BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780367|ref|YP_003064780.1| ribonuclease protein
[Candidatus Liberibacter asiaticus str. psy62]
         (281 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|323464029|gb|ADX76182.1| ribonuclease BN-like family protein [Staphylococcus
           pseudintermedius ED99]
          Length = 445

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 63/270 (23%), Positives = 127/270 (47%), Gaps = 2/270 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           +     I    ++D   +A+ ++   +LS+FP ++F  +L           T+   +   
Sbjct: 85  NFFNYLIYRIGKDDASGLAAQLAYYFMLSLFPMLIFILSLVPLFNIDS--DTITAQISKN 142

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  IT  I  V+   + GL +I  + A + +SNG+ A+  + N AY V + R++ 
Sbjct: 143 APAETSSIITGIIDDVMGNASGGLLSIGLILALWTASNGMTAMMNAFNVAYDVEDSRNFV 202

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           +++L++  + LL  +TL +   +F         +         +  +    R    +LA+
Sbjct: 203 VSKLLAIFFTLLIGITLPLTLVLFTFGEQIGNLLFGPLGLDEQVRWVFSLLRTALPVLAV 262

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            I    ++   P  K +  S++PG +F+ I W++G++ F  Y+  F+ YS  Y  +  ++
Sbjct: 263 LIVFTIIYTLAPNVKIRFKSVIPGALFSTIVWILGSLAFGFYVSNFANYSKTYGSIGGVI 322

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             +++LY+ G   I+GAE+NA +      K
Sbjct: 323 VLMLWLYITGFILIIGAEINAIVHQRKVIK 352


>gi|319892923|ref|YP_004149798.1| Ribonuclease BN [Staphylococcus pseudintermedius HKU10-03]
 gi|317162619|gb|ADV06162.1| Ribonuclease BN [Staphylococcus pseudintermedius HKU10-03]
          Length = 445

 Score =  222 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 63/270 (23%), Positives = 127/270 (47%), Gaps = 2/270 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           +     I    ++D   +A+ ++   +LS+FP ++F  +L           T+   +   
Sbjct: 85  NFFNYLIYRIGKDDASGLAAQLAYYFMLSLFPMLIFILSLVPLFNIDS--DTITAQISKN 142

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  IT  I  V+   + GL +I  + A + +SNG+ A+  + N AY V + R++ 
Sbjct: 143 APAETSSIITGIIDDVMGNASGGLLSIGLILALWTASNGMTAMMNAFNVAYDVEDSRNFV 202

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           +++L++  + LL  +TL +   +F         +         +  +    R    +LA+
Sbjct: 203 VSKLLAIFFTLLIGITLPLTLVLFTFGEQIGNLLFGPLGLDEQVRWVFSLLRTALPVLAV 262

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            I    ++   P  K +  S++PG +F+ I W++G++ F  Y+  F+ YS  Y  +  ++
Sbjct: 263 LIVFTIIYTLAPNVKIRFKSVIPGALFSTIVWILGSLAFGFYVSNFANYSKTYGSIGGVI 322

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             +++LY+ G   I+GAE+NA +      K
Sbjct: 323 VLMLWLYITGFILIIGAEINAIVHQRKVIK 352


>gi|325961896|ref|YP_004239802.1| YihY family protein [Arthrobacter phenanthrenivorans Sphe3]
 gi|323467983|gb|ADX71668.1| YihY family protein [Arthrobacter phenanthrenivorans Sphe3]
          Length = 404

 Score =  208 bits (530), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 61/270 (22%), Positives = 112/270 (41%), Gaps = 3/270 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVIDVVFGA 69
           I+   +  F ++    +A+ ++  A+LS+FP I+   +L G  G  Q     ++ +V G 
Sbjct: 40  ILKKTLREFNKDQCPDLAAALTYYAVLSLFPAILALVSLIGLFGDPQKTTDALLQIVRGF 99

Query: 70  WPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            P   A  +   +  + + PA GL   I    A + +S  V A   ++NR Y V E R +
Sbjct: 100 VPAETADTVGGVVSDLASAPAAGLTLIIGLATALWSASGYVGAFGRAMNRIYEVDEGRPF 159

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
              R       LLA V + I++ + V        V       G  L I    +    +  
Sbjct: 160 VKLRGTMLVVTLLAVVIVAILAGMLVLSGPVAEAVGGLIGLSGVFLAIWDIAKWPVMVGL 219

Query: 189 LFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           + + +  ++   P  K      +  G       ++V ++ F  Y+  F  Y+  Y  L  
Sbjct: 220 IIVIIAVLYYATPNVKQPKFKWMSMGSGIALFVFLVASLGFGFYVGNFGNYNKTYGTLGG 279

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           ++  L++L++L +  + GAE +A M     
Sbjct: 280 VIVMLLWLWILNMSLLFGAEFDAEMERGRQ 309


>gi|242371808|ref|ZP_04817382.1| ribonuclease BN [Staphylococcus epidermidis M23864:W1]
 gi|242350509|gb|EES42110.1| ribonuclease BN [Staphylococcus epidermidis M23864:W1]
          Length = 418

 Score =  208 bits (530), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 67/271 (24%), Positives = 124/271 (45%), Gaps = 2/271 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L++FP ++F   L G          +   V   
Sbjct: 73  NFLKYLIYRIGKDDASGLAAQMTYHFVLAMFPMLIFLLTLLGQF-ITINTDQINHKVSQY 131

Query: 70  WPEV-IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            P+   A  +T     +      G+ +I  + A + +SNG+ A+  S N AY V + R+ 
Sbjct: 132 IPDQSTADVVTKIFSSISDSANGGVLSIGLILAIWSASNGMSAIINSFNVAYDVEDARNG 191

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
            + +++S  Y L+  +  V+   +    P+   ++         +  I    RI   ++ 
Sbjct: 192 IVLKILSVIYTLVLGIVFVVAIVLITLGPVISKFLFGPLGLDKQVEWIFDVVRIVLPLII 251

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           + I    ++   P  K+K+ S+LPG +FT I W+VG+ LF  YI  F  Y+  Y  LA I
Sbjct: 252 IIILFTVLYSVAPNVKTKLRSVLPGALFTSIIWLVGSFLFGWYISNFGNYNKTYGSLAGI 311

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           +   ++LY+     I+GAE+NA +      K
Sbjct: 312 IILFLWLYITSFIIIIGAEINAIIHQRKVIK 342


>gi|223044001|ref|ZP_03614041.1| transporter [Staphylococcus capitis SK14]
 gi|222442544|gb|EEE48649.1| transporter [Staphylococcus capitis SK14]
          Length = 417

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 67/271 (24%), Positives = 125/271 (46%), Gaps = 2/271 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L++FP ++F   L G          +   V   
Sbjct: 73  NFLNYLIYRIGKDDASGLAAQMTYHFVLAMFPMLIFLLTLLGQF-ITINTDQINQKVSQY 131

Query: 70  WPEV-IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            P+   A  IT     +      G+ +I  + A + +SNG+ A+  S N AY V + R+ 
Sbjct: 132 VPDQSTADVITKIFSGISDSANGGVLSIGLILAIWSASNGMSAIINSFNVAYDVEDSRNG 191

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           ++ +++S  Y L+  +  V+   +    P+   ++         +  +    RI   ++ 
Sbjct: 192 FVLKILSVLYTLVLGIVFVVAIVLITLGPVISKFLFGPLGLDKQVEWVFDLVRIVLPLII 251

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           + I    ++   P  K+K+ S+LPG +FT I W+VG+ LF  YI  F  Y+  Y  LA I
Sbjct: 252 IIILFTVLYSVAPNVKTKLRSVLPGALFTSIIWLVGSFLFGWYISNFGNYNKTYGSLAGI 311

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           +   ++LY+     I+GAE+NA +      K
Sbjct: 312 IILFLWLYITSFIIIIGAEINAIIHQRTVIK 342


>gi|73662219|ref|YP_301000.1| hypothetical protein SSP0910 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|72494734|dbj|BAE18055.1| conserved hypothetical protein [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 390

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 63/267 (23%), Positives = 127/267 (47%), Gaps = 2/267 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           +     +    ++D   +++ +S   +LS+FP ++F  ++   +G  Q   T+ D++   
Sbjct: 73  NFFSYLVYRIGKDDASGLSAQLSYYFMLSLFPMLLFLLSIVPVVGVKQ--STIRDLIKDH 130

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   A  ++  I  ++   + GL +I  +AA + +SNG+ AL  + N AY V + R++ 
Sbjct: 131 VPSDYAPQVSGIIGDIMENASGGLLSIGLIAALWSASNGMTALMNAFNVAYDVEDSRNFV 190

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L S  + L   + + +   +          +         +  +    R    ++ +
Sbjct: 191 VAKLYSVLFTLAMIIVMPVALVLPTFGQQIGDLLFGPLGLGDQVKWLFDTIRFVLPVIVV 250

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            I  + ++   P  K K++S++PG IF  I ++ G+ LF  YI  F+ YS  Y  +A I+
Sbjct: 251 LIAFMVLYTLAPNVKIKLLSVIPGAIFATIVFLGGSYLFGIYISNFANYSKTYGSIAGII 310

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYY 276
             +++LY+ G   I+GAE+NA      
Sbjct: 311 ILMLWLYITGFIIIIGAEINAIFHQRK 337


>gi|269125476|ref|YP_003298846.1| ribonuclease BN [Thermomonospora curvata DSM 43183]
 gi|268310434|gb|ACY96808.1| ribonuclease BN [Thermomonospora curvata DSM 43183]
          Length = 445

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 56/269 (20%), Positives = 109/269 (40%), Gaps = 3/269 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D++      F E++    A+ ++  A+LS+FP ++   +L G  G      ++I  V   
Sbjct: 140 DLLKRTFREFKEDNLTDWAAALTYYAVLSIFPAMLVIISLIGL-GGASLSESIIRNVGDL 198

Query: 70  WPEVIAKPITDEILQVL--AVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
            P  +   +   + ++   A  A  +  I  +AA + +S  V A   + N  Y + E R 
Sbjct: 199 APGAVRDVLATALTELQRGAGAAGLVAVIGLVAAVWSASGYVAAFMRASNAIYDLPEGRP 258

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            + T  I     L++   L   +   V                   + +    +    ++
Sbjct: 259 IWKTLPIRIAVTLVSLTLLSASAIAVVISGPLARKAGDLLGLGDAAVTVWNIAKWPVLLV 318

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           A+      ++   P AK     + PG +     W++ +V F  Y+  F +Y+  Y  LA 
Sbjct: 319 AIAFLFALLYWASPNAKRGFTWVTPGGLLALAVWLLASVGFAFYVANFGSYNKTYGSLAG 378

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYY 276
           ++  LV+L++  +  +LG ELNA +    
Sbjct: 379 VIIFLVWLWISNIALLLGVELNAELQRAR 407


>gi|220911338|ref|YP_002486647.1| ribonuclease BN [Arthrobacter chlorophenolicus A6]
 gi|219858216|gb|ACL38558.1| ribonuclease BN [Arthrobacter chlorophenolicus A6]
          Length = 402

 Score =  199 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 59/270 (21%), Positives = 110/270 (40%), Gaps = 3/270 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVIDVVFGA 69
           I    +  F ++    +A+ ++  A+LS+FP I+   +L G  G  Q     ++ +V G 
Sbjct: 40  IAKKTLREFSKDQCPDLAASLTYYAVLSLFPAILALVSLVGLFGDPQKTTDALLQIVSGF 99

Query: 70  WPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            P      I   +  +   PA G    I    A + +S  V A   +LNR Y V E R +
Sbjct: 100 VPGETMDTIGGVVKDLANAPAAGFTLVIGLGTALWSASGYVGAFGRALNRVYEVDEGRPF 159

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
              R       LLA V + I++ + V        V  F    G  L +    +    ++ 
Sbjct: 160 VKLRGTMLAVTLLAIVIIAILAGMLVLSGPVAEAVGGFIGLSGVFLAVWNIAKWPVMVVL 219

Query: 189 LFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           + + +  ++   P  K      +  G     + +++ ++ F  Y+  F  Y+  Y  L  
Sbjct: 220 IIVIIAVLYYATPNVKQPKFKWMSMGSGIALVVFLLASLGFGFYVGNFGNYNKTYGALGG 279

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           ++  L++L++L +  + GAE +A       
Sbjct: 280 VIVMLLWLWILNMSLLFGAEFDAETERGRQ 309


>gi|314934048|ref|ZP_07841411.1| YihY family protein [Staphylococcus caprae C87]
 gi|313653159|gb|EFS16918.1| YihY family protein [Staphylococcus caprae C87]
          Length = 417

 Score =  199 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 67/271 (24%), Positives = 124/271 (45%), Gaps = 2/271 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ +    +L++FP ++F   L G          +   V   
Sbjct: 73  NFLNYLIYRIGKDDASGLAAQMMYHFVLAMFPMLIFLLTLLGQF-ITINTDQINQKVSQY 131

Query: 70  WPEV-IAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            P+   A  IT     +      G+ +I  + A + +SNG+ A+  S N AY V + R+ 
Sbjct: 132 VPDQSTADVITKIFSGISDSANGGVLSIGLILAIWSASNGMSAIINSFNVAYDVEDSRNG 191

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           ++ +++S  Y L+  +  V+   +    P+   ++         +  +    RI   ++ 
Sbjct: 192 FVLKILSVLYTLVLGIVFVVAIVLITLGPVISKFLFGPLGLDKQVEWVFDLVRIVLPLII 251

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           + I    ++   P  K+K+ S+LPG +FT I W+VG+ LF  YI  F  Y+  Y  LA I
Sbjct: 252 IIILFTVLYSVAPNVKTKLRSVLPGALFTSIIWLVGSFLFGWYISNFGNYNKTYGSLAGI 311

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           +   ++LY+     I+GAE+NA +      K
Sbjct: 312 IILFLWLYITSFIIIIGAEINAIIHQRTVIK 342


