALAAAYFSSN-GVEALRISLNRAYRVVEMRSWYITRLISFGY 138
           LQ LA    G   I     L  A +SSN G++AL  ++N AY   E RS     L+S  +
Sbjct: 134 LQALASQKPGALGIGFFIGLGIALWSSNSGMKALFDAMNIAYEEREKRSIIALNLMSILF 193

Query: 139 VLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHL 198
            + A +  +++      +P  L Y   +  A    L+ +   R    + A+  G+  ++ 
Sbjct: 194 TVGALLIGILLLLTVGVVPALLRYF--YLDAWTETLVAV--SRWPILVGAMLTGISLLYR 249

Query: 199 FLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
           F P+  ++K   +  G +   ++W+  + LF+ Y+  F+ Y+  Y  L +++  +++ ++
Sbjct: 250 FGPSRERAKWRWLSWGSLIATVAWIAASWLFSFYLQHFANYNATYGSLGAVVGLMMWTWI 309

Query: 258 LGVFFILGAELNASM 272
             +  I GA +NA M
Sbjct: 310 SVIILIAGAAINAEM 324


>gi|170748550|ref|YP_001754810.1| ribonuclease BN [Methylobacterium radiotolerans JCM 2831]
 gi|170655072|gb|ACB24127.1| ribonuclease BN [Methylobacterium radiotolerans JCM 2831]
          Length = 375

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/255 (21%), Positives = 122/255 (47%), Gaps = 17/255 (6%)

Query: 26  AMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQV 85
           A+A+ ++   LLS+FP I    +  G       +   +  +    P    + I D++ ++
Sbjct: 99  AVAAGVTFYTLLSLFPAIAALVSCYGLFADVTVINDHLAQLHAVLPSGAVELIGDQVKRI 158

Query: 86  LAVPAKGLFTI---SALAAAYFSSNG-VEALRISLNRAYRVVEMRSWYITRLISFGYVLL 141
            A    G  +I   S+L  + +S+N  ++A+  +LN  Y   E R+++        ++ L
Sbjct: 159 -AAKGSGSLSITFFSSLLLSIWSANAAMKAMFDALNVVYEEEEKRNFF--------WLNL 209

Query: 142 ASVTLVIMSFVFVAIPLALAYVRKF---FPALGNLLLIIWNGRIYATMLALFIGLIFVHL 198
            S+T  + + +F+ + L +  V      F  LG+   ++   R  A ++ L  GL  ++ 
Sbjct: 210 RSLTFTVGALLFIIVALNVIVVVPVVLNFLGLGSTAWLLAALRWPAILIVLLGGLSVLYR 269

Query: 199 FLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
           F P+ + ++   +  G +   + W+  ++LF+ Y+  F TY+  Y  L +++  + ++++
Sbjct: 270 FGPSREHARWRWVGVGSVVAGLLWLAASLLFSWYVANFGTYNETYGSLGAVIGFMTWIWI 329

Query: 258 LGVFFILGAELNASM 272
                +LG E+NA +
Sbjct: 330 SSTIVLLGGEINAEL 344


>gi|227540637|ref|ZP_03970686.1| ribonuclease BN [Sphingobacterium spiritivorum ATCC 33300]
 gi|227239499|gb|EEI89514.1| ribonuclease BN [Sphingobacterium spiritivorum ATCC 33300]
          Length = 336

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 130/295 (44%), Gaps = 45/295 (15%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIV---------FGANLAGFLGAHQFVPT 61
           ++ + I  F+++    M++ ++   + S+ P I+         +G  L G  GA      
Sbjct: 16  LMMNVINGFLDDKCMKMSASLAYYTVFSIGPLIIIIIWCIGFFYGTQLDGPTGAR----- 70

Query: 62  VIDVVFGAWPEVIAKPITDEI---LQVLAVPAK-------GLFTISALAAAYFSSNGVEA 111
             D VF  + E+  K +  ++   +Q ++   +       G+ T+   +   F       
Sbjct: 71  --DEVFKEFSELFGKDVAVQVQSTIQKISFENRSNIGIIVGIVTLIITSTTIFVD----- 123

Query: 112 LRISLNRAYRVVEM--RSWY---ITRLISFGYVLLASVTLVIMSFVFVAIPLALA-YVRK 165
           ++ S+N  ++V     + W    I RLISF  VL     L+I S +   I +AL  Y  +
Sbjct: 124 IQDSINTIWKVKAKAKKGWLKLIINRLISFSMVLGLGF-LLIASLMINGIIVALTNYFGQ 182

Query: 166 FFPALGNLLLIIW--NGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVV 223
           +F  + +L ++ W   G  +  + ALF G IF   FLP AK +   IL G IFT + ++ 
Sbjct: 183 YFENI-SLPMLDWINTGITFMVITALF-GFIFS--FLPDAKVRFRDILGGAIFTALLFMF 238

Query: 224 GAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           G    + YI T S  ++ Y    SI+  L ++Y        GAE    + I Y +
Sbjct: 239 GRYAISLYI-TQSATASAYGAAGSIIVLLGWVYYSSAILYFGAEFTKEIAIRYGK 292


>gi|86742177|ref|YP_482577.1| ribonuclease BN [Frankia sp. CcI3]
 gi|86569039|gb|ABD12848.1| ribonuclease BN [Frankia sp. CcI3]
          Length = 342

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 96/211 (45%), Gaps = 5/211 (2%)

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
            V+   +   I Q+L+     + +I  + + +  S  +     ++  AY   E+RS   +
Sbjct: 122 SVVDDAVRPTIDQILSRGRPDVISIGFVLSLWTGSTAMATFVNTITIAYGQRELRSAVRS 181

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALGNLLLIIWNGRIYATMLAL 189
           RL++    L    + VI+    V  P  ++ +      P +  L+ +++   +    LA+
Sbjct: 182 RLLALWLFLAQVASGVILLPALVLGPELISRIFDASRHPLVSTLITLLYWPVVGLVALAM 241

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
              L   HL LP  +      LPG I   + W+VG+ +  +Y+    ++  +Y  L S +
Sbjct: 242 LTSLY--HLSLPV-RRPWWRALPGAILALVCWLVGSGVLRYYLEIVFSHELVYGSLGSPV 298

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             L+F Y+  +  +LGAELNA++     R++
Sbjct: 299 AALLFFYITALAVLLGAELNAALDEQPPRRR 329


>gi|331696161|ref|YP_004332400.1| ribonuclease BN [Pseudonocardia dioxanivorans CB1190]
 gi|326950850|gb|AEA24547.1| ribonuclease BN [Pseudonocardia dioxanivorans CB1190]
          Length = 350

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 112/251 (44%), Gaps = 12/251 (4%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVL 86
           +A  ++  A L++FP ++    + G +     V   +D +    P   A+PI  + L  +
Sbjct: 67  LAGGVAFFAFLALFPALIAAITVYGLVADPAQVGDQVDRLAAILP-AAARPIVADQLGAV 125

Query: 87  AVPAKGLFTI----SALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLA 142
           +    G   +    S LAA + +S G   L  + N AY   E R +   R  + G  L A
Sbjct: 126 SSAGTGALGVGLVVSLLAALWSASAGTMNLIRATNLAYDEEETRGFLRLRGTALGLTLAA 185

Query: 143 SVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPA 202
            V +++   +  A+P     V      LG   L++     +  ++ L +  + V   +  
Sbjct: 186 IVFVLLAVALVAAMPAVFEAV-----GLGGAGLVVAQVVRWVLLVVLVVVALAVVYRVAP 240

Query: 203 AKS--KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGV 260
            +   K   +  G +   + W+VG+++F+ Y+  F +Y+  Y  LA  +  L++LY+   
Sbjct: 241 DRDAPKFRWVSVGAVVATVLWLVGSIVFSVYVDNFGSYNKTYGALAGAVVLLLWLYLTSY 300