>gi|111019911|ref|YP_702883.1| tRNA processing ribonuclease BN [Rhodococcus jostii RHA1]
 gi|110819441|gb|ABG94725.1| tRNA processing ribonuclease BN [Rhodococcus jostii RHA1]
          Length = 346

 Score =  192 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 57/273 (20%), Positives = 112/273 (41%), Gaps = 3/273 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVV 66
            + +I      F  +    +A+ ++  A+LS+FP ++   +L G  G   +    V+ +V
Sbjct: 28  WWYVIRKTAHEFTRDQCTDLAAALTYYAVLSLFPALLALVSLLGVFGQGQRTTDAVLQMV 87

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
               P      + D I Q++A P  G+   +  L A + +S  + A   ++NR Y V E 
Sbjct: 88  DDLGPSSAVDTLRDPIAQLVAAPTAGMALVLGLLGAVWSASGYIGAFGRAMNRMYEVEEG 147

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R  +  R       ++  V +   + +          V          L +    R    
Sbjct: 148 RPVWKLRPQMLAVTIVGLVLVAAAAAMLALSGPVARSVGDTIGFGDTALTVWNIARWPFV 207

Query: 186 MLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
           +  + + +  ++   P  K      I  G     ++W+V +VLF  Y+  F +Y+  Y  
Sbjct: 208 LGIVVVAVAILYYVTPNVKQPKFRWISAGAFLAIVTWIVASVLFGLYVANFGSYNKTYGS 267

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           LA ++  L++L++  +  + GAEL+A +     
Sbjct: 268 LAGVIVFLLWLWITNLALLFGAELDAELERGRE 300


>gi|329940661|ref|ZP_08289942.1| ribonuclease [Streptomyces griseoaurantiacus M045]
 gi|329300722|gb|EGG44619.1| ribonuclease [Streptomyces griseoaurantiacus M045]
          Length = 393

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 49/270 (18%), Positives = 106/270 (39%), Gaps = 4/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           ++    +  F  ++    A+ ++   +LS+FP ++   +  G  G       ++D V   
Sbjct: 88  EVFKGTLREFKNDELTDRAAALTYYGVLSLFPALLVLVSFLGMTGK-STTDKLLDQVDSL 146

Query: 70  WPEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
            P   +  +T  + Q+      G  +  +  + A + +S  + A   + N  Y V E R 
Sbjct: 147 APGSASDIVTKAVRQLQDNGGTGSIMAVVGIVLALWSASGYIAAFIRTANAVYDVPEGRP 206

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            +    +     ++  V  +I S + V                   L +    +    ++
Sbjct: 207 VWKVLPLRLAVTVVLMVLAIISSCIVVFTGGIAKRAGDALGLGDTALTVWSIAKWPVLVI 266

Query: 188 ALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
            + I +  ++   P AK +    I PG +   + W+V +  F  Y+  F +Y+  Y  +A
Sbjct: 267 LVTIMIAILYWSTPNAKVRGFRWITPGSLLALLIWLVASAGFAFYVANFGSYNKTYGTMA 326

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            ++  LV+L++  +  +LG E +A      
Sbjct: 327 GVIVFLVWLWISNLAILLGLEFDAETARQR 356


>gi|319399849|gb|EFV88096.1| YihY family protein [Staphylococcus epidermidis FRI909]
          Length = 392

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 65/267 (24%), Positives = 122/267 (45%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           +     I    ++D   +A+ ++   +L++FP ++F   L G             V    
Sbjct: 66  NFFSYLIYRIGKDDAAGLAAQMTYHFVLALFPMLIFLLTLLGQFITIDANQINQKVSQYV 125

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
             +  A  +   +  +    + G+ ++  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 126 PDQETASIVGGIVKDISDTASGGILSVGLILAIWSASNGMSAIINSFNVAYDVEDSRNGI 185

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  Y L+     V+   +    P+   ++         +  I    RI   ++ +
Sbjct: 186 VVKLLSILYTLVLGAVFVVAVVLITLGPVINKFLFGPLGIDNQIEWIFNLVRIVIPLIII 245

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI    ++   P  K+K+ S++PG IFT I W++G+  F +YI  FS YS  Y  LA I+
Sbjct: 246 FIIFTVLYSVAPNVKTKLRSVIPGAIFTSIIWLLGSFAFGYYISNFSNYSKTYGSLAGII 305

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYY 276
              ++LY+     I+GAE+NA +    
Sbjct: 306 ILFLWLYITSFIIIIGAEINAIIHQRK 332


>gi|57867339|ref|YP_188990.1| ribonuclease BN [Staphylococcus epidermidis RP62A]
 gi|251809911|ref|ZP_04824384.1| ribonuclease BN [Staphylococcus epidermidis BCM-HMP0060]
 gi|282874567|ref|ZP_06283452.1| YihY family protein [Staphylococcus epidermidis SK135]
 gi|293367803|ref|ZP_06614452.1| YihY family protein [Staphylococcus epidermidis M23864:W2(grey)]
 gi|57637997|gb|AAW54785.1| ribonuclease BN, putative [Staphylococcus epidermidis RP62A]
 gi|251806576|gb|EES59233.1| ribonuclease BN [Staphylococcus epidermidis BCM-HMP0060]
 gi|281296706|gb|EFA89215.1| YihY family protein [Staphylococcus epidermidis SK135]
 gi|291318142|gb|EFE58539.1| YihY family protein [Staphylococcus epidermidis M23864:W2(grey)]
 gi|329726921|gb|EGG63379.1| YihY family protein [Staphylococcus epidermidis VCU144]
 gi|329734775|gb|EGG71081.1| YihY family protein [Staphylococcus epidermidis VCU045]
 gi|329734799|gb|EGG71104.1| YihY family protein [Staphylococcus epidermidis VCU028]
          Length = 392

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 65/267 (24%), Positives = 122/267 (45%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           +     I    ++D   +A+ ++   +L++FP ++F   L G             V    
Sbjct: 66  NFFSYLIYRIGKDDAAGLAAQMTYHFVLALFPMLIFLLTLLGQFITIDANQINQKVSQYV 125

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
             +  A  +   +  +    + G+ ++  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 126 PDQETASIVGGIVKDISDTASGGILSVGLILAIWSASNGMSAIINSFNVAYDVEDSRNGV 185

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  Y L+     V+   +    P+   ++         +  I    RI   ++ +
Sbjct: 186 VVKLLSILYTLVLGAVFVVAVVLITLGPVINKFLFGPLGIDNQIEWIFNLVRIVIPLIII 245

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI    ++   P  K+K+ S++PG IFT I W++G+  F +YI  FS YS  Y  LA I+
Sbjct: 246 FIIFTVLYSVAPNVKTKLRSVIPGAIFTSIIWLLGSFAFGYYISNFSNYSKTYGSLAGII 305

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYY 276
              ++LY+     I+GAE+NA +    
Sbjct: 306 ILFLWLYITSFIIIIGAEINAIIHQRK 332


>gi|27468486|ref|NP_765123.1| transporter [Staphylococcus epidermidis ATCC 12228]
 gi|27316033|gb|AAO05167.1|AE016749_113 transporter [Staphylococcus epidermidis ATCC 12228]
          Length = 392

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 65/267 (24%), Positives = 122/267 (45%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           +     I    ++D   +A+ ++   +L++FP ++F   L G             V    
Sbjct: 66  NFFSYLIYRIGKDDAAGLAAQMTYHFVLALFPMLIFLLTLLGQFITIDANQINQKVSQYV 125

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
             +  A  +   +  +    + G+ ++  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 126 PDQETASIVGGIVKDISDTASGGILSVGLILAIWSASNGMSAIINSFNVAYDVEDSRNGV 185

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  Y L+     V+   +    P+   ++         +  I    RI   ++ +
Sbjct: 186 VVKLLSILYTLVLGAVFVVAVVLITLGPVINKFLFGPLGIDNQIEWIFNLVRIVIPLIII 245

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI    ++   P  K+K+ S++PG IFT I W++G+  F +YI  FS YS  Y  LA I+
Sbjct: 246 FIIFTVLYSVAPNVKTKLRSVIPGAIFTSIIWLLGSFAFGYYISNFSNYSKTYGSLAGII 305

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYY 276
              ++LY+     I+GAE+NA +    
Sbjct: 306 ILFLWLYITSFIIIIGAEINAIIHQRK 332


>gi|297196223|ref|ZP_06913621.1| ribonuclease BN family membrane protein [Streptomyces
           pristinaespiralis ATCC 25486]
 gi|197720035|gb|EDY63943.1| ribonuclease BN family membrane protein [Streptomyces
           pristinaespiralis ATCC 25486]
          Length = 390

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 53/279 (18%), Positives = 116/279 (41%), Gaps = 7/279 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +++ F     ++   ++ F +++    A+ ++   +L++FP ++   +L G +G      
Sbjct: 85  LKKSFG---QVLRGTLKEFKDDELTDRAAALTYYGILALFPALLVLVSLLGIMG-QSTTQ 140

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNR 118
            V++ +    P      IT+ + Q+    + G  L  I  L A + +S  V A   S N 
Sbjct: 141 KVLENIQQLAPGPARDVITNAVTQLQGSSSTGSILAIIGLLGALWSASGYVAAFIRSSNA 200

Query: 119 AYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIW 178
            Y V E R  +    +  G  L   +   + + + +        +          + +  
Sbjct: 201 VYDVPEGRPAWKVLPVRLGVTLALMIMACVSALIVILSGGIAQQLGTALGVGDTAMTVWT 260

Query: 179 NGRIYATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
             +    ++ + + +  ++   P AK +    I PG     + W+V +  F  Y+  F +
Sbjct: 261 YAKWPVLVVLVSVMVALLYWATPNAKVRGFKWITPGSFIAVLIWLVASAGFAFYVANFGS 320

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           Y+  Y  LA I+  LV+L++  +  +LG E +A ++   
Sbjct: 321 YNKTYGTLAGIIIFLVWLWITNLAILLGLEFDAELVRER 359


>gi|242241721|ref|ZP_04796166.1| ribonuclease BN [Staphylococcus epidermidis W23144]
 gi|242234811|gb|EES37122.1| ribonuclease BN [Staphylococcus epidermidis W23144]
          Length = 392

 Score =  189 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 65/267 (24%), Positives = 122/267 (45%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           +     I    ++D   +A+ ++   +L++FP ++F   L G             V    
Sbjct: 66  NFFSYLIYRIGKDDAAGLAAQMTYHFVLALFPMLIFLLTLLGQFITIDANQINQKVSQYV 125

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
             +  A  +   +  +    + G+ ++  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 126 PDQETASIVGGIVKDISDTASGGILSVGLILAIWSASNGMSAIINSFNVAYDVEDSRNGI 185

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  Y L+     V+   +    P+   ++         +  I    RI   ++ +
Sbjct: 186 VVKLLSILYTLVLGAVFVVAVVLITLGPVINKFLFGPLGIDNQIEWIFNLVRIVIPLIII 245

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI    ++   P  K+K+ S++PG IFT I W++G+  F +YI  FS YS  Y  LA I+
Sbjct: 246 FIIFTVLYSVAPNVKTKLRSVIPGAIFTSIIWLLGSFAFGYYISNFSNYSKTYGSLAGII 305

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYY 276
              ++LY+     I+GAE+NA +    
Sbjct: 306 ILFLWLYITSFIIIIGAEINAIIHQRK 332


>gi|226362631|ref|YP_002780409.1| ribonuclease [Rhodococcus opacus B4]
 gi|226241116|dbj|BAH51464.1| putative ribonuclease [Rhodococcus opacus B4]
          Length = 363

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 55/273 (20%), Positives = 116/273 (42%), Gaps = 3/273 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVV 66
            + +I      F  ++   +A+ ++  A+LS+FP ++   +L G  G   +   TV+ +V
Sbjct: 28  WWYVIRKTAHEFTRDECTDLAAALTYYAVLSLFPALLAMVSLLGVFGQGQRTTDTVLQIV 87

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
               P      + D I Q++  P+ G    +  L A + +S  + A   ++NR Y V E 
Sbjct: 88  DDLGPSSAVDTLRDPITQLVQTPSAGAALILGLLGAVWSASGYIGAFGRAMNRIYEVEEG 147

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R  +  R +     L+  V + + + +          V          L +    R    
Sbjct: 148 RPVWKLRPLQLLVTLVGLVLVALAALMLAISGPVARSVGDAIGFGDTALTVWNIARWPFI 207

Query: 186 MLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
           +  + + +  ++   P  +      +  G +   ++W++ +VLF  Y+  F +Y+  Y  
Sbjct: 208 LGVVIVAVAILYYVTPNVQQPKFRWVSAGALVGIVTWILVSVLFGLYVSNFGSYNKTYGS 267

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           LA ++  L++L++  +  + GAEL+A +     
Sbjct: 268 LAGVIVFLLWLWITNLALLFGAELDAELERGRE 300


>gi|145224451|ref|YP_001135129.1| putative ribonuclease BN [Mycobacterium gilvum PYR-GCK]
 gi|145216937|gb|ABP46341.1| putative ribonuclease BN [Mycobacterium gilvum PYR-GCK]
          Length = 401

 Score =  188 bits (477), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 53/273 (19%), Positives = 111/273 (40%), Gaps = 3/273 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVV 66
              ++      F  +    +A+ ++  A+LS+FP +V   +L G +G   +    V+ +V
Sbjct: 75  WLFVLRKTAREFTHDQCTDLAAALTYYAVLSLFPALVVVMSLLGVIGQSERTADAVLGIV 134

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
               P      + + I Q++  P+ GL   +  + A + +S  V A   ++NR Y V E 
Sbjct: 135 DDVSPGAAVDVLREPIQQLVNAPSAGLTLVLGIVGALWSASGFVGAFGRAMNRIYEVEEG 194