Query: 261 FFILGAELNAS 271
             +LGAE+NA 
Sbjct: 301 IVLLGAEINAE 311


>gi|88854744|ref|ZP_01129410.1| membrane protein [marine actinobacterium PHSC20C1]
 gi|88815905|gb|EAR25761.1| membrane protein [marine actinobacterium PHSC20C1]
          Length = 336

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 76/275 (27%), Positives = 123/275 (44%), Gaps = 41/275 (14%)

Query: 19  FVEEDGWAMASHISLSALLSVFP--FIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAK 76
           F+   G   A+ ++  + L++FP    V  A   G  G  Q V TV+D+      E I +
Sbjct: 26  FLRHRGIDTAATLTFFSALAIFPAALTVVSAFALG-QGRIQAVETVLDLA-----EEILQ 79

Query: 77  PITDEILQVLAVPAKGLFTIS----ALA-----AAYFSSNGVEALRISLNRAYRVVEMRS 127
           P T   + VL VP   LF+I     ALA     + +  S+   A   + N  Y V E R 
Sbjct: 80  PDT---VDVLEVPLAQLFSIGSPGIALAIGIVLSVWSMSSYATAFGRAANSVYEVHEGR- 135

Query: 128 WYITRLISF-GYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL------LIIWN- 179
               RL+ F G +L+ SV L+I    F A+   L        A+G  L      + +W+ 
Sbjct: 136 ----RLVKFRGLMLILSVFLII---AFAAVIALLLTTPNVATAIGEALGFGEPWVAVWSY 188

Query: 180 GR--IYATMLALFIGLIFVHLFLPAAKSKIMS-ILPGVIFTWISWVVGAVLFTHYIVTFS 236
           GR  + A +L L I +++   F P  + + M  +  G +F   +W +    F  Y+ T +
Sbjct: 189 GRWPVLAAILTLIIAVLY--YFTPNIRHERMRWVSTGAVFAIATWGLATAAFGLYVSTIA 246

Query: 237 TYSTMYAGLASIMTCLVFLYMLGVFFILGAELNAS 271
            Y  +Y  L   +  L++LY+  +  + G E++A 
Sbjct: 247 NYDRVYGWLGGALALLIWLYISNLALVAGIEVDAE 281


>gi|301299944|ref|ZP_07206172.1| YihY family protein [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|300852450|gb|EFK80106.1| YihY family protein [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 295

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 126/279 (45%), Gaps = 6/279 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQF-V 59
           ++E      D+    +E   E D  + +  I+  ALL++ P I+   N+   +   +  V
Sbjct: 4   LKEKLHKFRDLFLLIVERASEADINSTSITIAYYALLAILPTIILLGNILSIINLKEADV 63

Query: 60  PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
              + V+  +      KPI + +L+     + G+ ++S + A +  S G+ AL+  LN A
Sbjct: 64  LNGLQVIVPSNVFTTLKPIIETMLKK---GSGGIASVSGILALWAVSRGINALKNGLNMA 120

Query: 120 YRVVEMRSW--YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLII 177
           Y V +       + R+ S    ++  + +V +  VF    +AL Y+        N + + 
Sbjct: 121 YGVGKGTGTGAVLGRIFSIFITVVLGLLIVALFLVFSFGQIALDYITPLLNLSTNWIDLF 180

Query: 178 WNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
              +     + +F+ +I ++  +P AK   + +LPG I   I W+  +  F+ Y+  F+ 
Sbjct: 181 MRWKWPTAAIGIFVIIILIYTLIPNAKLHFILVLPGAILATIGWLGLSQGFSIYVRYFTR 240

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
               Y  L + +  L++L   G   +LG+ +NA +  Y+
Sbjct: 241 TLLSYEALGTFIVLLLWLNYTGWVIMLGSVVNAGLEYYF 279


>gi|90962240|ref|YP_536156.1| ribonuclease BN [Lactobacillus salivarius UCC118]
 gi|227892347|ref|ZP_04010152.1| ribonuclease BN [Lactobacillus salivarius ATCC 11741]
 gi|90821434|gb|ABE00073.1| Ribonuclease BN [Lactobacillus salivarius UCC118]
 gi|227865896|gb|EEJ73317.1| ribonuclease BN [Lactobacillus salivarius ATCC 11741]
          Length = 294

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 126/279 (45%), Gaps = 6/279 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQF-V 59
           ++E      D+    +E   E D  + +  I+  ALL++ P I+   N+   +   +  V
Sbjct: 3   LKEKLHKFRDLFLLIVERASEADINSTSITIAYYALLAILPTIILLGNILSIINLKEADV 62

Query: 60  PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
              + V+  +      KPI + +L+     + G+ ++S + A +  S G+ AL+  LN A
Sbjct: 63  LNGLQVIVPSNVFTTLKPIIETMLKK---GSGGIASVSGILALWAVSRGINALKNGLNMA 119

Query: 120 YRVVEMRSW--YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLII 177
           Y V +       + R+ S    ++  + +V +  VF    +AL Y+        N + + 
Sbjct: 120 YGVGKGTGTGAVLGRIFSIFITVVLGLLIVALFLVFSFGQIALDYITPLLNLSTNWIDLF 179

Query: 178 WNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
              +     + +F+ +I ++  +P AK   + +LPG I   I W+  +  F+ Y+  F+ 
Sbjct: 180 MRWKWPTAAIGIFVIIILIYTLIPNAKLHFILVLPGAILATIGWLGLSQGFSIYVRYFTR 239

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
               Y  L + +  L++L   G   +LG+ +NA +  Y+
Sbjct: 240 TLLSYEALGTFIVLLLWLNYTGWVIMLGSVVNAGLEYYF 278


>gi|322391709|ref|ZP_08065176.1| ribonuclease BN [Streptococcus peroris ATCC 700780]
 gi|321145419|gb|EFX40813.1| ribonuclease BN [Streptococcus peroris ATCC 700780]
          Length = 287

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 103/210 (49%), Gaps = 15/210 (7%)

Query: 36  LLSVFPFIVFGANLAGF--LGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL 93
           L+S+FP ++   N+  +  +    F+ T+ + +    P+ I + +   + +VL  P+ GL
Sbjct: 38  LISIFPLLMIVVNILPYFQIPISNFLLTIKEFL----PDTIYEVVAKIVREVLTQPSTGL 93

Query: 94  FTISALAAAYFSSNGVEALRISLNRAYRVVEMRS----WYITRLISFGYVLLASVTLVIM 149
            + + L+A +  S  +  L+ + N+AY + + R       ++ L+SFG  +L ++ L + 
Sbjct: 94  LSFAILSALWTFSKSMNFLQKAFNKAYGIAKNRGIISHQLMSLLVSFGLQILFALALFLS 153

Query: 150 SFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIM 208
            F  + + L   Y +    AL + L       IYA + A+   +I ++ FLP  K SKI 
Sbjct: 154 MFGHMLLDLLKNYWKSE-SALFSYLQDFTGPLIYAFLFAI---VIMLYYFLPNVKVSKIR 209

Query: 209 SILPGVIFTWISWVVGAVLFTHYIVTFSTY 238
            ++PG +F  ++ +    +F  Y   +  Y
Sbjct: 210 YVIPGSLFVLVTTIALLNIFAAYFNNYVNY 239


>gi|189502450|ref|YP_001958167.1| hypothetical protein Aasi_1095 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|189497891|gb|ACE06438.1| hypothetical protein Aasi_1095 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 295

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/286 (22%), Positives = 128/286 (44%), Gaps = 27/286 (9%)

Query: 2   REYFCIVFDIIYDAIEHFV-EEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
             ++C +   I+  + H +   D    +  ++ +  L++FP  +F   L  ++   + VP
Sbjct: 13  NSHYCSILLQIFKELWHRILANDILERSYAVAFNFTLAIFPATIFIFTLIPYISIPELVP 72

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            +ID      PE I   +   I   L+    GL +   + + Y SSNG+    +SL + +
Sbjct: 73  KLIDFFKEGIPETIYGALAPTIQDTLSKHRSGLLSFGFIYSLYLSSNGI----MSLIKNF 128

Query: 121 RVVEM------RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL 174
            +V+       RS+   R I+        +TL +M  +F +I L L   R+    + N  
Sbjct: 129 NLVDQPMSHYKRSYLQQRAIA------TILTLALMLALFSSI-LLLIVARQILDYMVNYE 181

Query: 175 LIIWNGRI----YAT----MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAV 226
           LI     I    +A+     L  FI +  ++   P  K     IL G +   +  ++ ++
Sbjct: 182 LITHKVHISILPFASSIIVFLIFFIAIAGIYYLAPTNKQNRKFILIGALIATLGCLLASL 241

Query: 227 LFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
            F++Y+  F  Y  +Y  L  ++  +++L++L +  ++G ELN ++
Sbjct: 242 AFSYYVNHFVKYG-LYGSLGVMIALMLWLFLLSLTLLIGFELNITL 286


>gi|221133917|ref|ZP_03560222.1| ribonuclease BN [Glaciecola sp. HTCC2999]
          Length = 297

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 115/263 (43%), Gaps = 42/263 (15%)

Query: 28  ASHISLSALLSVFPFI-VFGANLAGFLG------------AHQFVPTVIDVVFGAWPEVI 74
           A H++  +LLS+ PFI VF   L+ F               + FVPT  D        V+
Sbjct: 40  AGHLAYVSLLSLVPFIMVFFTMLSAFPAFAEIRLALESFIFNNFVPTSGD--------VL 91

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT--- 131
            K I++ +     + A G+ ++  +A        +  +  +LN  +R  E R    T   
Sbjct: 92  QKYISEFVGNASGMGAVGIASLMVVALLL-----IMNIDKTLNTIWRTPEARPRMFTFAV 146

Query: 132 --RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
              +I+ G +++ S  LV    +  A     +Y  ++ P LG LLL     ++  ++ A 
Sbjct: 147 YWMVITLGPIMMGSSILVSSYLLGFA-----SYAEEYTPGLGTLLL-----KMVPSVTAT 196

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           F G + +++ +P  + K    L G I     + +    F  Y+ +F +Y  +Y  LA I 
Sbjct: 197 F-GFLILYMLVPNTRVKFSHALCGAILATFLFELSKKGFAFYVASFPSYQVIYGALAVIP 255

Query: 250 TCLVFLYMLGVFFILGAELNASM 272
              V++Y+  +  ++GAE   S+
Sbjct: 256 ILFVWVYLSWIVVLVGAEFTCSI 278


>gi|296534422|ref|ZP_06896866.1| ribonuclease BN [Roseomonas cervicalis ATCC 49957]
 gi|296265251|gb|EFH11432.1| ribonuclease BN [Roseomonas cervicalis ATCC 49957]
          Length = 340

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 73/265 (27%), Positives = 112/265 (42%), Gaps = 40/265 (15%)

Query: 28  ASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLA 87
           A+ ++  ALLSVFP +    +L G       V   +    G  P      I DE L+ LA
Sbjct: 71  AAGVTFYALLSVFPALTALVSLFGLFADPAMVGQQLQQAEGFIP-AGGMQIIDEQLRRLA 129

Query: 88  VPAKGLFTISA---LAAAYFSSN-GVEALRISLNRAYRVVEMRSWYITRLISFGYVLLAS 143
              +G    SA   L  A +S+N G +A+  +LN  Y   E R +    LI+  + L A 
Sbjct: 130 SGERGSLGFSAVLGLGVALWSANQGTKAMFDALNIVYEEKEKRGFLRRTLITLAFTLGAL 189

Query: 144 V-TLVIMSFVFVAIPLALAYVRKFFPALGNLLLII--WNGRIYATMLALFIGLIFVHL-- 198
           V T++ MS V V     +      F +   LLL +  W       +L LFI  +   L  
Sbjct: 190 VFTMLAMSAVVVLP---VVLAFAGFESSTELLLRLARW------PLLILFITALLATLYR 240

Query: 199 FLPAAKSKIMSILPGVIFTWISWVVGAVL-----------FTHYIVTFSTYSTMYAGLAS 247
           F P+ +           + W+SW  G V            F+ Y+  F  Y   Y  L +
Sbjct: 241 FGPSREK--------ARWRWVSW--GGVFAALAWAALSAGFSFYVGNFGNYDATYGSLGA 290

Query: 248 IMTCLVFLYMLGVFFILGAELNASM 272
           ++  + ++++  +  + GAELNA M
Sbjct: 291 VIGFMTWIWLSAMVVLFGAELNAEM 315


>gi|310829421|ref|YP_003961778.1| putative ribonuclease BN [Eubacterium limosum KIST612]
 gi|308741155|gb|ADO38815.1| putative ribonuclease BN [Eubacterium limosum KIST612]
          Length = 272

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/260 (21%), Positives = 116/260 (44%), Gaps = 16/260 (6%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAK 76
           E     D W + + +S   +++ FP I+F  N  G     +F+    D +F    E + +
Sbjct: 17  EDMDRTDFWGICAQMSFYIIMAFFPLIIFLINFVG-----RFIVQFKDYLFDILKEYLPQ 71

Query: 77  PITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRL 133
              D +  ++    K L     I  L   +F++    A+   +N+ Y   E RS     L
Sbjct: 72  LSYDYVRTLIDTLTKNLADNNYILVLFTFFFATLAARAIMTGMNQNYGNHESRSHLKIWL 131

Query: 134 ISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALG----NLLLIIWNGRIYATMLAL 189
           +SF + +L +++++++   +V       Y+      LG    N++L+     I++ + ++
Sbjct: 132 LSFLFTILFAISIILIISAYVFSEAISEYI---LVRLGIDQFNIILMNIFTFIFSLVTSI 188

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           F+    V++  P  + + M  LPG +F+ +   +   +F  ++   + Y+ +Y     + 
Sbjct: 189 FL-FTCVYVLAPDRQLRFMQGLPGAVFSTLGINIAFRIFLMFMNHSTKYTLLYGNFGGLF 247

Query: 250 TCLVFLYMLGVFFILGAELN 269
             LV +Y + V   LG ++N
Sbjct: 248 ALLVGIYFVCVILNLGGKIN 267


>gi|114561519|ref|YP_749032.1| ribonuclease BN [Shewanella frigidimarina NCIMB 400]
 gi|122300991|sp|Q088X1|Y331_SHEFN RecName: Full=UPF0761 membrane protein Sfri_0331
 gi|114332812|gb|ABI70194.1| tRNA-processing RNAse BN [Shewanella frigidimarina NCIMB 400]
          Length = 320

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 114/247 (46%), Gaps = 31/247 (12%)

Query: 35  ALLSVFP-FIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL 93
           ++LS FP F     N+ GF+  + F+P   D V               I + +A  +KG 
Sbjct: 57  SMLSAFPVFKGIRGNIEGFI-YNNFIPAAGDTV------------QVHINEFVANASKGT 103

Query: 94  FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT-----RLISFGYVLLASVTLVI 148
           F +  +A  + +   + A+  +LN  +R+ E RS+ ++      +++ G VL+ + +LV 
Sbjct: 104 F-VGIIALVFVAIMLISAIDKALNNIWRITEKRSYVVSFSMYWMVLTLGPVLIGA-SLVA 161

Query: 149 MSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIM 208
            S+V     +A   +    P +   L +I++    A++L L+       + +P  K   +
Sbjct: 162 TSYVVSLEVVAGTELSGLVPWIVERLPLIFSA---ASILLLY-------MVVPNKKVHFL 211

Query: 209 SILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAEL 268
             L G I   + +  G   F  Y+  F +Y  +Y  LA +    V++Y+  +  +LGAE+
Sbjct: 212 HALLGAIVAAVLFEAGKKGFAFYVTQFPSYEAIYGALAVVPILFVWVYLSWMIVLLGAEI 271

Query: 269 NASMIIY 275
            A++  Y
Sbjct: 272 TAALPEY 278


>gi|300214900|gb|ADJ79316.1| Ribonuclease BN [Lactobacillus salivarius CECT 5713]
          Length = 294