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R  +  RL      L+  +     + +          V  +       L +    R    
Sbjct: 195 RPGWKLRLQQLFLTLVGLIVAATAALLLAVSGPVAEAVGGYLGVGATGLTVWNIARWPLL 254

Query: 186 MLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
           ++ +  G+  ++   P  +      I  G     ++WV  ++ F  Y+  F  Y+  +  
Sbjct: 255 LVLVVFGVAMLYYVSPNVRQPKFRWISVGAAIAIVTWVCASLGFGFYVANFGNYNKTFGT 314

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           LA ++  L++L++  +  + GAE++A +     
Sbjct: 315 LAGVIVFLLWLWLTNLALLFGAEVDAELERGRQ 347


>gi|297625291|ref|YP_003687054.1| tRNA processing ribonuclease BN [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
 gi|296921056|emb|CBL55594.1| TRNA processing ribonuclease BN [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
          Length = 364

 Score =  187 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 54/270 (20%), Positives = 103/270 (38%), Gaps = 3/270 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVVFGA 69
           ++   I  F  +    +A+ ++  A+LS+FP ++   +L G +G        V+ ++   
Sbjct: 35  VLRKTIREFSSDQCTDIAASLTYYAVLSLFPCLIAIFSLLGVVGQGKAASDAVLGIIEQV 94

Query: 70  WPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            P      I   I Q+   P  G       L A + +S  V A   ++NR Y + E R +
Sbjct: 95  APGDTVDTIRGPIEQIAESPGAGFALITGILLAIWSASGYVGAFSRAMNRIYEIEEGRPF 154

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +  +       ++  V LVI + + V        +            I    +    +  
Sbjct: 155 WKLKPAQLLVTVITIVLLVIAAIILVVSGDVTKAIGDALGIGDVPQTIWSIAKWPLLIFI 214

Query: 189 LFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
             + +  ++   P AK      I  G +   I   +    F  Y+  FS Y   Y  LA 
Sbjct: 215 AVLVVAILYYATPNAKQPKFRWISMGALLAIIVLALATAAFGFYVGNFSNYDRTYGSLAG 274

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           ++  L++L++  +  + GAE +A +     
Sbjct: 275 VIIFLLWLWIANLALLFGAEFDAELERGRQ 304


>gi|315444784|ref|YP_004077663.1| hypothetical protein Mspyr1_32120 [Mycobacterium sp. Spyr1]
 gi|315263087|gb|ADT99828.1| predicted membrane protein [Mycobacterium sp. Spyr1]
          Length = 401

 Score =  187 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 53/273 (19%), Positives = 111/273 (40%), Gaps = 3/273 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVV 66
              ++      F  +    +A+ ++  A+LS+FP +V   +L G +G   +    V+ +V
Sbjct: 75  WLFVLRKTAREFTHDQCTDLAAALTYYAVLSLFPALVVVMSLLGVIGQSERTADAVLGIV 134

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
               P      + + I Q++  P+ GL   +  + A + +S  V A   ++NR Y V E 
Sbjct: 135 DDVSPGAAVDVLREPIQQLVNAPSAGLTLVLGIVGALWSASGFVGAFGRAMNRIYEVEEG 194

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R  +  RL      L+  +     + +          V  +       L +    R    
Sbjct: 195 RPGWKLRLQQLFLTLVGLIVAATAALLLAVSGPVAEAVGGYLGVGATGLTVWNITRWPLL 254

Query: 186 MLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
           ++ +  G+  ++   P  +      I  G     ++WV  ++ F  Y+  F  Y+  +  
Sbjct: 255 LVLVVFGVAMLYYVSPNVRQPKFRWISVGAAIAIVTWVCASLGFGFYVANFGNYNKTFGT 314

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           LA ++  L++L++  +  + GAE++A +     
Sbjct: 315 LAGVIVFLLWLWLTNLALLFGAEVDAELERGRQ 347


>gi|282866832|ref|ZP_06275868.1| ribonuclease BN [Streptomyces sp. ACTE]
 gi|282558324|gb|EFB63890.1| ribonuclease BN [Streptomyces sp. ACTE]
          Length = 360

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 48/274 (17%), Positives = 109/274 (39%), Gaps = 4/274 (1%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
              + ++   +  F +++    A+ ++   +LS+FP ++   +L G +        V+D 
Sbjct: 57  RSWWAVLRRTVREFADDELADRAAALTYYGVLSLFPALLVLVSLLG-IAGESATQQVMDN 115

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVV 123
           +    P  +   ++D + Q+      G  +  +  + A + +S  + A   S N  Y + 
Sbjct: 116 LRKLAPGPVRDILSDAVEQLQGNGGTGSLMAVLGLVLALWSASGYIAAFIRSSNAVYDIP 175

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R  +    +     +   V  V+ + + V                   L      +  
Sbjct: 176 EGRPVWKVLPLRLALTVTLMVLAVVSALIVVFTGPLAQRAGSALGVGDTALTAWSIAKWP 235

Query: 184 ATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
             +L + + +  ++   P A+ +    + PG     + W++ +  F  Y+  FS+Y+  Y
Sbjct: 236 VLVLLVTVMIALLYWAAPNARGRGFKWVTPGSFLALLLWMIASAGFALYVAYFSSYNKTY 295

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             LA ++  LV+L++  +  +LG E +A M    
Sbjct: 296 GALAGVIVFLVWLWITNLAILLGLEFDAEMARQR 329


>gi|229492024|ref|ZP_04385838.1| tRNA processing ribonuclease BN [Rhodococcus erythropolis SK121]
 gi|229321048|gb|EEN86855.1| tRNA processing ribonuclease BN [Rhodococcus erythropolis SK121]
          Length = 516

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 54/273 (19%), Positives = 108/273 (39%), Gaps = 3/273 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
              ++      F  +    +A+ ++  A+LS+FP I+   +L G  G  Q     +  + 
Sbjct: 30  WLYVLRSTARQFSRDQCTDLAAALTYYAVLSLFPAILAVVSLLGVFGQGQSTVDAVLQIV 89

Query: 68  GAWPEVIA-KPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           GA     A   +   I Q++  PA G         A + +S  V A   ++NR Y V E 
Sbjct: 90  GALGPSSAVDTLRGPIQQLVQAPAAGFALIAGIAGALWSASGYVGAFGRAMNRMYEVDEG 149

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R  +  R +     ++A   +   + +          +     A    L +    R    
Sbjct: 150 RPVWKLRPVMLLVTIVALTLIGCAAAMLAISGPVARAIGDVIGAGDTALTVWNIARWPVV 209

Query: 186 MLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
           ++ + + +  ++   P  +      I  G     + W++ +V F  Y+  FS+Y+  Y  
Sbjct: 210 LVFVVLAVAILYYATPNIQQPKFRWISGGAALAIVVWILASVGFGFYVANFSSYNKTYGS 269

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           LA  +  L++L++  +  + GAEL++ +     
Sbjct: 270 LAGAIVFLLWLWITNLALLFGAELDSELERGRQ 302


>gi|262202449|ref|YP_003273657.1| ribonuclease BN [Gordonia bronchialis DSM 43247]
 gi|262085796|gb|ACY21764.1| ribonuclease BN [Gordonia bronchialis DSM 43247]
          Length = 349

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 56/273 (20%), Positives = 114/273 (41%), Gaps = 3/273 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVV 66
           V+ I       F  +    +A+ ++  A+LS+FP ++   +L G  G   + V  V+ +V
Sbjct: 28  VWYITRKVAREFSRDQCTDLAAALTYYAVLSLFPALLAVVSLLGVFGQGQRTVDAVLQMV 87

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
               P      + D + Q+++ P+ G    +    A + +S  V A   ++NR Y + E 
Sbjct: 88  DDVGPSSAVDTLRDPVQQLVSAPSAGFALVLGLAGALWSASGYVGAFGRAMNRMYEIDEG 147

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R  +  R        +A +    ++ +          V     A    L +    R    
Sbjct: 148 RPIWKLRPQMLLVTAVALLMAGAIAVMLAISGPVAKAVGDAIGAGDAALTVWNIARWPLV 207

Query: 186 MLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
           ++   + +  ++   P  K      I  G     + W++ +VLF  Y+  FS+Y+  Y  
Sbjct: 208 LIFAILVVAILYYSTPNVKQPKFRWISIGATVAIVVWILASVLFGLYVANFSSYNKTYGA 267

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           LA ++  L++L++  +  + GAE++A ++    
Sbjct: 268 LAGVVVFLLWLWITNLALLFGAEIDAELVRGRQ 300


>gi|330685613|gb|EGG97259.1| YihY family protein [Staphylococcus epidermidis VCU121]
          Length = 411

 Score =  186 bits (472), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 67/270 (24%), Positives = 125/270 (46%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           +     +    ++D   +A+ ++   +L++FP ++F   L  F    Q     I  +  +
Sbjct: 71  NFFSYLVYRIGKDDASGLAAQMTYHFVLAMFPMLIFLLTLLPFFNIEQSQ---ITSMLSS 127

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  V    + GL ++  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 128 APSETSSIIKGVIGDVTKNSSGGLLSVGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGI 187

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V   I   +         Y+         +  +    R+   ++ +
Sbjct: 188 LLKLLSVVFTVVMGVVFAIAMALPTLGSAISHYLFGPLGLDSEVKWVFNLIRVVLPLIII 247

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            +  I ++   P  K+KI+S+LPG IFT I W++G+  F  YI  F  YS  Y  +A I+
Sbjct: 248 LVLFIVLYSVAPNVKTKILSVLPGAIFTSIIWLLGSFAFGWYISNFGNYSKTYGSIAGII 307

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +   +  K
Sbjct: 308 ILLIWLYLTSFIIIIGAEINAIIHQRHVIK 337


>gi|332701683|ref|ZP_08421771.1| ribonuclease BN [Desulfovibrio africanus str. Walvis Bay]
 gi|332551832|gb|EGJ48876.1| ribonuclease BN [Desulfovibrio africanus str. Walvis Bay]
          Length = 373

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 57/275 (20%), Positives = 115/275 (41%), Gaps = 8/275 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
             DI+        +++   +A+ ++  A+L++FP I    ++ G L     + + I  V 
Sbjct: 78  WRDILKRTWAEQSKDNLSLVAAGVAFYAMLALFPAIAALISIYGLLADPAQLQSQIGEVS 137

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYRVVE 124
           G  P      I  ++ +V++     L     +  L A + +S G++ L  +LN +Y   E
Sbjct: 138 GVLPGDARSIIQSQLSKVVSGAGGALSLGAAVGLLLALWSASKGMKGLIQALNISYGEEE 197

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R +     IS    +   +  ++     VA+P  L            ++  +   R   
Sbjct: 198 SRGFLKLNAISLLLTVSGLIFFILALTAVVAMPALL----DNLGLPDAVMWTVSIARWPL 253

Query: 185 TMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
             LA  + L  ++ + P     +   +  G     ++W+  ++LF+ Y+  F  Y+  Y 
Sbjct: 254 LALAGMLALAVLYRYAPDRDEPRWRWVSWGSAGATMAWIAASLLFSLYVSQFGNYNETYG 313

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            L +++  L +L++     +LGAELNA M     +
Sbjct: 314 TLGAVVILLTWLFLTAYVVLLGAELNAEMERQTRK 348


>gi|300114181|ref|YP_003760756.1| ribonuclease BN [Nitrosococcus watsonii C-113]
 gi|299540118|gb|ADJ28435.1| ribonuclease BN [Nitrosococcus watsonii C-113]
          Length = 447

 Score =  186 bits (471), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 58/270 (21%), Positives = 115/270 (42%), Gaps = 8/270 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D++        E+    +A+ ++  ALL++FP +    ++ G +     V   ++ + G 
Sbjct: 32  DVLLRVKNELSEDKLTVIAAGVAFYALLAIFPALTALVSIYGLVADPADVQQQLNTLSGF 91

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P      + D++  + A     L      S L A + ++ G++ L  +LN  Y   E R
Sbjct: 92  IPAEAQTLLNDQLSSITAHSQTALGVGVIGSILLALWGATKGLKTLMEALNVVYDEKETR 151

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            +      +      A +  VI   + VA+P  L      F    ++   +   R     
Sbjct: 152 GFLKLNATALILTFGALMLGVIAIGLVVALPALLG----NFGLGADVRTWVSLLRWPVLA 207

Query: 187 LALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
               +GL  V+ + P+  + +   +  G +   + W+  +V F++Y+  FS+Y+  Y  L
Sbjct: 208 FVAMLGLAVVYRYGPSRSQPRWHWVSWGAVLATVLWIAASVGFSYYVSNFSSYNETYGSL 267

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIY 275
             ++  L++L++     +LGAELNA M   
Sbjct: 268 GGVVVFLMWLFITAFIILLGAELNAEMEHQ 297


>gi|170739721|ref|YP_001768376.1| ribonuclease BN [Methylobacterium sp. 4-46]
 gi|168193995|gb|ACA15942.1| ribonuclease BN [Methylobacterium sp. 4-46]
          Length = 386

 Score =  185 bits (470), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 59/273 (21%), Positives = 122/273 (44%), Gaps = 4/273 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI+Y     F ++   ++A+ ++   LL++FP I    +L G       +   + ++ G 
Sbjct: 89  DILYRVYVEFQKDRVLSVAAGVTFYTLLAIFPAIAALVSLYGLFTDPATINDHLSLLQGV 148

Query: 70  WPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P      I D++ ++ A     L      S   + + ++ GV+A+  +LN  Y   E R
Sbjct: 149 LPSGALDIIGDQVKRITAKGGTTLGLTFFTSLAISLWSANAGVKAIFDALNIVYEEEEKR 208

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+    L S  + L   + +V      V +P+ L +V  F  ++      I   R    +
Sbjct: 209 SFIRLNLQSLAFTLGGLLFVVFALTGIVVLPVILNFVGTFGISISPKAWYIALLRWPILL 268

Query: 187 LALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
             L + L  ++ + P+  K +   + PG +   + W++G++ F+ Y+  F +Y+  Y  L
Sbjct: 269 AVLLLALAVLYRYGPSRDKPQWRWVTPGSLIAGVVWIIGSIAFSWYVAHFGSYNETYGSL 328

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            + +  + ++++     +LG E+NA +     R
Sbjct: 329 GAAVGFMTWIWISATIVLLGGEINAELEHQTIR 361


>gi|239638059|ref|ZP_04679018.1| transporter [Staphylococcus warneri L37603]
 gi|239596342|gb|EEQ78880.1| transporter [Staphylococcus warneri L37603]
          Length = 411

 Score =  185 bits (469), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 67/270 (24%), Positives = 125/270 (46%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           +     +    ++D   +A+ ++   +L++FP ++F   L  F    Q     I  +  +
Sbjct: 71  NFFSYLVYRIGKDDASGLAAQMTYHFVLAMFPMLIFLLTLLPFFNIEQSQ---ITNMLSS 127

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  V    + GL ++  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 128 APSETSSIIKGVIGDVTKNSSGGLLSVGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGI 187

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V   I   +         Y+         +  +    R+   ++ +
Sbjct: 188 LLKLLSVVFTVVMGVVFAIAMALPTLGSAISHYLFGPLGLDSEVKWVFNLIRVVLPLIII 247

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            +  I ++   P  K+KI+S+LPG IFT I W++G+  F  YI  F  YS  Y  +A I+
Sbjct: 248 LVLFIVLYSVAPNVKTKILSVLPGAIFTSIIWLLGSFAFGWYISNFGNYSKTYGSIAGII 307

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +   +  K
Sbjct: 308 ILLIWLYLTSFIIIIGAEINAIIHQRHVIK 337


>gi|254381761|ref|ZP_04997125.1| conserved hypothetical protein [Streptomyces sp. Mg1]
 gi|194340670|gb|EDX21636.1| conserved hypothetical protein [Streptomyces sp. Mg1]
          Length = 379

 Score =  184 bits (468), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 49/274 (17%), Positives = 106/274 (38%), Gaps = 4/274 (1%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
                ++   ++ F +++    A+ ++   +L++FP ++   +L G  G       V+D 
Sbjct: 44  RSWKAVLRGTLKEFKDDELADRAAALTYYGVLALFPALLVLVSLIGLAG-ESATKEVLDN 102

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVV 123
           V    P      +TD + Q+      G  L  +  + A + +S  + A   + N  Y + 
Sbjct: 103 VQKLAPGSARDVVTDAVQQIQGHSGVGSLLAIVGLVVAVWSASGYIAAFIRASNAVYDMP 162

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R  +    +     +   V     + + V        V          L +    +  
Sbjct: 163 EGRPVWKVLSLRMALTVTLMVLACASALIVVFSGNLARQVGSSLGIGDTALTVWSIVKWP 222

Query: 184 ATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
             ++ + I +  ++   P AK +    + PG       W+  +  F  Y+  F +Y+  Y
Sbjct: 223 VLVILVTIMIALLYWAAPNAKGRGFKWVSPGSFLALAIWMAASAGFAFYVANFGSYNKTY 282

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             LA ++  LV+L++  +  +LG E +A ++   
Sbjct: 283 GTLAGVIVFLVWLWITNLAILLGLEFDAELVRQR 316


>gi|116668913|ref|YP_829846.1| putative ribonuclease BN [Arthrobacter sp. FB24]
 gi|116609022|gb|ABK01746.1| putative ribonuclease BN [Arthrobacter sp. FB24]
          Length = 377

 Score =  184 bits (468), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 52/270 (19%), Positives = 112/270 (41%), Gaps = 3/270 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVVFGA 69
           I       F ++    +A+ ++  ++LS+FP ++   +L G  G   +    ++D+V G 
Sbjct: 53  IAKKTFREFTKDQCPDLAAALTYYSVLSIFPALLALVSLLGIFGDAQKTTSGLLDIVQGI 112

Query: 70  WPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            P      I   +  + + PA G    I  L A + +S  V A   ++NR Y V E R +
Sbjct: 113 APGDTVNTIRPVVEDLSSSPAAGFTLVIGLLTALWSASGYVGAFGRAMNRVYEVDEGRPF 172

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
              R    G  ++  + +V+++ + V        V          L +    +    ++ 
Sbjct: 173 LKLRGTMLGVTVVNLLIVVVLAAMLVLSGPVAESVGNVIGLGDAFLAVWNIAKWPVMLVL 232

Query: 189 LFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           +   +  +    P  K      +  G     + +++ ++ F  Y+  F++Y+  Y  +  
Sbjct: 233 VIAAIAVLFYATPNVKQPKFRWMSMGSAIALVVFLLASLAFGFYVANFNSYNKTYGAIGG 292

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           ++  L++L++L +  + GAE +A M     
Sbjct: 293 VIIALLWLWILNMSLLFGAEFDAEMERGRQ 322


>gi|29827533|ref|NP_822167.1| ribonuclease BN family membrane protein [Streptomyces avermitilis
           MA-4680]
 gi|29604633|dbj|BAC68702.1| putative membrane protein, ribonuclease BN-like family
           [Streptomyces avermitilis MA-4680]
          Length = 393

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 52/269 (19%), Positives = 108/269 (40%), Gaps = 4/269 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           ++  ++  F +++    A+ ++   +L++FP ++   +L G  G       V+  V    
Sbjct: 93  VLKGSLREFKDDELTDRAAALTYYGVLALFPALLVLVSLLGITGK-STTDKVLTNVQKLA 151

Query: 71  PEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
           P      IT  + Q+      G  +  I  + A + +S  V A   + N  Y + E R  
Sbjct: 152 PGSARDIITRAVEQLQNNAGTGSVVAIIGLVLAVWSASGYVAAFIRASNAVYDIPEGRPV 211

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +    I  G  ++  V  VI + + V                   L +    +    ++ 
Sbjct: 212 WKILPIRVGVTVVLMVLAVISALIVVFTGGLARQAGDALGIGDTALTVWSIAKWPVLVIL 271

Query: 189 LFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           + + +  ++   P AK K    I PG     + W++ +  F  Y+  F++Y+  Y  +A 
Sbjct: 272 VTLMIAILYWASPNAKVKGWRWITPGSFLALVIWMIASAGFAFYVANFASYNKTYGTMAG 331

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYY 276
           ++  LV+L++  +  +LG E +A      
Sbjct: 332 VIVFLVWLWITNLAILLGLEFDAETARQR 360


>gi|325676097|ref|ZP_08155779.1| tRNA processing ribonuclease BN [Rhodococcus equi ATCC 33707]
 gi|325553137|gb|EGD22817.1| tRNA processing ribonuclease BN [Rhodococcus equi ATCC 33707]
          Length = 362

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 54/270 (20%), Positives = 112/270 (41%), Gaps = 3/270 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVVFGA 69
           ++      F  +    +A+ ++  A+L++FP ++   +L G  G   + V  V+++V   
Sbjct: 37  VLRKTAREFGTDQCTDLAAALTYYAVLALFPALLVIVSLLGVFGQGQRTVDAVMEMVGQL 96

Query: 70  WPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            P      + + + Q++A P+ G+   I  L A + +S  V A   ++NR Y + E R  
Sbjct: 97  GPTNAVDTLREPVEQLVAAPSAGIALVIGVLGALWSASGYVGAFARAMNRIYEIEEGRPI 156

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +  R + F       V +     + V        V          +      +    +L 
Sbjct: 157 WKLRPLMFVVTAFCLVAVGASGLMLVISGPVARSVGDVLGLGDAAVTAWDIAKWPVLLLV 216

Query: 189 LFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           + + +  ++   P   + K   I PG     + W+  + LF  Y+  F++Y+  Y  LA 
Sbjct: 217 VGVLVAVLYYVTPNVSQPKFRWISPGAAIAIVVWIGASALFAVYVSNFASYNKTYGSLAG 276

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYW 277
            +  L++L++  +  + GAE +A +     
Sbjct: 277 AVVFLLWLWITNLALLFGAEFDAELERGRE 306


>gi|312137801|ref|YP_004005137.1| ribonuclease bn [Rhodococcus equi 103S]
 gi|311887140|emb|CBH46449.1| ribonuclease BN [Rhodococcus equi 103S]
          Length = 362

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 54/270 (20%), Positives = 112/270 (41%), Gaps = 3/270 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVVFGA 69
           ++      F  +    +A+ ++  A+L++FP ++   +L G  G   + V  V+++V   
Sbjct: 37  VLRKTAREFGTDQCTDLAAALTYYAVLALFPALLVIVSLLGVFGQGQRTVDAVMEMVGQL 96

Query: 70  WPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            P      + + + Q++A P+ G+   I  L A + +S  V A   ++NR Y + E R  
Sbjct: 97  GPTNAVDTLREPVEQLVAAPSAGIALVIGVLGALWSASGYVGAFARAMNRIYEIEEGRPI 156

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +  R + F       V +     + V        V          +      +    +L 
Sbjct: 157 WKLRPLMFVVTAFCLVAVGASGLMLVISGPVARSVGDVLGLGDAAVTAWDIAKWPVLLLV 216

Query: 189 LFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           + + +  ++   P   + K   I PG     + W+  + LF  Y+  F++Y+  Y  LA 
Sbjct: 217 VGVLVAVLYYVTPNVSQPKFRWISPGAAIAIVVWIGASALFAVYVSNFASYNKTYGSLAG 276

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYW 277
            +  L++L++  +  + GAE +A +     
Sbjct: 277 AVVFLLWLWITNLALLFGAEFDAELERGRE 306


>gi|290961371|ref|YP_003492553.1| hypothetical protein SCAB_70211 [Streptomyces scabiei 87.22]
 gi|260650897|emb|CBG74014.1| putative membrane protein, ribonuclease-like [Streptomyces scabiei
           87.22]
          Length = 365

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 49/274 (17%), Positives = 110/274 (40%), Gaps = 4/274 (1%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
              + ++    + F +++    A+ ++   +LS+FP I+   ++ G +G  +    ++D 
Sbjct: 44  RSWWAVVRRTAKEFQDDELSDRAAALTYYGVLSLFPAILVLVSMLGVVG-QRATDRILDN 102

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVV 123
           +    P      + D ++Q+      G  L  +  LAA + +S  V A   + N  Y + 
Sbjct: 103 IGDLAPGPARDILRDAVVQLSDSGGTGGLLAIVGLLAAVWSASGYVAAFIRTSNAVYDLP 162

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R  +    +  G  L+  V L   + + V                G  + +    +  
Sbjct: 163 EGRPAWKVTPLRIGLTLVLMVMLAASALIVVFTGPLAERAGTTIGLGGAAIAVWNIAKWP 222

Query: 184 ATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
             ++ + + +  ++   P  + +    + PG I   + W+  +  F  Y   F +Y+  Y
Sbjct: 223 VLLVLVTLMIALLYWAAPNVRGRGFRWVSPGGIVATLIWLAASAGFAVYAANFGSYNKTY 282

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             LA  +  L++L++  +  +LG E +A +    
Sbjct: 283 GTLAGAVVFLIWLWLTNLAILLGLEFDAELSRER 316


>gi|220921071|ref|YP_002496372.1| ribonuclease BN [Methylobacterium nodulans ORS 2060]
 gi|219945677|gb|ACL56069.1| ribonuclease BN [Methylobacterium nodulans ORS 2060]
          Length = 386

 Score =  182 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 57/273 (20%), Positives = 121/273 (44%), Gaps = 4/273 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D++Y     F ++   ++A+ ++   LL++FP I    +L G +     +   I ++ G 
Sbjct: 89  DVLYRVYLEFQKDRVLSVAAGVTFYTLLAMFPAIAALVSLYGLIADPATINDHIALLQGV 148

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISA---LAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P      I +++ ++ +     L          + + ++ GV+A+  +LN  Y   E R
Sbjct: 149 LPSGALDIIGEQVKRISSKGGTTLGLTFFTTLALSLWSANAGVKAIFDALNIVYEEEEKR 208

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+    L S  + L   + +V+     V +P+ L ++  F  ++      I   R    +
Sbjct: 209 SFIKLNLQSLTFTLGGLLFVVVALSGIVVLPVILNFIGNFGISISPKAWYIALLRWPLLL 268

Query: 187 LALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
             L   L  ++ + P+    K   + PG +   + W+VG++ F+ Y+  F +Y+  Y  L
Sbjct: 269 AILLFALALLYRYGPSRDEPKWRWVTPGSLIAGVVWLVGSIAFSWYVAHFGSYNETYGSL 328

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            + +  + ++++     +LG E+NA M     R
Sbjct: 329 GAAIGFMTWIWISATIVLLGGEINAEMEHQTVR 361


>gi|302548984|ref|ZP_07301326.1| ribonuclease BN family membrane protein [Streptomyces
           viridochromogenes DSM 40736]
 gi|302466602|gb|EFL29695.1| ribonuclease BN family membrane protein [Streptomyces
           viridochromogenes DSM 40736]
          Length = 389

 Score =  182 bits (462), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 51/269 (18%), Positives = 110/269 (40%), Gaps = 4/269 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           ++  ++  F +++    A+ ++   +L++FP ++   ++ G  G       V++ V    
Sbjct: 89  VLKGSLREFKDDELTDRAAALTYYGVLAMFPALLVLVSILGLTGR-STTDKVLENVQQFA 147

Query: 71  PEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
           P      IT  + Q+      G  +  +  + A + +S  V A   S N  Y + E R  
Sbjct: 148 PGSARDIITRAVEQLQGNAGVGSLMAVVGLVLAVWSASGYVAAFIRSANAVYDIPEGRPV 207

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +    +  G  ++  V  V  + + V                   L +    +    ++ 
Sbjct: 208 WKLLPVRVGVTVVLMVLAVFSALIVVFTGGLARQAGSVLGIGDTALTVWSIAKWPVLVVL 267