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 62/279 (22%), Positives = 126/279 (45%), Gaps = 6/279 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQF-V 59
           ++E      D+    +E   E D  + +  I+  ALL++ P I+   N+   +   +  +
Sbjct: 3   LKEKLHKFRDLFLLIVERASEADINSTSITIAYYALLAILPTIILLGNILSIINLKEADI 62

Query: 60  PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
              + V+  +      KPI + +L+     + G+ ++S + A +  S G+ AL+  LN A
Sbjct: 63  LNGLQVIVPSNVFTTLKPIIETMLKK---GSGGIASVSGILALWAVSRGINALKNGLNMA 119

Query: 120 YRVVEMRSW--YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLII 177
           Y V +       + R+ S    ++  + +V +  VF    +AL Y+        N + + 
Sbjct: 120 YGVGKGTGTGAVLGRIFSIFITVVLGLLIVALFLVFSFGQIALDYITPLLNLSTNWIDLF 179

Query: 178 WNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
              +     + +F+ +I ++  +P AK   + +LPG I   I W+  +  F+ Y+  F+ 
Sbjct: 180 MRWKWPTAAIGIFVIIILIYTLIPNAKLHFILVLPGAILATIGWLGLSQGFSIYVRYFTR 239

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
               Y  L + +  L++L   G   +LG+ +NA +  Y+
Sbjct: 240 TLLSYEALGTFIVLLLWLNYTGWVIMLGSVVNAGLEYYF 278


>gi|114704910|ref|ZP_01437818.1| hypothetical protein FP2506_08236 [Fulvimarina pelagi HTCC2506]
 gi|114539695|gb|EAU42815.1| hypothetical protein FP2506_08236 [Fulvimarina pelagi HTCC2506]
          Length = 373

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 86/173 (49%), Gaps = 5/173 (2%)

Query: 101 AAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLAL 160
           A + ++NG++ L  ++N AY   E RS+     ++F +    ++ ++I+  V +     +
Sbjct: 159 AMWSANNGIKTLFEAMNVAYGETEQRSFLKLNAVAFCF----TIGMIIVGIVLITAIGVI 214

Query: 161 AYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWI 219
             + K         + I   R     L +   +  ++ + P+ K ++   ++ G   T  
Sbjct: 215 PAIMKILGLQTFSEIFIAALRWPVVFLLIVAAIAAIYRYGPSRKRARWKWVIGGAFLTAF 274

Query: 220 SWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
            W+V ++ F+ Y+  F+ Y+  Y  L +++  ++++++  V FI+GAE+NA M
Sbjct: 275 VWLVASISFSWYLQNFANYNATYGSLGAVIGFMMWVWVSSVIFIIGAEVNAEM 327


>gi|256824738|ref|YP_003148698.1| hypothetical protein Ksed_08810 [Kytococcus sedentarius DSM 20547]
 gi|256688131|gb|ACV05933.1| predicted membrane protein [Kytococcus sedentarius DSM 20547]
          Length = 417

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 64/266 (24%), Positives = 117/266 (43%), Gaps = 13/266 (4%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV---IDVVFGAWP 71
           A+  F ++    +A+ ++  A+LS+FP I+   +L G  G  +        I V  GA P
Sbjct: 96  ALYEFTDDGCTDLAAGLTYFAVLSIFPAIIGLVSLLGVFGQGESTTQAFLQIAVDLGADP 155

Query: 72  EVIAKPITDEIL--QVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           +       ++ +  Q  +  A     +  L A + +SN V      +NR Y V E R ++
Sbjct: 156 QSTGYTFIEDFITKQQESSGAGLALALGLLGALWSASNYVNGFSRMMNRIYEVPEGRPFW 215

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFP--ALGNLLLIIWNGRIYAT-- 185
           + R +     +L  + + ++   FV   L        F    LG+L   IW    +    
Sbjct: 216 VLRPVMVLVTVLVLLLVAVLGLSFV---LTGPVAESVFGVVGLGDLATTIWAWAKWPAAA 272

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           ++ +FI +  ++   P  K     + PG I  ++ WV+ +  F  YI  F  Y   Y  +
Sbjct: 273 LIVIFI-IRLLYWATPNVKLPRQILTPGAILAFLIWVLASAAFGFYIANFGNYDATYGSM 331

Query: 246 ASIMTCLVFLYMLGVFFILGAELNAS 271
           A ++  L++L++     +LGAE++A 
Sbjct: 332 AGVIVFLLWLWLTNTVLLLGAEIDAE 357


>gi|254559558|ref|YP_003066653.1| ribonuclease BN [Methylobacterium extorquens DM4]
 gi|254266836|emb|CAX22635.1| Ribonuclease BN [Methylobacterium extorquens DM4]
          Length = 388

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/258 (22%), Positives = 124/258 (48%), Gaps = 23/258 (8%)

Query: 26  AMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQV 85
           ++A+ ++   LLS+FP I       G +     +   +  + G  PE   + I +++ ++
Sbjct: 112 SVAAGVTFYTLLSLFPAIAALVTCYGLVADVNTINVHLSTLHGVLPESAIEIIGEQVKRI 171

Query: 86  LAVPAKGL-FTI-SALAAAYFSSNG-VEALRISLNRAYRVVEMRS--WYITRLISFG--- 137
               +  L FT  ++L  + +S+N  ++A+  +LN  Y   E R+  W   R ++F    
Sbjct: 172 ATKGSGALGFTFFTSLTLSLWSANAAMKAMFDALNVVYEEEEKRNFFWLNVRSLTFTAGA 231

Query: 138 --YVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIF 195
             +++LA +++V++  VF             F  LG+   +I   R    +L L  GL  
Sbjct: 232 LLFIILALISIVVLPVVF------------NFLGLGDGARLIAMARWPMLLLVLLGGLAV 279

Query: 196 VHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
           ++ + P+  +++   +  G I   + W++ ++LF+ Y+  F  Y+  Y  L +++  + +
Sbjct: 280 LYRYGPSRERARWRWVGAGSIVAGVLWLIASILFSWYVANFGNYNETYGSLGAVIGFMTW 339

Query: 255 LYMLGVFFILGAELNASM 272
           +++     +LG E+NA +
Sbjct: 340 IWISATIVLLGGEINAEI 357


>gi|298502451|ref|YP_003724391.1| ribonuclease BN [Streptococcus pneumoniae TCH8431/19A]
 gi|298238046|gb|ADI69177.1| possible ribonuclease BN [Streptococcus pneumoniae TCH8431/19A]
          Length = 291

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 118/249 (47%), Gaps = 23/249 (9%)

Query: 36  LLSVFPFIVFGANLAGF--LGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL 93
           L+S+FP ++   N+  +  +   +F+  + DV+    P  + + +     +VL  P+ GL
Sbjct: 43  LISIFPLLLVVVNILPYFQIPVGEFLCFMKDVL----PPSLYEGVEKIAREVLTQPSTGL 98

Query: 94  FTISALAAAYFSSNGVEALRISLNRAYRVVEMRS----WYITRLISFGYVLLASVTLVIM 149
            + S L+A +  S  +  L+ + N+AY V + R       ++ L+SFG  LL +  L ++
Sbjct: 99  LSFSVLSALWSFSKSMNFLQKAFNKAYGVEKSRGLISHQMLSLLVSFGLQLLFAFALFLI 158

Query: 150 SFVFVAIPLALAYVRK---FFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPA-AKS 205
            F  + + L   Y  K    + AL  L        IYA + A+   L+ ++ FLP  +  
Sbjct: 159 LFGQMILALLAHYWTKDGIIYQALQGLA----GPLIYALLFAI---LVMLYYFLPNISNR 211

Query: 206 KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY--MLGVFFI 263
           KI   LPG  F  +  +    LF+ Y+  +  +      L S++  ++  +  ++    I
Sbjct: 212 KISYTLPGSAFVLLVILGLLTLFSSYLNYYVHHLVDVRILGSVLLVVMMFWFILIAKIVI 271