Query: 189 LFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           + I +  ++   P AK K    I PG +   + W+V +  F  Y+  F++Y+  Y  +A 
Sbjct: 268 VTIMIAILYWATPNAKVKGFRWITPGSVLALLIWLVASAGFAVYVANFASYNKTYGTMAG 327

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYY 276
           ++  LV+L++  +  +LG E +A  +   
Sbjct: 328 VIVFLVWLWITNLAILLGLEFDAETVRQR 356


>gi|302539626|ref|ZP_07291968.1| ribonuclease BN [Streptomyces hygroscopicus ATCC 53653]
 gi|302457244|gb|EFL20337.1| ribonuclease BN [Streptomyces himastatinicus ATCC 53653]
          Length = 395

 Score =  182 bits (462), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 50/269 (18%), Positives = 106/269 (39%), Gaps = 4/269 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           +   ++  F +++    A+ ++   +LS+FP ++   +L G +        V+  +    
Sbjct: 95  VFKGSLREFKDDELTDRAAALTYYGVLSLFPALLVLVSLVG-IAGKSTTDEVLSNLKQLA 153

Query: 71  PEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
           P      IT  + Q+      G  +     + A + +S  V A   + N  Y + E R  
Sbjct: 154 PGSARDLITRTVEQLQGNGGTGSIMAITGLVLAVWSASGYVAAFIRASNAVYEMPEGRPA 213

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +    +  G  ++  V  V  + + V                   L +    +    ++ 
Sbjct: 214 WKILPVRVGVTVVLMVLTVASALIVVFTGGLARQTGAALGIGDTTLTVWSIAKWPVLVIL 273

Query: 189 LFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           + + L  ++   P AK K    I PG     + W++ +  FT Y+  F++Y+  Y  +A 
Sbjct: 274 ITVMLALLYWAAPNAKVKKFRWITPGSFLALVIWMIVSAGFTFYVANFASYNKTYGTMAG 333

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYY 276
           ++  LV+L++  +  +LG E +A      
Sbjct: 334 VIVFLVWLWISNLAILLGLEFDAETARQR 362


>gi|222151855|ref|YP_002561015.1| hypothetical protein MCCL_1612 [Macrococcus caseolyticus JCSC5402]
 gi|222120984|dbj|BAH18319.1| conserved hypothetical protein [Macrococcus caseolyticus JCSC5402]
          Length = 342

 Score =  181 bits (460), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 60/267 (22%), Positives = 123/267 (46%), Gaps = 2/267 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   +    ++D   +++ ++   LLS+FP ++F   L           T+ +++   
Sbjct: 73  NFLSMLLFRIGKDDAAGLSAQLAYYFLLSLFPMLIFLLTLVPLFKVSP--ETITNMIAKN 130

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   A  ITD I  V+     GL +   +AA + +SNG+ AL  + N +Y V + R+  
Sbjct: 131 APGDAANMITDVISDVMNNANGGLLSFGLIAALWSASNGMTALMNAFNVSYEVEDARNPI 190

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           +++L+S  + ++  +   +   + V       Y+   F        I    ++   ++  
Sbjct: 191 VSKLLSVLFTVVMVLVFGVALALPVFGEQIGNYLFGQFGLESQFKWIFSLVKVALPLIVT 250

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI    ++   P  K +  S++PG +F  I W+  + LF +Y+  F  YS  Y  +  I+
Sbjct: 251 FIVFTTLYAIAPNIKLQFKSVIPGALFATIVWIGASFLFGYYVSNFGNYSKTYGSIGGII 310

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYY 276
             +++LY+ G   I+G+++NA +    
Sbjct: 311 VLMLWLYLTGFIIIIGSQINAIIHEKK 337


>gi|297204191|ref|ZP_06921588.1| ribonuclease BN family membrane protein [Streptomyces sviceus ATCC
           29083]
 gi|197714118|gb|EDY58152.1| ribonuclease BN family membrane protein [Streptomyces sviceus ATCC
           29083]
          Length = 359

 Score =  181 bits (460), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 53/269 (19%), Positives = 112/269 (41%), Gaps = 4/269 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           ++  ++  F +++    A+ ++   LLS+FP I+   ++ G  G      TV+  +    
Sbjct: 53  VLRGSLREFKDDELTDRAAALTYYGLLSLFPAILVLVSMLGLTGKSAT-DTVLKNLKQFT 111

Query: 71  PEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
           P      IT  + Q+      G  +  +  + A + +S  V A   S NR Y + E R  
Sbjct: 112 PGSARDIITGAVEQLQGNAGVGSVMAIVGLVLAVWSASGYVAAFMRSANRVYDMPEGRPI 171

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +    +  G  ++  V  V+ + + V                   L +    +    ++ 
Sbjct: 172 WKILPVRVGLTVVLMVLAVVSALIVVFTGTLAHKAGTALGIGDTALTVWAIAKWPVLVVL 231

Query: 189 LFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           + I +  ++   P A+ K    I PG +   + W++ +  F  Y+  F++Y+  Y  +A 
Sbjct: 232 VTIMIALLYWATPNARVKGFRWITPGSVLALLIWLIASAGFAFYVANFASYNKTYGTMAG 291

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYY 276
           ++  LV+L++  +  +LG E +A  +   
Sbjct: 292 VIVFLVWLWISNLAILLGLEFDAETVRQR 320


>gi|319948212|ref|ZP_08022371.1| TRNA processing ribonuclease BN [Dietzia cinnamea P4]
 gi|319438147|gb|EFV93108.1| TRNA processing ribonuclease BN [Dietzia cinnamea P4]
          Length = 357

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 57/269 (21%), Positives = 113/269 (42%), Gaps = 3/269 (1%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVVFGAW 70
           I  A+  F  +    +A+ ++  A+LS+FP ++   +L G  G     V  V++++ GA 
Sbjct: 38  IKRALSEFSRDKCTDLAASLTYFAVLSLFPALLAVVSLLGVFGQGQATVDAVMELLEGAA 97

Query: 71  PEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           PE     +   I  V+  PA G+        A + +S  V A   ++NR Y + E R ++
Sbjct: 98  PEETLAALRGPIESVVNTPAAGIALITGLAGALWSASGYVGAFGRAMNRIYEIEEGRPFW 157

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
             + ++     +  + + +   + V       +           + +    +    +L +
Sbjct: 158 KLKPVTVLLTAVLLLLVCLAGLILVVSGPIAEWAGNLIGLGETAVTVWGIAKWPVLVLVV 217

Query: 190 FIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
            + L  ++ F P  K      I  G +   I W V    F  Y+  FS+Y+  Y  LA +
Sbjct: 218 VVILAVLYGFAPNVKQPKFRWISIGAVIALIVWAVATGGFVFYVTNFSSYNATYGSLAGV 277

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYW 277
           +  L++L++     + GAE++A +     
Sbjct: 278 IIFLLWLWITNNALLFGAEVDAEVERARE 306


>gi|315504286|ref|YP_004083173.1| ribonuclease bn [Micromonospora sp. L5]
 gi|315410905|gb|ADU09022.1| ribonuclease BN [Micromonospora sp. L5]
          Length = 363

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 54/268 (20%), Positives = 106/268 (39%), Gaps = 3/268 (1%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
           +   +  F ++     A+ ++   +LS+FP ++   ++ G LG          V      
Sbjct: 65  LKRTVREFQDDSLTDWAAALTYYGVLSIFPGVLVLISVLGLLGDRATEGVRDTVGQAVPE 124

Query: 72  EVIAKPITDEILQVLAVP--AKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           E I + I   I Q       A     +  +AA + +S  V A   + N  Y V E R  +
Sbjct: 125 ENIRRIIESAIDQAGQSGGLASIAAIVGLVAAFWSASGYVAAFMRASNSIYDVPEGRPIW 184

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
            T  +  G   +  V L+I + + V                   + +    +    ++ +
Sbjct: 185 KTLPVRLGVTAVIGVMLLISAVIVVFTGGLAEQAGNAIGLGETAVTVWNIAKWPVLLVLV 244

Query: 190 FIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
            +    ++   P A+      + PG +   + W+V + LF  Y+  F +Y+  Y  +A +
Sbjct: 245 SLMFAILYWASPNARHGGFRWVSPGGVLAVVLWLVVSGLFALYVSNFGSYNKTYGAVAGV 304

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYY 276
           +  LV+L++  V  +LGAE +A +    
Sbjct: 305 IIFLVWLWLSNVAILLGAEFDAELERSR 332


>gi|302869239|ref|YP_003837876.1| ribonuclease BN [Micromonospora aurantiaca ATCC 27029]
 gi|302572098|gb|ADL48300.1| ribonuclease BN [Micromonospora aurantiaca ATCC 27029]
          Length = 363

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 54/269 (20%), Positives = 110/269 (40%), Gaps = 5/269 (1%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
           +   ++ F ++     A+ ++   +LS+FP ++   ++ G LG  +    V D V  A P
Sbjct: 65  LKRTVQEFQDDSLTDWAAALTYYGVLSIFPGVLVLISVLGLLG-ERATEGVRDTVGQAVP 123

Query: 72  EVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
           E   + I +  +               +  +AA + +S  V A   + N  Y V E R  
Sbjct: 124 EENIRRIIESAIDQAGQSGGLASIAAIVGLVAAFWSASGYVAAFMRASNSIYDVPEGRPI 183

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           + T  +  G   +  V L+I + + V                   + +    +    ++ 
Sbjct: 184 WKTLPVRLGVTAVIGVMLLISAVIVVFTGGLAEQAGNAIGLGETAVTVWNIAKWPVLLVL 243

Query: 189 LFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           + +    ++   P A+      + PG +   + W+V + LF  Y+  F +Y+  Y  +A 
Sbjct: 244 VSLMFAILYWASPNARHGGFRWVSPGGVLAVVLWLVVSGLFALYVSNFGSYNKTYGAVAG 303

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYY 276
           ++  LV+L++  V  +LGAE +A +    
Sbjct: 304 VIIFLVWLWLSNVAILLGAEFDAELERSR 332


>gi|108801303|ref|YP_641500.1| ribonuclease BN, putative [Mycobacterium sp. MCS]
 gi|119870454|ref|YP_940406.1| putative ribonuclease BN [Mycobacterium sp. KMS]
 gi|126437284|ref|YP_001072975.1| putative ribonuclease BN [Mycobacterium sp. JLS]
 gi|108771722|gb|ABG10444.1| ribonuclease BN, putative [Mycobacterium sp. MCS]
 gi|119696543|gb|ABL93616.1| putative ribonuclease BN [Mycobacterium sp. KMS]
 gi|126237084|gb|ABO00485.1| putative ribonuclease BN [Mycobacterium sp. JLS]
          Length = 350

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 57/272 (20%), Positives = 114/272 (41%), Gaps = 3/272 (1%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVVF 67
           F ++      F  +    +A+ ++  A+LS+FP ++   +L G  G   +    ++D+V 
Sbjct: 32  FYVLRKTAREFGHDQCTDLAAALTYYAVLSLFPAVLVMVSLLGVFGQGRRTTDALLDIVS 91

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
              P      +   I Q++  P+ G    I  L A + +S  V A   ++NR Y V E R
Sbjct: 92  DVAPASTVDTLRPTIEQLVESPSAGFALVIGILTALWSASGYVGAFGRAMNRIYEVAEGR 151

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
             +  R +       A +   +++F+          +          +     GR    +
Sbjct: 152 PVWKLRPLQLVLTFAALLGAALVAFMLAVSGPVAEALGNAIGLGEAAVTAWSIGRWPVIL 211

Query: 187 LALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           L + + +  ++   P  +      I  G     ++W+V +V F  Y+  FS+Y+  Y  L
Sbjct: 212 LLVVVAVAVLYYATPNVQQPKFRWISLGAGLAILTWIVASVGFGFYVANFSSYNKTYGTL 271

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           A ++  L++L++  +  + GAEL+A +     
Sbjct: 272 AGVIIFLLWLWITNLALLFGAELDAELERGRQ 303


>gi|184200660|ref|YP_001854867.1| hypothetical protein KRH_10140 [Kocuria rhizophila DC2201]
 gi|183580890|dbj|BAG29361.1| hypothetical membrane protein [Kocuria rhizophila DC2201]
          Length = 400

 Score =  179 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 49/270 (18%), Positives = 112/270 (41%), Gaps = 3/270 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVVFGA 69
           +   A+  F ++    +A+ ++  A+LSVFP ++   +L G  G        ++D +   
Sbjct: 78  VFKRALSEFTKDGCTDLAASLTYFAVLSVFPALLALVSLLGVFGQGEATTKAILDFLNQY 137

Query: 70  WPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            P  + + ++D I Q+      GL   +  + A + +S    A   +LNR Y V E R +
Sbjct: 138 APSALVELLSDPISQLTTQSGAGLALVVGIVGALWTASGYTGAFSRALNRIYEVSEGRPF 197

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +  + +     L+  + +  +  + +        +          + +    +I   +L 
Sbjct: 198 WKLKPVMLLVTLIVVLIVAAVMVMVLLSGDLAQTLGDAVGLGSTAVTVWNWVKIPVVLLL 257

Query: 189 LFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           L + +  +    P  +      + PG   + +  +V  + F  Y+  F+ Y+  Y  + S
Sbjct: 258 LVLLIAILFYATPNVQQPKFRWMSPGAAISLVFMIVAGLAFAFYVANFAKYNATYGVIGS 317

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           ++  L+ L+++    + GAE++A +     
Sbjct: 318 VIILLLGLWIMNNALLFGAEVDAELERGRQ 347


>gi|309812239|ref|ZP_07705997.1| YihY family protein [Dermacoccus sp. Ellin185]
 gi|308433926|gb|EFP57800.1| YihY family protein [Dermacoccus sp. Ellin185]
          Length = 522

 Score =  177 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 47/274 (17%), Positives = 104/274 (37%), Gaps = 6/274 (2%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVVFGAW 70
              A   F ++    +A+ ++  ++ ++FP I+   +  G  G   +   +VI+ +    
Sbjct: 21  FKRAAAKFSQDQCTDLAASLTYYSVQAMFPAIIAAVSTIGLFGNGQKTTDSVIEAIAEIV 80