Query: 264 LGAELNASM 272
           LGA +NASM
Sbjct: 272 LGAVINASM 280


>gi|194398139|ref|YP_002037313.1| ribonuclease BN [Streptococcus pneumoniae G54]
 gi|194357806|gb|ACF56254.1| ribonuclease BN, putative [Streptococcus pneumoniae G54]
          Length = 286

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 118/249 (47%), Gaps = 23/249 (9%)

Query: 36  LLSVFPFIVFGANLAGF--LGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL 93
           L+S+FP ++   N+  +  +   +F+  + DV+    P  + + +     +VL  P+ GL
Sbjct: 38  LISIFPLLLVVVNILPYFQIPVGEFLGFMKDVL----PPSLYEGVEKIAREVLTQPSTGL 93

Query: 94  FTISALAAAYFSSNGVEALRISLNRAYRVVEMRS----WYITRLISFGYVLLASVTLVIM 149
            + S L+A +  S  +  L+ + N+AY V + R       ++ L+SFG  LL +  L ++
Sbjct: 94  LSFSVLSALWSFSKSMNFLQKAFNKAYGVEKSRGLISHQMLSLLVSFGLQLLFAFALFLI 153

Query: 150 SFVFVAIPLALAYVRK---FFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPA-AKS 205
            F  + + L   Y  K    + AL  L        IYA + A+   L+ ++ FLP  +  
Sbjct: 154 LFGQMILALLAHYWTKDGIIYQALQGLA----GPLIYALLFAI---LVMLYYFLPNISNR 206

Query: 206 KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY--MLGVFFI 263
           KI   LPG  F  +  +    LF+ Y+  +  +      L S++  ++  +  ++    I
Sbjct: 207 KISYTLPGSAFVLLVILGLLTLFSSYLNYYVHHLVDVRILGSVLLVVMMFWFILIAKIVI 266

Query: 264 LGAELNASM 272
           LGA +NASM
Sbjct: 267 LGAVINASM 275


>gi|86130265|ref|ZP_01048865.1| YihY family protein [Dokdonia donghaensis MED134]
 gi|85818940|gb|EAQ40099.1| YihY family protein [Dokdonia donghaensis MED134]
          Length = 313

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/256 (20%), Positives = 117/256 (45%), Gaps = 17/256 (6%)

Query: 26  AMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV---IAKPITDEI 82
           + A  I+ S  +++FP ++F  NL  ++    F    +  ++   P       +PI  +I
Sbjct: 55  SRAGSIAYSFFMAIFPALIFVLNLIPYVPVPDFDIKFMAFIYELIPSQSLDFFRPIISDI 114

Query: 83  LQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGY---- 138
            Q       GL +++ L A + ++NGV ++      ++     RS++    ++       
Sbjct: 115 AQN---ERAGLLSVAGLLALFLTANGVNSIFSGFEGSHYNEINRSFFRQYAVAIATSIIL 171

Query: 139 -VLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA-TMLALFIGLIFV 196
            +LL +   V++ F ++ + L     R F     ++ L+     ++   M+   I  ++ 
Sbjct: 172 ALLLVTTISVVVYFEYLLVSLK---ERDFMSTDLDITLLSVGKNVFVLIMIYAVIATLYY 228

Query: 197 HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
                  KS+  S  PG + T + +++   LF  YI TF  Y+ +Y  + +++  +++++
Sbjct: 229 FGTKEGRKSRFFS--PGALMTTVLFMITTYLFGIYIDTFGRYNELYGSIGALLIMMLYIW 286

Query: 257 MLGVFFILGAELNASM 272
           +     +LG ELNA++
Sbjct: 287 LNSNLILLGFELNATL 302


>gi|225856351|ref|YP_002737862.1| ribonuclease BN [Streptococcus pneumoniae P1031]
 gi|225724776|gb|ACO20628.1| ribonuclease BN [Streptococcus pneumoniae P1031]
          Length = 286

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 118/249 (47%), Gaps = 23/249 (9%)

Query: 36  LLSVFPFIVFGANLAGF--LGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL 93
           L+S+FP ++   N+  +  +   +F+  + DV+    P  + + +     +VL  P+ GL
Sbjct: 38  LISIFPLLLVVVNILPYFQIPVGEFLCFMKDVL----PPSLYEGVEKIAREVLTQPSTGL 93

Query: 94  FTISALAAAYFSSNGVEALRISLNRAYRVVEMRS----WYITRLISFGYVLLASVTLVIM 149
            + S L+A +  S  +  L+ + N+AY V + R       ++ L+SFG  LL +  L ++
Sbjct: 94  LSFSVLSALWSFSKSMNFLQKAFNKAYGVEKSRGLISHQMLSLLVSFGLQLLFAFALFLI 153

Query: 150 SFVFVAIPLALAYVRK---FFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPA-AKS 205
            F  + + L   Y  K    + AL  L        IYA + A+   L+ ++ FLP  +  
Sbjct: 154 LFGQMILALLAHYWTKDGIIYQALQGLA----GPLIYALLFAI---LVMLYYFLPNISNR 206

Query: 206 KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY--MLGVFFI 263
           KI   LPG  F  +  +    LF+ Y+  +  +      L S++  ++  +  ++    I
Sbjct: 207 KISYTLPGSAFVLLVILGLLTLFSSYLNYYVHHLVDVRILGSVLLVVMMFWFILIAKIVI 266

Query: 264 LGAELNASM 272
           LGA +NASM
Sbjct: 267 LGAVINASM 275


>gi|148992234|ref|ZP_01821957.1| ribonuclease BN, putative [Streptococcus pneumoniae SP9-BS68]
 gi|168488338|ref|ZP_02712537.1| ribonuclease BN [Streptococcus pneumoniae SP195]
 gi|221231473|ref|YP_002510625.1| ribonuclease BN-like family protein [Streptococcus pneumoniae ATCC
           700669]
 gi|225854183|ref|YP_002735695.1| ribonuclease BN [Streptococcus pneumoniae JJA]
 gi|298230973|ref|ZP_06964654.1| ribonuclease BN [Streptococcus pneumoniae str. Canada MDR_19F]
 gi|298254128|ref|ZP_06977714.1| ribonuclease BN [Streptococcus pneumoniae str. Canada MDR_19A]
 gi|147928860|gb|EDK79872.1| ribonuclease BN, putative [Streptococcus pneumoniae SP9-BS68]
 gi|183572912|gb|EDT93440.1| ribonuclease BN [Streptococcus pneumoniae SP195]
 gi|220673933|emb|CAR68442.1| ribonuclease BN-like family protein [Streptococcus pneumoniae ATCC
           700669]
 gi|225723978|gb|ACO19831.1| ribonuclease BN [Streptococcus pneumoniae JJA]
 gi|332074462|gb|EGI84938.1| ribonuclease BN-like family protein [Streptococcus pneumoniae
           GA17570]
          Length = 286

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 118/249 (47%), Gaps = 23/249 (9%)

Query: 36  LLSVFPFIVFGANLAGF--LGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL 93
           L+S+FP ++   N+  +  +   +F+  + DV+    P  + + +     +VL  P+ GL
Sbjct: 38  LISIFPLLLVVVNILPYFQIPVGEFLCFMKDVL----PPSLYEGVEKIAREVLTQPSTGL 93

Query: 94  FTISALAAAYFSSNGVEALRISLNRAYRVVEMRS----WYITRLISFGYVLLASVTLVIM 149
            + S L+A +  S  +  L+ + N+AY V + R       ++ L+SFG  LL +  L ++
Sbjct: 94  LSFSVLSALWSFSKSMNFLQKAFNKAYGVEKSRGLISHQMLSLLVSFGLQLLFAFALFLI 153

Query: 150 SFVFVAIPLALAYVRK---FFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPA-AKS 205
            F  + + L   Y  K    + AL  L        IYA + A+   L+ ++ FLP  +  
Sbjct: 154 LFGQMILALLAHYWTKDGIIYQALQGLA----GPLIYALLFAI---LVMLYYFLPNISNR 206

Query: 206 KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY--MLGVFFI 263
           KI   LPG  F  +  +    LF+ Y+  +  +      L S++  ++  +  ++    I
Sbjct: 207 KISYTLPGSAFVLLVILGLLTLFSSYLNYYVHHLVDVRILGSVLLVVMMFWFILIAKIVI 266

Query: 264 LGAELNASM 272
           LGA +NASM
Sbjct: 267 LGAVINASM 275


>gi|323466993|gb|ADX70680.1| Methionine aminopeptidase Map [Lactobacillus helveticus H10]
          Length = 289

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 103/216 (47%), Gaps = 20/216 (9%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV--VEMR-- 126
           P+ ++  I   I  +L   + G  +   + A +  SN V A+R+  NR Y V  VE++  
Sbjct: 55  PDQVSSFIMPIINSLLKTTSTGYISFGIILAIWSFSNLVNAIRLGENRLYGVHQVELKLS 114

Query: 127 --SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLI-------I 177
             ++  TRLI     ++   TL+I+  +F A+ + LA+ ++    +  +  I       I
Sbjct: 115 MLNFLWTRLI-----MVIFTTLMII--IFTAVGVVLAFGQELLDLMDAIFKIPVHEVGKI 167

Query: 178 WNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
           ++ R     L + + + +++  LP  K K   I PGV  T   W+  + LF+ Y+  F  
Sbjct: 168 FSYRYPVIFLIIILAVFYLNYVLPNIKLKKRVIWPGVFVTSCGWIALSFLFSFYLHNFPI 227

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
               Y  + + +  +++L +  + F+ G  +NA++I
Sbjct: 228 TWKNYGIVGTFIIFMLWLNIASLLFLFGVAVNATII 263


>gi|332992062|gb|AEF02117.1| putative ribonuclease protein [Alteromonas sp. SN2]
          Length = 318

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/251 (19%), Positives = 114/251 (45%), Gaps = 10/251 (3%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVL 86
           +A+ ++   LL++FP +    +L G + + + +   + ++    P   +  I +++  + 
Sbjct: 39  IAAGVAFYCLLAIFPLLGATISLYGLMVSPEELQNHMALLVNVVPSDSSYIIEEQLKNLT 98

Query: 87  AVPAKGL---FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLAS 143
              +  L   F ++   + + SS G  AL  + N  Y     R ++   +      +   
Sbjct: 99  QKSSSALGWGFFLTLFLSLWSSSKGANALITACNITYIEDNGRGFFKGLIARITGTICMI 158

Query: 144 VTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF-IGLIFVHLFLPA 202
           +T+++       +P  ++++     +      I W       +L LF IGL  ++ + P 
Sbjct: 159 ITVIVALVCITVLPELISWISGGLISFKQASWITW-----PVLLLLFNIGLSALYRYAPH 213

Query: 203 AKSKIMS-ILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVF 261
            +S     + PG +F  + W+  +  F+ Y+  F++Y+  Y  +  I+  L++LY+    
Sbjct: 214 RRSAQWRWVTPGSLFATLLWIAASYGFSIYLNEFASYNKTYGSVGGIIILLMWLYLSAYI 273

Query: 262 FILGAELNASM 272
            ++GAE+N+S+
Sbjct: 274 ILIGAEVNSSI 284


>gi|182683583|ref|YP_001835330.1| ribonuclease BN, putative [Streptococcus pneumoniae CGSP14]
 gi|182628917|gb|ACB89865.1| ribonuclease BN, putative [Streptococcus pneumoniae CGSP14]
          Length = 291

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 118/249 (47%), Gaps = 23/249 (9%)

Query: 36  LLSVFPFIVFGANLAGF--LGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL 93
           L+S+FP ++   N+  +  +   +F+  + DV+    P  + + +     +VL  P+ GL
Sbjct: 43  LISIFPLLLVVVNILPYFQIPVGEFLGFMKDVL----PPSLYEGVEKIAREVLTQPSTGL 98

Query: 94  FTISALAAAYFSSNGVEALRISLNRAYRVVEMRS----WYITRLISFGYVLLASVTLVIM 149
            + S L+A +  S  +  L+ + N+AY V + R       ++ L+SFG  LL +  L ++
Sbjct: 99  LSFSVLSALWSFSKSMNFLQKAFNKAYGVEKSRGLISHQMLSLLVSFGLQLLFAFALFLI 158

Query: 150 SFVFVAIPLALAYVRK---FFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPA-AKS 205
            F  + + L   Y  K    + AL  L        IYA + A+   L+ ++ FLP  +  
Sbjct: 159 LFGQMILALLAHYWTKDGIIYQALQGLA----GPLIYALLFAI---LVMLYYFLPNLSNR 211

Query: 206 KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY--MLGVFFI 263
           KI   LPG  F  +  +    LF+ Y+  +  +      L S++  ++  +  ++    I
Sbjct: 212 KISYTLPGSAFVLLVILGLLTLFSSYLNYYVHHLVDVRILGSVLLVVMMFWFILIAKIVI 271

Query: 264 LGAELNASM 272
           LGA +NASM
Sbjct: 272 LGAVINASM 280


>gi|301793838|emb|CBW36231.1| ribonuclease BN-like family protein [Streptococcus pneumoniae
           INV104]
 gi|332204674|gb|EGJ18739.1| ribonuclease BN-like family protein [Streptococcus pneumoniae
           GA47901]
          Length = 286

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 118/249 (47%), Gaps = 23/249 (9%)

Query: 36  LLSVFPFIVFGANLAGF--LGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL 93
           L+S+FP ++   N+  +  +   +F+  + DV+    P  + + +     +VL  P+ GL
Sbjct: 38  LISIFPLLLVVVNILPYFQIPVGEFLCFMKDVL----PPSLYEGVEKIAREVLTQPSTGL 93

Query: 94  FTISALAAAYFSSNGVEALRISLNRAYRVVEMRS----WYITRLISFGYVLLASVTLVIM 149
            + S L+A +  S  +  L+ + N+AY V + R       ++ L+SFG  LL +  L ++
Sbjct: 94  LSFSVLSALWSFSKSMNFLQKAFNKAYGVEKSRGLISHQMLSLLVSFGLQLLFAFALFLI 153

Query: 150 SFVFVAIPLALAYVRK---FFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPA-AKS 205
            F  + + L   Y  K    + AL  L        IYA + A+   L+ ++ FLP  +  
Sbjct: 154 LFGQMILALLAHYWTKDGIIYQALQGLA----GPLIYALLFAI---LVMLYYFLPNLSNR 206

Query: 206 KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY--MLGVFFI 263
           KI   LPG  F  +  +    LF+ Y+  +  +      L S++  ++  +  ++    I
Sbjct: 207 KISYTLPGSAFVLLVILGLLTLFSSYLNYYVHHLVDVRILGSVLLVVMMFWFILIAKIVI 266

Query: 264 LGAELNASM 272
           LGA +NASM
Sbjct: 267 LGAVINASM 275


>gi|83949735|ref|ZP_00958468.1| Ribonuclease BN [Roseovarius nubinhibens ISM]
 gi|83837634|gb|EAP76930.1| Ribonuclease BN [Roseovarius nubinhibens ISM]
          Length = 315

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 54/253 (21%), Positives = 116/253 (45%), Gaps = 14/253 (5%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVL 86
           +++ ++  ALLS+FP +     + GF G    + +  DV     PE     + ++I  ++
Sbjct: 16  ISAGVAFYALLSLFPAVTAMVAIWGFAGDPSKLLSQFDVARQFMPEEAYLLVQEQITALI 75

Query: 87  AVPAKGL---FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLAS 143
                 L     IS   + + + N   AL   LN  YR    ++      ++    ++  
Sbjct: 76  VADNTTLQWTTVISLTLSIWSAKNATAALIRGLNSIYREDHRKNPLKRYGVAVALTIVMI 135