Query: 71  PEVIAKP---ITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
            +         T  I  +    A   F +  L + + +S  V A     NR Y V E R 
Sbjct: 81  GKNKDDIPEGFTTFINNLQGGGAGLAFILGILVSLWSASGYVNAFSRMSNRIYDVAEGRP 140

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            +  RL  +   ++A V  ++ +F  V        +            +    ++   ++
Sbjct: 141 VFKLRLWLYFVTIVAFVLAILAAFSLVVSGGIAEQIFDSVGLGTQAATVWDWAKVPFVVV 200

Query: 188 ALFIGLIFVHLFLPAAKSKIMSIL--PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
            +   +  +    P  K      +  PG +  ++ W +G + F  Y+     Y   Y  +
Sbjct: 201 VVIFIISLLFWGTPNVKRPFKQAMFNPGAVLAFVIWAIGTIAFAWYVSNMGNYGKTYGPM 260

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           A+ +  L++L++  +  + GAE ++  +     K
Sbjct: 261 ATPIILLLWLWITNLAMLFGAEFDSETLRTRQLK 294


>gi|21219215|ref|NP_624994.1| hypothetical protein SCO0686 [Streptomyces coelicolor A3(2)]
 gi|6425606|emb|CAB60467.1| putative membrane protein [Streptomyces coelicolor A3(2)]
          Length = 407

 Score =  177 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 52/269 (19%), Positives = 108/269 (40%), Gaps = 4/269 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           ++      F +++    A+ ++   +L++FP ++   +L G +        V+D V    
Sbjct: 106 LLRRVFAEFKDDELTDRAAALTYYGILALFPALLVLVSLLG-IAGDSATQEVLDNVKKLA 164

Query: 71  PEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
           P      +T+ + Q+ A    G  L  +  + A + +S  V A   S N  Y V E R  
Sbjct: 165 PGSARDVLTNAVEQLQAKAGLGSVLAVVGLVGAVWSASGYVAAFIRSANAVYDVPEGRPV 224

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +    +     ++  V  V+ + + V                   L +    +    +L 
Sbjct: 225 WKVLPLRVALTVVLLVLAVVSALIVVFTGSLARQAGTALGVGDTALTVWSIAKWPVLVLL 284

Query: 189 LFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           +   +  ++   P A+ K    I PG +   + W++ +  F  Y+  F +Y+  Y  LA 
Sbjct: 285 VTFMIAILYWAAPNARVKGFKWISPGSLVALLIWLLASAGFAFYVANFGSYNKTYGTLAG 344

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYY 276
           ++  LV+L++  +  +LG E +A +    
Sbjct: 345 VIIFLVWLWVTNLAILLGLEFDAELARQR 373


>gi|188580068|ref|YP_001923513.1| ribonuclease BN [Methylobacterium populi BJ001]
 gi|179343566|gb|ACB78978.1| ribonuclease BN [Methylobacterium populi BJ001]
          Length = 386

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 52/275 (18%), Positives = 122/275 (44%), Gaps = 9/275 (3%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
            +DI       F ++   ++A+ ++   LLS+FP I       G +     +   +  + 
Sbjct: 92  WWDIATRVYLEFNKDRVLSVAAGVTFYTLLSLFPAIAALVTCYGLVADVNTINVHLSTLH 151

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTI---SALAAAYFSSNGVEALRISLNRAYRVVE 124
           G  PE     I +++ ++ A  +  L      S   + + ++  ++A+  +LN  Y   E
Sbjct: 152 GVLPESAIDIIGEQVKRISAKGSGTLGVTFFTSLTLSLWSANAAMKAMFDALNVVYEEEE 211

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R+++   + S  +   A + +++     V +P+   ++      LG+   +I   R   
Sbjct: 212 KRNFFWLNVRSLTFTGGALLFIILALMSIVVLPVVFNFL-----GLGDGARLIAMARWPV 266

Query: 185 TMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            +L L  GL  ++ + P+  +++   +  G +   + W+  ++LF+ Y+  F  Y+  Y 
Sbjct: 267 LLLVLLGGLAVLYRYGPSRERARWRWVGAGSVVAGLLWLAASILFSWYVANFGNYNETYG 326

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            L +++  + ++++     +LG E+NA +     R
Sbjct: 327 SLGAVIGFMTWIWISATIVLLGGEINAEIEHQTAR 361


>gi|332670932|ref|YP_004453940.1| ribonuclease BN [Cellulomonas fimi ATCC 484]
 gi|332339970|gb|AEE46553.1| ribonuclease BN [Cellulomonas fimi ATCC 484]
          Length = 361

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 48/269 (17%), Positives = 107/269 (39%), Gaps = 4/269 (1%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW-- 70
              +  F+ ++    A+ ++  A+L++ P ++   ++ G +G  +     +  +      
Sbjct: 41  RRTVREFLADECTDQAAALTYYAVLAIAPALLAVVSVLGLVGDPEQTLNRVMDLVADLGA 100

Query: 71  PEVIAKPITDEILQVLAVP-AKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           PE  A+ +   +  V +   A     +  L A + +S  V A    +NR Y V E R  +
Sbjct: 101 PEDAAQTVEPIVQAVTSNSKAGVALVLGVLLALWSASGYVAAFGRGMNRIYEVDEGRPIW 160

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
             R +     L   +  V++    V        +       G  + +    +    ++ +
Sbjct: 161 KLRPVILLVTLALVLIAVLVVVAMVLSGPVARTIGDAVGLSGTAVTVWNVFKWPVVVVLV 220

Query: 190 FIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
            + +  ++   P  +      I  G     + W + +V F  Y+ TF++Y   Y  LA +
Sbjct: 221 VVAIAVLYHATPNVRQPKFRWISVGAAVALLVWALASVAFGFYVTTFASYDATYGSLAGV 280

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYW 277
           +  L++L++  +  + GAEL+A +     
Sbjct: 281 VVFLLWLWISNLALLFGAELDAELERGRQ 309


>gi|271961924|ref|YP_003336120.1| ribonuclease BN [Streptosporangium roseum DSM 43021]
 gi|270505099|gb|ACZ83377.1| ribonuclease BN [Streptosporangium roseum DSM 43021]
          Length = 334

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 49/274 (17%), Positives = 109/274 (39%), Gaps = 4/274 (1%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
              +D++   ++ F E++    A+ ++  A+LS+FP ++   ++ G  G      +++D 
Sbjct: 38  RSWWDVLKRTVKEFQEDNLTDWAAALTYYAVLSIFPALLAVISVLGLFG-QSATQSLVDN 96

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISAL--AAAYFSSNGVEALRISLNRAYRVV 123
           +    P    + I   +  + +               A + +S+ V A   + N  Y + 
Sbjct: 97  LGALAPGPARQTIDTVLQALQSSQRAAGIAAIIGIAVALWSASSYVGAFMRAANVMYEMP 156

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R  + T  +  G   +  + + + S   V          K        L +    +  
Sbjct: 157 EGRPVWKTLPLRLGITAVLVILMAVGSVAVVFTGGLAEQAGKVLGVGETGLAVWGVVKWP 216

Query: 184 ATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
             ++ + + L  ++   P  +      I PG +   + W+  +  F  Y+  F +YS  Y
Sbjct: 217 ILVIIVALVLALLYWAAPNVQHPGFRWITPGSMIAVVLWIAASAAFGFYVANFGSYSKTY 276

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           A LA ++  L++L++  +  +LG E +A +    
Sbjct: 277 AALAGVVVFLIWLWITNIAVLLGVEFDAELARER 310


>gi|16264688|ref|NP_437480.1| hypothetical protein SM_b21363 [Sinorhizobium meliloti 1021]
 gi|15140826|emb|CAC49340.1| conserved hypothetical membrane protein [Sinorhizobium meliloti
           1021]
          Length = 364

 Score =  176 bits (447), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 58/277 (20%), Positives = 125/277 (45%), Gaps = 10/277 (3%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
             + D+ +  +    E+    +A+ ++   LLSVFP +    ++ G +     +     +
Sbjct: 68  RGLRDVFWRVVSQISEDRISLIAAGVTFYVLLSVFPALASLVSIYGLVSDPATIAEQATL 127

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRV 122
           +    P    + +TD++  + +     L        L A + + NGV AL  ++N AY  
Sbjct: 128 LAAVLPAQSLQMMTDQLETLSSQKTSSLSFGFIAGLLFALWSARNGVGALFEAMNIAYDE 187

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E RS+    L+S G+ L   +   ++      +P  LA++            ++   R 
Sbjct: 188 TEKRSFIRLTLLSIGFTLAGLILTAVLIAAIAVLPAVLAFLHLELEG------LLRFVRW 241

Query: 183 YATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
              +L +  G+  ++ + P+ +  K+  +  G   + I W+V ++ F++YI  F+ Y+  
Sbjct: 242 PVMLLLIAAGITLIYRYGPSREPAKLRWLTWGAALSTICWLVASLAFSYYIDNFANYNAT 301

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           Y  L +++  ++++++  +  I+GAELNA +     R
Sbjct: 302 YGALGALIGFMLWIWISTMIVIIGAELNAELEHQTAR 338


>gi|317124596|ref|YP_004098708.1| ribonuclease BN [Intrasporangium calvum DSM 43043]
 gi|315588684|gb|ADU47981.1| ribonuclease BN [Intrasporangium calvum DSM 43043]
          Length = 355

 Score =  176 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 51/275 (18%), Positives = 112/275 (40%), Gaps = 3/275 (1%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVID 64
            I    +  A   F  ++   +A+ ++   +LS+FP ++   +L G  G     V +++D
Sbjct: 31  KIWRTSLKRAAHEFGHDECTDLAAGLTYYGVLSIFPGLLALVSLLGVFGRGRSTVESLLD 90

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVV 123
           ++        A  +   I  ++   A GL   +  + A + +S  V A   ++NR Y V 
Sbjct: 91  ILEAVGQGDSADTLRGPITDMVNSGAAGLTLVVGLVGAVWSASGYVGAFGRAMNRIYGVD 150

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R +   R ++    +   +   ++    V        V       G  +      +  
Sbjct: 151 EGRPFIRLRPLNLALTVAFVIMAALILLGLVLTGDLARAVGDTIGLGGAAVTTWSIAKWP 210

Query: 184 ATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
             ++ +   +  ++   P  K  +   +  G +   ++ +V +V F  Y+  FS Y   Y
Sbjct: 211 VILILVIAMVALLYWATPNVKQPRFRWLSVGAVIAILAAIVASVGFGFYVSGFSNYDKTY 270

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
             LA ++  L++++++ +  + GAE++A M     
Sbjct: 271 GSLAGVIVFLLWMWLMNLALLFGAEVDAEMERGRE 305


>gi|254559558|ref|YP_003066653.1| ribonuclease BN [Methylobacterium extorquens DM4]
 gi|254266836|emb|CAX22635.1| Ribonuclease BN [Methylobacterium extorquens DM4]
          Length = 388

 Score =  175 bits (444), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 52/275 (18%), Positives = 123/275 (44%), Gaps = 9/275 (3%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
            +DI       F ++   ++A+ ++   LLS+FP I       G +     +   +  + 
Sbjct: 94  WWDIATRVYLEFNKDRVLSVAAGVTFYTLLSLFPAIAALVTCYGLVADVNTINVHLSTLH 153

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTI---SALAAAYFSSNGVEALRISLNRAYRVVE 124
           G  PE   + I +++ ++    +  L      S   + + ++  ++A+  +LN  Y   E
Sbjct: 154 GVLPESAIEIIGEQVKRIATKGSGALGFTFFTSLTLSLWSANAAMKAMFDALNVVYEEEE 213

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R+++   + S  +   A + +++     V +P+   ++      LG+   +I   R   
Sbjct: 214 KRNFFWLNVRSLTFTAGALLFIILALISIVVLPVVFNFL-----GLGDGARLIAMARWPM 268

Query: 185 TMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            +L L  GL  ++ + P+  +++   +  G I   + W++ ++LF+ Y+  F  Y+  Y 
Sbjct: 269 LLLVLLGGLAVLYRYGPSRERARWRWVGAGSIVAGVLWLIASILFSWYVANFGNYNETYG 328

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            L +++  + ++++     +LG E+NA +     R
Sbjct: 329 SLGAVIGFMTWIWISATIVLLGGEINAEIEHQTAR 363


>gi|218530643|ref|YP_002421459.1| ribonuclease BN [Methylobacterium chloromethanicum CM4]
 gi|218522946|gb|ACK83531.1| ribonuclease BN [Methylobacterium chloromethanicum CM4]
          Length = 397

 Score =  175 bits (444), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 49/273 (17%), Positives = 117/273 (42%), Gaps = 9/273 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D++        E     +++ ++   LL++FP I    ++ G +     +   I+ + G 
Sbjct: 105 DVLKRTYRDIGENRLTLVSAGVTFFVLLAIFPAIAALVSVYGLIADVSTINHQIEALRGV 164

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTI---SALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P      + +++ ++       L          + + ++ GV+ +  +LN  Y   E R
Sbjct: 165 LPSGGVDIVAEQVKRLTEKGDTTLGLTALIGIALSVWSANGGVKHVFDALNLVYNEREQR 224

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            ++   L+S  +   A + +V+     VA+P+A+ ++      L      +   R     
Sbjct: 225 GFFKLNLVSLAFTAGALLFVVLALAGIVAVPVAIQFL-----GLSGDAWWLALLRWPILF 279

Query: 187 LALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           + + + L  ++ + P+    +   + PG +F    W+ G++LF+ Y+  F +Y   Y  L
Sbjct: 280 VIVILMLAVLYRYGPSRDAPRWRWVTPGGMFAAFLWLAGSLLFSWYVSNFGSYDKTYGSL 339