Query: 144 VTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA---LFIGLIFVHLFL 200
              ++   + +A+P+ALA++      LG  + +  +   +A ++    L  GL++   + 
Sbjct: 136 AAALVAFALVIALPVALAFLN-----LGIKVEMFVSAAKWAILMGVVLLCFGLLY--RYG 188

Query: 201 PAAKSKIMSIL-PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLG 259
           P  +   +S L PG +F   +W  G++ F+ Y+  F +++ +Y  L +++  L + Y+  
Sbjct: 189 PNRRGATVSWLSPGALFALATWAAGSIAFSTYLRNFGSFNEVYGSLGALVALLFWFYISA 248

Query: 260 VFFILGAELNASM 272
              ++GA +NA +
Sbjct: 249 YVVLIGALINAEL 261


>gi|15900558|ref|NP_345162.1| ribonuclease BN, putative [Streptococcus pneumoniae TIGR4]
 gi|148997263|ref|ZP_01824917.1| ribonuclease BN, putative [Streptococcus pneumoniae SP11-BS70]
 gi|149002344|ref|ZP_01827286.1| ribonuclease BN, putative [Streptococcus pneumoniae SP14-BS69]
 gi|149020271|ref|ZP_01835163.1| ribonuclease BN, putative [Streptococcus pneumoniae SP23-BS72]
 gi|168482885|ref|ZP_02707837.1| ribonuclease BN [Streptococcus pneumoniae CDC1873-00]
 gi|168487251|ref|ZP_02711759.1| ribonuclease BN [Streptococcus pneumoniae CDC1087-00]
 gi|168492815|ref|ZP_02716958.1| ribonuclease BN [Streptococcus pneumoniae CDC3059-06]
 gi|168575327|ref|ZP_02721263.1| ribonuclease BN [Streptococcus pneumoniae MLV-016]
 gi|169833347|ref|YP_001694130.1| ribonuclease BN [Streptococcus pneumoniae Hungary19A-6]
 gi|225858485|ref|YP_002739995.1| ribonuclease BN [Streptococcus pneumoniae 70585]
 gi|225860648|ref|YP_002742157.1| ribonuclease BN [Streptococcus pneumoniae Taiwan19F-14]
 gi|237650324|ref|ZP_04524576.1| ribonuclease BN, putative [Streptococcus pneumoniae CCRI 1974]
 gi|237821691|ref|ZP_04597536.1| ribonuclease BN, putative [Streptococcus pneumoniae CCRI 1974M2]
 gi|303254762|ref|ZP_07340863.1| ribonuclease BN, putative [Streptococcus pneumoniae BS455]
 gi|303259930|ref|ZP_07345904.1| ribonuclease BN, putative [Streptococcus pneumoniae SP-BS293]
 gi|303261335|ref|ZP_07347283.1| ribonuclease BN, putative [Streptococcus pneumoniae SP14-BS292]
 gi|303264001|ref|ZP_07349922.1| ribonuclease BN, putative [Streptococcus pneumoniae BS397]
 gi|303266315|ref|ZP_07352205.1| ribonuclease BN, putative [Streptococcus pneumoniae BS457]
 gi|303268782|ref|ZP_07354570.1| ribonuclease BN, putative [Streptococcus pneumoniae BS458]
 gi|307067275|ref|YP_003876241.1| hypothetical protein SPAP_0646 [Streptococcus pneumoniae AP200]
 gi|14972130|gb|AAK74802.1| putative ribonuclease BN [Streptococcus pneumoniae TIGR4]
 gi|147756963|gb|EDK64003.1| ribonuclease BN, putative [Streptococcus pneumoniae SP11-BS70]
 gi|147759659|gb|EDK66650.1| ribonuclease BN, putative [Streptococcus pneumoniae SP14-BS69]
 gi|147930573|gb|EDK81555.1| ribonuclease BN, putative [Streptococcus pneumoniae SP23-BS72]
 gi|168995849|gb|ACA36461.1| ribonuclease BN [Streptococcus pneumoniae Hungary19A-6]
 gi|172043652|gb|EDT51698.1| ribonuclease BN [Streptococcus pneumoniae CDC1873-00]
 gi|183569882|gb|EDT90410.1| ribonuclease BN [Streptococcus pneumoniae CDC1087-00]
 gi|183576826|gb|EDT97354.1| ribonuclease BN [Streptococcus pneumoniae CDC3059-06]
 gi|183578570|gb|EDT99098.1| ribonuclease BN [Streptococcus pneumoniae MLV-016]
 gi|225720351|gb|ACO16205.1| ribonuclease BN [Streptococcus pneumoniae 70585]
 gi|225727432|gb|ACO23283.1| ribonuclease BN [Streptococcus pneumoniae Taiwan19F-14]
 gi|301799695|emb|CBW32260.1| ribonuclease BN-like family protein [Streptococcus pneumoniae
           OXC141]
 gi|301801520|emb|CBW34212.1| ribonuclease BN-like family protein [Streptococcus pneumoniae
           INV200]
 gi|302598302|gb|EFL65347.1| ribonuclease BN, putative [Streptococcus pneumoniae BS455]
 gi|302637469|gb|EFL67956.1| ribonuclease BN, putative [Streptococcus pneumoniae SP14-BS292]
 gi|302638849|gb|EFL69310.1| ribonuclease BN, putative [Streptococcus pneumoniae SP-BS293]
 gi|302641647|gb|EFL72006.1| ribonuclease BN, putative [Streptococcus pneumoniae BS458]
 gi|302644126|gb|EFL74383.1| ribonuclease BN, putative [Streptococcus pneumoniae BS457]
 gi|302646406|gb|EFL76632.1| ribonuclease BN, putative [Streptococcus pneumoniae BS397]
 gi|306408812|gb|ADM84239.1| Predicted membrane protein [Streptococcus pneumoniae AP200]
 gi|327390387|gb|EGE88728.1| ribonuclease BN-like family protein [Streptococcus pneumoniae
           GA04375]
 gi|332075951|gb|EGI86417.1| ribonuclease BN-like family protein [Streptococcus pneumoniae
           GA41301]
 gi|332203816|gb|EGJ17883.1| ribonuclease BN-like family protein [Streptococcus pneumoniae
           GA47368]
          Length = 286

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 118/249 (47%), Gaps = 23/249 (9%)

Query: 36  LLSVFPFIVFGANLAGF--LGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGL 93
           L+S+FP ++   N+  +  +   +F+  + DV+    P  + + +     +VL  P+ GL
Sbjct: 38  LISIFPLLLVVVNILPYFQIPVGEFLGFMKDVL----PPSLYEGVEKIAREVLTQPSTGL 93

Query: 94  FTISALAAAYFSSNGVEALRISLNRAYRVVEMRS----WYITRLISFGYVLLASVTLVIM 149
            + S L+A +  S  +  L+ + N+AY V + R       ++ L+SFG  LL +  L ++
Sbjct: 94  LSFSVLSALWSFSKSMNFLQKAFNKAYGVEKSRGLISHQMLSLLVSFGLQLLFAFALFLI 153

Query: 150 SFVFVAIPLALAYVRK---FFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPA-AKS 205
            F  + + L   Y  K    + AL  L        IYA + A+   L+ ++ FLP  +  
Sbjct: 154 LFGQMILALLAHYWTKDGIIYQALQGLA----GPLIYALLFAI---LVMLYYFLPNLSNR 206

Query: 206 KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY--MLGVFFI 263
           KI   LPG  F  +  +    LF+ Y+  +  +      L S++  ++  +  ++    I
Sbjct: 207 KISYTLPGSAFVLLVILGLLTLFSSYLNYYVHHLVDVRILGSVLLVVMMFWFILIAKIVI 266

Query: 264 LGAELNASM 272
           LGA +NASM
Sbjct: 267 LGAVINASM 275


>gi|92119332|ref|YP_579061.1| ribonuclease BN, putative [Nitrobacter hamburgensis X14]
 gi|91802226|gb|ABE64601.1| ribonuclease BN, putative [Nitrobacter hamburgensis X14]
          Length = 386

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 122/279 (43%), Gaps = 20/279 (7%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R +  I+  +  +  EH +    +A+A+ ++  +L ++FP +     + G       +  
Sbjct: 78  RRWKDILLRVYANVSEHRI----FALAAGMTYYSLFAIFPALAAMVAVYGLFSDPATIAK 133

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTIS-----ALAAAYFSSNG-VEALRIS 115
             D V G  P   +  I     Q+  V +KG  T+       LA + +S+N  +++L  +
Sbjct: 134 HFDQVSGFVP---SGAIDVAREQLTRVASKGNQTLGLTFAIGLAVSLWSANAAMKSLFDT 190

Query: 116 LNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL- 174
           LN  Y   E R +     +S  + +   V ++      V +P+ L YV      L N   
Sbjct: 191 LNIVYGEKETRGFVKLNAMSLAFTMTGIVFVLAALGAVVVVPVILNYV-----GLSNFAD 245

Query: 175 LIIWNGRIYATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIV 233
           L++   R  A  + + + L  ++ F P  ++ +   I  G     I W+  + LF+ Y  
Sbjct: 246 LLVRTARWPAMFVGVALALALIYRFGPDREAPRWRWITWGSAVATILWLAASTLFSWYAA 305

Query: 234 TFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
            F  ++  Y  L + +  + +L++  +  +LGAEL+A M
Sbjct: 306 NFGKFNETYGSLGAAIGFMTWLWISAIVILLGAELDAQM 344


>gi|260575792|ref|ZP_05843788.1| ribonuclease BN [Rhodobacter sp. SW2]
 gi|259021945|gb|EEW25245.1| ribonuclease BN [Rhodobacter sp. SW2]
          Length = 277

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 99/209 (47%), Gaps = 15/209 (7%)

Query: 71  PEVIAKPITDEILQVLAVPAK--GLFTISALAAAYFSSN-GVEALRISLNRAYRVVE--- 124
           P   A  + D+I  ++  P    G  T+ +L  A +S+  G+ AL   L+  +R      
Sbjct: 71  PHDAAVLVHDQITALITTPKVHLGWATLLSLGIAVYSARAGISALIQGLDVVHRATPRGL 130

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
           ++ W++  +++   +     T+++     V +PL L +V         LL + W     A
Sbjct: 131 LQGWWVEFVMTMSLI----TTVLVALATVVIVPLVLNFVTLGVLEGWMLLALPWG----A 182

Query: 185 TMLALFIGLIFVHLFLP-AAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            +L L   LI ++ F P   + ++  ++PG     + W + ++  + Y+  F++Y+ +Y 
Sbjct: 183 MVLLLMSCLIILYRFGPNTPQRRVHRVIPGAFLAALVWAMVSIALSAYLANFNSYNRIYG 242

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASM 272
            + +++  L +LY+     +LGA +NA +
Sbjct: 243 SIGAVIALLSWLYLSVWSVLLGAAVNAEI 271


>gi|288962283|ref|YP_003452578.1| ribonuclease BN [Azospirillum sp. B510]
 gi|288914549|dbj|BAI76034.1| ribonuclease BN [Azospirillum sp. B510]
          Length = 353

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/260 (21%), Positives = 110/260 (42%), Gaps = 27/260 (10%)

Query: 27  MASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVL 86
           +A+ +S  ALL++FP +    ++ G +     + T +  + G  P      ++D+  +V 
Sbjct: 71  LAAGVSYYALLAIFPAVAALVSIFGLVADPAMIETQLSQLRGLLPPEALTIVSDQARKVA 130

Query: 87  AVPAKGL---FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLA- 142
             P++GL        L   + +S G  +L  +LN AY   E R          G+++LA 
Sbjct: 131 TAPSQGLGFGLIFGLLLTLWSASRGTNSLVTALNIAYGEKETR----------GFLMLAA 180

Query: 143 -SVTLVIMSFVFVAIPLALAYVR---------KFFPALGNLLLIIWNGRIYATMLALFIG 192
            S+ L +   +FV + +AL             +  PA     L  W          +   
Sbjct: 181 LSMGLTVAGLLFVIVAMALIIAVPAAIAIVGLQDTPAGWIANLARW---PILAAAIMLAL 237

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
            +F        + +   +  G     + W++G++ F+ Y+  F +Y+  Y  + +++  L
Sbjct: 238 AVFYRYAPDRREPRWRWVTWGSAMATMVWLLGSLGFSVYVSNFGSYNETYGSVGAVVILL 297

Query: 253 VFLYMLGVFFILGAELNASM 272
           ++  +     +LGAELNA +
Sbjct: 298 LWFNLTSYVVLLGAELNAEI 317


>gi|58697944|ref|ZP_00372948.1| ribonuclease, BN family [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|58535551|gb|EAL59534.1| ribonuclease, BN family [Wolbachia endosymbiont of Drosophila
           simulans]
          Length = 200

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 75/166 (45%), Gaps = 18/166 (10%)

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+ I   +   I ++++ P + L T++ + A + +S+ +E LR  LN+AY+V     + +
Sbjct: 42  PQDILSSLMPRIREIISGPPQSLLTLAIVGAVWTASSTIEGLRTILNKAYKVPVSPPYIL 101

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML--- 187
            R++S            I+ F+ + + + L  V  F   +  L+   + G  Y   L   
Sbjct: 102 RRVLS------------ILQFLVITLIITLTIV--FSTLVPMLIDFSYQGLSYTRYLLIE 147

Query: 188 -ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYI 232
             LF  + +++  LP  K  +  + PG     I W + A  F  Y+
Sbjct: 148 FVLFTVVSWLYFMLPNIKQNLSDVFPGSCVAVILWTISASAFKQYL 193


>gi|161507147|ref|YP_001577101.1| hypothetical protein lhv_0656 [Lactobacillus helveticus DPC 4571]
 gi|160348136|gb|ABX26810.1| Predicted membrane protein [Lactobacillus helveticus DPC 4571]
          Length = 307

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 104/217 (47%), Gaps = 20/217 (9%)

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV--VEMR- 126
           +P+ ++  I   I  +L   + G  +   + A +  SN V A+R+  NR Y V  VE++ 
Sbjct: 72  FPDQVSSFIMPIINSLLKTTSTGYISFGIILAIWSFSNLVNAIRLGENRLYGVHQVELKL 131

Query: 127 ---SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLI------- 176
              ++  TRLI     ++   TL+I+  +F A+ + LA+ ++    +  +  I       
Sbjct: 132 SMLNFLWTRLI-----MVIFTTLMII--IFTAVGVVLAFGQELLDLMDAIFKIPVHEVGK 184

Query: 177 IWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFS 236
           I++ R     L + + + +++  LP  K K   I PGV  T   W+  + LF+ Y+  F 
Sbjct: 185 IFSYRYPVIFLIIILAVFYLNYVLPNIKLKKRVIWPGVFVTSCGWIALSFLFSFYLHNFP 244

Query: 237 TYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
                Y  + + +  +++L +  + F+ G  +NA++I
Sbjct: 245 ITWKNYGIVGTFIIFMLWLNIASLLFLFGVAVNATII 281


>gi|158313101|ref|YP_001505609.1| ribonuclease BN [Frankia sp. EAN1pec]
 gi|158108506|gb|ABW10703.1| ribonuclease BN [Frankia sp. EAN1pec]
          Length = 360

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 74/156 (47%), Gaps = 5/156 (3%)

Query: 119 AYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYV--RKFFPALGNLLLI 176
           AY   E+RS   +RL++ G  L    T V++    V  P  L+ +      P + +LL I
Sbjct: 181 AYGQRELRSAVRSRLLALGLFLAQVATGVLLLPALVLGPGLLSDMLNSGRHPVVDDLLKI 240

Query: 177 IWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFS 236
           ++   +    LA+   L   HL LP  +S     LPG       W+VG+ L   Y+    
Sbjct: 241 LFWPVVGVVSLAMLTTLY--HLALPVRRS-WRRALPGAALALFLWLVGSY