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            + +  + ++++     +LGA+LNA +     +
Sbjct: 340 GAAIGFMTWIWLSTTIVLLGAQLNAELEHQTAK 372


>gi|240139015|ref|YP_002963490.1| Ribonuclease BN family protein [Methylobacterium extorquens AM1]
 gi|240008987|gb|ACS40213.1| Ribonuclease BN family protein [Methylobacterium extorquens AM1]
          Length = 397

 Score =  175 bits (443), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 49/273 (17%), Positives = 117/273 (42%), Gaps = 9/273 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D++        E     +++ ++   LL++FP I    ++ G +     +   I+ + G 
Sbjct: 105 DVLKRTYRDIGENRLTLVSAGVTFFVLLAIFPAIAALVSVYGLIADVSTINHQIEALRGV 164

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTI---SALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P      + +++ ++       L          + + ++ GV+ +  +LN  Y   E R
Sbjct: 165 LPSGGVDIVAEQVKRLTEKGDTTLGLTALIGIALSVWSANGGVKHVFDALNLVYNEREQR 224

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            ++   L+S  +   A + +V+     VA+P+A+ ++      L      +   R     
Sbjct: 225 GFFKLNLVSLAFTAGALLFVVLALAGIVAVPVAIQFL-----GLSGDAWWLALLRWPILF 279

Query: 187 LALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           + + + L  ++ + P+    +   + PG +F    W+ G++LF+ Y+  F +Y   Y  L
Sbjct: 280 VIVILMLAVLYRYGPSRDAPRWRWVTPGGMFAAFLWLAGSLLFSWYVSNFGSYDKTYGSL 339

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            + +  + ++++     +LGA+LNA +     +
Sbjct: 340 GAAIGFMTWIWLSTTIVLLGAQLNAELEHQTAK 372


>gi|119715572|ref|YP_922537.1| putative ribonuclease BN [Nocardioides sp. JS614]
 gi|119536233|gb|ABL80850.1| putative ribonuclease BN [Nocardioides sp. JS614]
          Length = 377

 Score =  175 bits (443), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 52/273 (19%), Positives = 112/273 (41%), Gaps = 3/273 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVV 66
              +    +  F ++    +A+ ++  A+L+VFP  +   +L G +G     V T++ +V
Sbjct: 53  WLFVARKTVREFSDDQCTDLAAALTYYAVLAVFPAAIALTSLLGLVGQGTSSVETLLGIV 112

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
                  + K + D ++++    A GL F +    A + +S  V A   ++NR Y + E 
Sbjct: 113 DDLGGASVVKSVHDPLIEISRSQAAGLAFVLGLAGALWSASGYVGAFGRAMNRIYEIREG 172

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R  +  R +     L+       +    V        V         LL +    +    
Sbjct: 173 RPVWKLRPLMLLLTLVLVTLAAAVLLALVVTGPVADSVGSALGVGSTLLGVWNIAKWPVI 232

Query: 186 MLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
            LA+ + +  ++   P  +      +  G +   ++W + ++ F  Y+  FS+Y   Y  
Sbjct: 233 ALAVVVMVALLYYATPNVRQPRFRWVSVGAVLAIVTWALVSLAFGFYVANFSSYDKTYGA 292

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           L  ++  L+++++  +  + GAEL+A +     
Sbjct: 293 LGGVIAFLLWVWLTNLALLFGAELDAELERGRE 325


>gi|254561610|ref|YP_003068705.1| ribonuclease BN family protein [Methylobacterium extorquens DM4]
 gi|254268888|emb|CAX24849.1| Ribonuclease BN family protein [Methylobacterium extorquens DM4]
          Length = 397

 Score =  175 bits (443), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 49/273 (17%), Positives = 117/273 (42%), Gaps = 9/273 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D++        E     +++ ++   LL++FP I    ++ G +     +   I+ + G 
Sbjct: 105 DVLKRTYRDIGENRLTLVSAGVTFFVLLAIFPAIAALVSVYGLIADVSTINHQIEALRGV 164

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTI---SALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P      + +++ ++       L          + + ++ GV+ +  +LN  Y   E R
Sbjct: 165 LPSGGVDIVAEQVKRLTEKGDTTLGLTALIGIALSVWSANGGVKHVFDALNLVYNEREQR 224

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            ++   L+S  +   A + +V+     VA+P+A+ ++      L      +   R     
Sbjct: 225 GFFKLNLVSLAFTAGALLFVVLALAGIVAVPVAIQFL-----GLSGDAWWLALLRWPILF 279

Query: 187 LALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           + + + L  ++ + P+    +   + PG +F    W+ G++LF+ Y+  F +Y   Y  L
Sbjct: 280 VIVILMLAVLYRYGPSRDAPRWRWVTPGGMFAAFLWLAGSLLFSWYVSNFGSYDKTYGSL 339

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            + +  + ++++     +LGA+LNA +     +
Sbjct: 340 GAAIGFMTWIWLSTTIVLLGAQLNAELEHQTAK 372


>gi|256789758|ref|ZP_05528189.1| hypothetical protein SlivT_35203 [Streptomyces lividans TK24]
          Length = 402

 Score =  175 bits (443), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 52/269 (19%), Positives = 108/269 (40%), Gaps = 4/269 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           ++      F +++    A+ ++   +L++FP ++   +L G +        V+D V    
Sbjct: 101 LLRRVFAEFKDDELTDRAAALTYYGILALFPALLVLVSLLG-IAGDSATQEVLDNVKKLA 159

Query: 71  PEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
           P      +T+ + Q+ A    G  L  +  + A + +S  V A   S N  Y V E R  
Sbjct: 160 PGSARDVLTNAVEQLQAKAGLGSVLAVVGLVGAVWSASGYVAAFIRSANAVYDVPEGRPV 219

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +    +     ++  V  V+ + + V                   L +    +    +L 
Sbjct: 220 WKVLPLRVALTVVLLVLAVVSALIVVFTGSLARQAGTALGVGDTALTVWSIAKWPVLVLL 279

Query: 189 LFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           +   +  ++   P A+ K    I PG +   + W++ +  F  Y+  F +Y+  Y  LA 
Sbjct: 280 VTFMIAILYWAAPNARVKGFKWISPGSLVALLIWLLASAGFAFYVANFGSYNKTYGTLAG 339

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYY 276
           ++  LV+L++  +  +LG E +A +    
Sbjct: 340 VIIFLVWLWVTNLAILLGLEFDAELARQR 368


>gi|163851892|ref|YP_001639935.1| ribonuclease BN [Methylobacterium extorquens PA1]
 gi|163663497|gb|ABY30864.1| ribonuclease BN [Methylobacterium extorquens PA1]
          Length = 397

 Score =  174 bits (442), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 49/273 (17%), Positives = 117/273 (42%), Gaps = 9/273 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D++        E     +++ ++   LL++FP I    ++ G +     +   I+ + G 
Sbjct: 105 DVLKRTYRDIGENRLTLVSAGVTFFVLLAIFPAIAALVSVYGLIADVSTINHQIEALRGV 164

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTI---SALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P      + +++ ++       L          + + ++ GV+ +  +LN  Y   E R
Sbjct: 165 LPSGGVDIVAEQVKRLTEKGDTTLGLTALIGIALSVWSANGGVKHVFDALNLVYNEREQR 224

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            ++   L+S  +   A + +V+     VA+P+A+ ++      L      +   R     
Sbjct: 225 GFFKLNLVSLAFTAGALLFVVLALAGIVAVPVAIQFL-----GLSGDAWWLALLRWPILF 279

Query: 187 LALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           + + + L  ++ + P+    +   + PG +F    W+ G++LF+ Y+  F +Y   Y  L
Sbjct: 280 VIVILMLAVLYRYGPSRDAPRWRWVTPGGMFAAFLWLAGSLLFSWYVSNFGSYDKTYGSL 339

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            + +  + ++++     +LGA+LNA +     +
Sbjct: 340 GAAIGFMTWIWLSTTIVLLGAQLNAELEHQTAK 372


>gi|224476940|ref|YP_002634546.1| hypothetical protein Sca_1456 [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222421547|emb|CAL28361.1| hypothetical protein SCA_1456 [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 358

 Score =  174 bits (442), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 54/271 (19%), Positives = 118/271 (43%), Gaps = 2/271 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           +++   I    ++D   +A+ +S   +LS+F   +    ++           +++++   
Sbjct: 68  NLLSYLIYRIGKDDASGLAAQLSYYFMLSLF--PMLLFLMSLLPLFKIDRDKIVNMIANN 125

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   A  +T  I  ++   +  + ++  + A + +SNG+ AL  + N AY V + R+  
Sbjct: 126 APASTADLLTGIIGDIMKNASGSILSVGLILALWSASNGMTALMNAFNVAYDVEDGRNPI 185

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +LIS  + ++     +      V        +         +  I          + +
Sbjct: 186 VLKLISVLFTVIMGAVFIAAMIFPVFGQQIGHLLFGPLGLDSQIKWIFNILSYALPFVVI 245

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           F+  + ++   P  K K+ S++PG +F  + W++G   F  Y+  F+ YS  Y  +  I+
Sbjct: 246 FLLFVTLYTLAPNIKIKMKSVIPGALFASVVWILGTAAFGLYVSNFANYSKTYGSIGGII 305

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             +++LY+ G   I+GAE+NA +      K 
Sbjct: 306 VLMLWLYITGFIIIVGAEINAIINQRRTLKN 336


>gi|148271712|ref|YP_001221273.1| putative tRNA processing ribonuclease BN [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
 gi|147829642|emb|CAN00558.1| putative tRNA processing ribonuclease BN [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
          Length = 363

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 54/270 (20%), Positives = 113/270 (41%), Gaps = 3/270 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVVFGA 69
           ++   +  F  +    +A+ ++  A+LS+FP ++   +L G  G   Q V  V+D++ G 
Sbjct: 36  VLRKTVREFGSDQCTDIAASLTYYAVLSLFPALIAIISLLGVFGQGQQTVTAVLDLLRGF 95

Query: 70  WPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            P      I   +   +  PA G       + A + +S  V A   ++NR Y + E R +
Sbjct: 96  APADALALIEPILTGFVESPAAGFALVSGIVLAIWSASGYVGAFTRAMNRIYEIPEGRPF 155

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
              + +     L+  V L++ + +          + +       + ++    +      A
Sbjct: 156 LKLKPMQLAVTLIGIVILLVCALIIAISGPVTDAIGEALGLGPTVQIVWSIAKWPVLAFA 215

Query: 189 LFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           + + +  ++   P AK      +  G     +  VV +V F  Y+  FS+Y+  Y  LA 
Sbjct: 216 IVLLIAILYYATPNAKQPKFRWMSVGAAIALVVLVVASVGFAFYVTEFSSYAKSYGALAG 275

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           ++  L++L++  +  + GAE +A +     
Sbjct: 276 VVVFLLWLWIANLALLFGAEFDAELERGRQ 305


>gi|167620300|ref|ZP_02388931.1| YihY family protein [Burkholderia thailandensis Bt4]
          Length = 636

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 35/273 (12%), Positives = 93/273 (34%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A     E+    +A  ++ + +L++ P +     L         F  ++ 
Sbjct: 8   LDTIKRLARFAARRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQNSLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     +   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNSQIFKYLNQFASKAKGLTTAGLIVLVVTAVMTMMTVESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +                   ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSISSYLFTKSLAFAGSTSTPPIFEWLLTAASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +   +++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVVGGVCAAVAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     + GA + +++    
Sbjct: 244 AFATVPMFLLWMYLSWFVTLAGAMIASALPAIR 276


>gi|289773646|ref|ZP_06533024.1| ribonuclease BN family membrane protein [Streptomyces lividans
           TK24]
 gi|289703845|gb|EFD71274.1| ribonuclease BN family membrane protein [Streptomyces lividans
           TK24]
          Length = 394

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 52/269 (19%), Positives = 108/269 (40%), Gaps = 4/269 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           ++      F +++    A+ ++   +L++FP ++   +L G +        V+D V    
Sbjct: 93  LLRRVFAEFKDDELTDRAAALTYYGILALFPALLVLVSLLG-IAGDSATQEVLDNVKKLA 151

Query: 71  PEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
           P      +T+ + Q+ A    G  L  +  + A + +S  V A   S N  Y V E R  
Sbjct: 152 PGSARDVLTNAVEQLQAKAGLGSVLAVVGLVGAVWSASGYVAAFIRSANAVYDVPEGRPV 211

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +    +     ++  V  V+ + + V                   L +    +    +L 
Sbjct: 212 WKVLPLRVALTVVLLVLAVVSALIVVFTGSLARQAGTALGVGDTALTVWSIAKWPVLVLL 271

Query: 189 LFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           +   +  ++   P A+ K    I PG +   + W++ +  F  Y+  F +Y+  Y  LA 
Sbjct: 272 VTFMIAILYWAAPNARVKGFKWISPGSLVALLIWLLASAGFAFYVANFGSYNKTYGTLAG 331

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYY 276
           ++  LV+L++  +  +LG E +A +    
Sbjct: 332 VIIFLVWLWVTNLAILLGLEFDAELARQR 360


>gi|300786173|ref|YP_003766464.1| ribonuclease [Amycolatopsis mediterranei U32]
 gi|299795687|gb|ADJ46062.1| putative ribonuclease [Amycolatopsis mediterranei U32]
          Length = 337

 Score =  172 bits (437), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 54/268 (20%), Positives = 105/268 (39%), Gaps = 4/268 (1%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
           +    + F  ++    A+ ++    LS+FP I+    + G LG    + TVID V    P
Sbjct: 34  LKRTFKQFNRDNLTDWAAALTYYGALSLFPGIIVLTAILGLLG-PDKIQTVIDNVNQLVP 92

Query: 72  EVIAKPITDEILQVLAVPA--KGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
                 +   I ++    +    L  +  L A + +S  + A   + N  Y + E R  Y
Sbjct: 93  GQGKDILVGAIKELTGSRSLAGPLAILGLLGALWSASGYIGAFMRASNAIYGMPEGRPIY 152

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
               +     +   V L + +   VA       +          +L+    +     L +
Sbjct: 153 KVVPLRVALTIAIVVLLALCALGVVATGSVARRLGDLIGLGSTGVLVWEIAKWPVIALLV 212

Query: 190 FIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
            +    ++   P  +      + PG +   + WV+ +  F  Y+  F +Y+  Y  LA +
Sbjct: 213 SVAFALLYWVGPNVRQPGFRWLTPGGLLAVVLWVLASAGFALYVANFGSYNKTYGSLAGV 272

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYY 276
           +  LV+L++  +  +LGAEL+A +    
Sbjct: 273 IAFLVWLWISNLAILLGAELDAELARGR 300


>gi|170780894|ref|YP_001709226.1| putative integral membrane protein [Clavibacter michiganensis
           subsp. sepedonicus]
 gi|169155462|emb|CAQ00570.1| putative integral membrane protein [Clavibacter michiganensis
           subsp. sepedonicus]
          Length = 363

 Score =  172 bits (436), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 51/270 (18%), Positives = 112/270 (41%), Gaps = 3/270 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVVFGA 69
           ++   +  F  +    +A+ ++  A+LS+FP ++   +L G  G     V  V+D++ G 
Sbjct: 36  VLRKTMREFGTDQCTDIAASLTYYAVLSLFPALIAIISLLGVFGQGESTVSAVLDLLRGF 95

Query: 70  WPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            P      I   +   +  PA G       + A + +S  V A   ++NR Y + E R +
Sbjct: 96  APADALALIEPILTGFVESPAAGFALVSGIVLAIWSASGYVGAFSRAMNRIYEIPEGRPF 155

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +  +       ++  V L++ + +          + +       + ++    +      A
Sbjct: 156 WKLKPTQLAVTVIGIVLLLVCALIIAISGPVTDAIGEALGLGQTVQIVWSIAKWPVLAFA 215

Query: 189 LFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           + + +  ++   P AK      +  G     +  V+ +V F  Y+  FS+Y+  Y  LA 
Sbjct: 216 IVLLIAILYYATPNAKQPKFRWMSMGAAIALVVLVIASVAFAFYVTEFSSYAKSYGALAG 275

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           ++  L++L++  +  + GAE +A +     
Sbjct: 276 VVVFLLWLWIANLALLFGAEFDAELERGRQ 305


>gi|311893944|dbj|BAJ26352.1| putative ribonuclease [Kitasatospora setae KM-6054]
          Length = 358

 Score =  172 bits (436), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 48/271 (17%), Positives = 107/271 (39%), Gaps = 4/271 (1%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
             ++      F++++    A+ ++   +L+VFP ++   ++ G LG       V+D +  
Sbjct: 49  LAVLRRTAGEFLDDELPDRAAALTYYGVLAVFPALLVLVSILGLLGGP-VTGAVLDNLRQ 107

Query: 69  AWPEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
             P      ++  + Q+      G     +  L A + +S  V A   + N  Y + E R
Sbjct: 108 LAPGPARDVLSGSVEQLRDGRGAGGVFAAVGLLGALWSASGYVAAFIRAANAVYDIREGR 167

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
             +    +  G  L+  V L+  + + V                   + +    +    +
Sbjct: 168 PVWKLTPLRVGLTLVLMVLLLASAVIVVFTGPLAERAGDLLGIGPTAVTVWSVAKWPVLV 227

Query: 187 LALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           L + + +  ++   P  + +    I PG +   + W+  +  F  Y+  F +Y+  Y  L
Sbjct: 228 LLVSVMIALLYWAAPNVRGRGWHWISPGSLLAVLLWLALSGGFAAYVAWFGSYNRTYGTL 287

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           A ++  LV+L++  +  +LG E +A +    
Sbjct: 288 AGVVVFLVWLWLSNLAVLLGLEFDAELARER 318


>gi|188581649|ref|YP_001925094.1| ribonuclease BN [Methylobacterium populi BJ001]
 gi|179345147|gb|ACB80559.1| ribonuclease BN [Methylobacterium populi BJ001]
          Length = 396

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 51/273 (18%), Positives = 119/273 (43%), Gaps = 9/273 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI+        E     +++ ++   LL++FP +    ++ G +     +   I+ + G 
Sbjct: 104 DILKRTYRDIGENRLTLVSAGVTFFVLLAIFPAVAALVSVYGLVADVATINQQIESLRGI 163

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P      + +++ ++       L          + + ++ GV+ +  +LN  Y   E R
Sbjct: 164 LPSGGVDILAEQVKRLTEKGDTTLGLTALFGIALSVWSANGGVKHVFDALNLVYNEREQR 223

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            ++   L+S  +   A + +VI     VA+P+A+ ++      L +    +   R  A  
Sbjct: 224 GFFKLNLVSLAFTAGALLFIVIALAGIVAVPVAIQFL-----GLSSDAWWLALLRWPALF 278

Query: 187 LALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           + + + L  ++ + P+    +   + PG +F    W+ G++LF+ Y+  F +Y   Y  L
Sbjct: 279 VVVILMLAVLYRYGPSRDAPRWRWVTPGGMFAAFLWLAGSLLFSWYVSNFGSYDKTYGSL 338

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            + +  + ++++     +LGA+LNA +     +
Sbjct: 339 GAAIGFMTWIWLSTTIVLLGAQLNAELEHQTAK 371


>gi|308177256|ref|YP_003916662.1| ribonuclease BN-like protein [Arthrobacter arilaitensis Re117]
 gi|307744719|emb|CBT75691.1| ribonuclease BN-like protein [Arthrobacter arilaitensis Re117]
          Length = 376

 Score =  171 bits (434), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 47/267 (17%), Positives = 105/267 (39%), Gaps = 3/267 (1%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVVFGAWPE 72
            +I  F  +    +A+ ++  A+LS+FP ++   +L G  G        ++ ++     +
Sbjct: 50  RSIREFSRKKCTDLAASLTYFAMLSIFPALLAVVSLLGVAGQAENMTRNILSLIQELASK 109

Query: 73  VIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
            + + +   I Q+ + P+ GL      L A + +S  V A   ++N+ Y V E R +Y  
Sbjct: 110 EVVETLRQPIEQLASAPSAGLALVAGLLGALWSASGYVGAFGRAMNQIYEVYEGRPFYKL 169

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
           R +     L+  V + ++  + +        +        + + I    +    +L   +
Sbjct: 170 RPLMLALTLVLLVAVSVLGMLLIVSGPLAQAIGNVLGLGESAVAIWNIAKWPVIVLCAIV 229

Query: 192 GLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
            +  ++   P  K      +  G     +   V  V F  Y+  F  Y+  Y  +  ++ 
Sbjct: 230 LVAVLYYGAPNVKQPKFRWVSLGSAIALLVLAVATVGFFFYVSNFGNYNKTYGAIGGVIV 289

Query: 251 CLVFLYMLGVFFILGAELNASMIIYYW 277
            L++L++  +  + GA  +A       
Sbjct: 290 LLLWLWIANLSLLFGAVFDAEAERGRQ 316


>gi|256824738|ref|YP_003148698.1| hypothetical protein Ksed_08810 [Kytococcus sedentarius DSM 20547]
 gi|256688131|gb|ACV05933.1| predicted membrane protein [Kytococcus sedentarius DSM 20547]
          Length = 417

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 54/275 (19%), Positives = 104/275 (37%), Gaps = 5/275 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           +   A+  F ++    +A+ ++  A+LS+FP I+   +L G  G  +        +    
Sbjct: 92  VARRALYEFTDDGCTDLAAGLTYFAVLSIFPAIIGLVSLLGVFGQGESTTQAFLQIAVDL 151

Query: 71  PEVIAKPITDEILQVLAVPAKG-----LFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
                      I   +    +         +  L A + +SN V      +NR Y V E 
Sbjct: 152 GADPQSTGYTFIEDFITKQQESSGAGLALALGLLGALWSASNYVNGFSRMMNRIYEVPEG 211

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R +++ R +     +L  + + ++   FV        V            I    +  A 
Sbjct: 212 RPFWVLRPVMVLVTVLVLLLVAVLGLSFVLTGPVAESVFGVVGLGDLATTIWAWAKWPAA 271

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
            L +   +  ++   P  K     + PG I  ++ WV+ +  F  YI  F  Y   Y  +
Sbjct: 272 ALIVIFIIRLLYWATPNVKLPRQILTPGAILAFLIWVLASAAFGFYIANFGNYDATYGSM 331

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           A ++  L++L++     +LGAE++A        K+
Sbjct: 332 AGVIVFLLWLWLTNTVLLLGAEIDAEAERMRELKR 366


>gi|288962283|ref|YP_003452578.1| ribonuclease BN [Azospirillum sp. B510]
 gi|288914549|dbj|BAI76034.1| ribonuclease BN [Azospirillum sp. B510]
          Length = 353

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 57/273 (20%), Positives = 120/273 (43%), Gaps = 7/273 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI+    +    ++   +A+ +S  ALL++FP +    ++ G +     + T +  + G 
Sbjct: 54  DILLRVWDEQSGDNVSMLAAGVSYYALLAIFPAVAALVSIFGLVADPAMIETQLSQLRGL 113

Query: 70  WPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P      ++D+  +V   P++GL        L   + +S G  +L  +LN AY   E R
Sbjct: 114 LPPEALTIVSDQARKVATAPSQGLGFGLIFGLLLTLWSASRGTNSLVTALNIAYGEKETR 173

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            + +   +S G  +   + +++   + +A+P A+A V            I    R     
Sbjct: 174 GFLMLAALSMGLTVAGLLFVIVAMALIIAVPAAIAIVGLQ---DTPAGWIANLARWPILA 230

Query: 187 LALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
            A+ + L   + + P  +  +   +  G     + W++G++ F+ Y+  F +Y+  Y  +
Sbjct: 231 AAIMLALAVFYRYAPDRREPRWRWVTWGSAMATMVWLLGSLGFSVYVSNFGSYNETYGSV 290

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            +++  L++  +     +LGAELNA +     R
Sbjct: 291 GAVVILLLWFNLTSYVVLLGAELNAEIEHQTAR 323


>gi|284043536|ref|YP_003393876.1| ribonuclease BN [Conexibacter woesei DSM 14684]
 gi|283947757|gb|ADB50501.1| ribonuclease BN [Conexibacter woesei DSM 14684]
          Length = 328

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 53/274 (19%), Positives = 104/274 (37%), Gaps = 4/274 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +F  +   +  + E++    A+ ++   LLS+FP ++   ++ G  G  Q     +  + 
Sbjct: 29  LFATLKRTVREYSEDNMSDWAAALTYYGLLSLFPALIALVSILGLFGDPQSTTRSLTDIV 88

Query: 68  GAW-PEVIAKPITDEILQVLAVP--AKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
               P   A      I  + +    A  LF +   AA + +S  V A   + N  Y   E
Sbjct: 89  TRLGPSSAADTFEGPIRSITSNRGAAGVLFFVGLGAAIWSASGYVGAFTRAANIVYETPE 148

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R ++  R +     L   V L +++   V     +  V          + +    +   
Sbjct: 149 GRPFWKLRPLQLLVTLAMVVMLALVALALVMTGPVVETVADSIGIGSTAVTVWEFAKWPV 208

Query: 185 TMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            +  + +    ++   P  K      + PG +   + W++ + LF  Y+  F +Y   Y 
Sbjct: 209 MLAVVVLMFAVLYHVSPNVKLPGFRWVTPGALLAIVVWLIASALFAFYVANFGSYDKTYG 268

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
            L  I+  LV+ ++  V  +LG ELN+       
Sbjct: 269 TLGGIVVLLVWFWITNVALLLGMELNSERERSRE 302


>gi|77460571|ref|YP_350078.1| ribonuclease BN [Pseudomonas fluorescens Pf0-1]
 gi|77384574|gb|ABA76087.1| putative ribonuclease [Pseudomonas fluorescens Pf0-1]
          Length = 316

 Score =  170 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 63/273 (23%), Positives = 125/273 (45%), Gaps = 1/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +  ++   I  FV+++    AS ++   L S+FPFI+F   L GFL    F   +     
Sbjct: 11  LHRVMVRTITEFVDDEMSTYASALAYQMLFSLFPFILFLIALIGFLHLPDFFSWLRLQSE 70

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P    + +   I Q+      GL ++  + A Y +S GV  +  ++N AY VVE R 
Sbjct: 71  LVLPPQALEQVNPVIDQLQQSK-GGLLSVGIVIALYTASAGVRLMMSAMNAAYDVVEGRP 129

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            +    +S  Y +  +  L++ + + V  P  + ++         ++ +    R    ++
Sbjct: 130 LWKRFPLSVIYTVGIAGMLLVAAALMVLGPQVMGWIAAQVGLEEVIVTLWTIARWPVIVI 189

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            + + +  ++  +P  K +   I PG +   + W++ ++ F  Y+ TF+ Y+ MY  + +
Sbjct: 190 LMMVAVALIYYVMPDVKQEFRFITPGSVLAVVVWIIASLGFAFYVKTFANYNAMYGSIGA 249

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  L++ Y+     +LGAE+NA +       K
Sbjct: 250 IIVLLLYFYISSAVLLLGAEMNAVIEHMSSEGK 282


>gi|284991775|ref|YP_003410329.1| ribonuclease BN [Geodermatophilus obscurus DSM 43160]
 gi|284065020|gb|ADB75958.1| ribonuclease BN [Geodermatophilus obscurus DSM 43160]
          Length = 374

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 57/271 (21%), Positives = 114/271 (42%), Gaps = 8/271 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
           +     I+  A      ++   +   ++    L++FP ++   N+ G + + + V   ++
Sbjct: 66  WRGWKQIVQRAWAENNADNMPIIGGGVAFFGFLAIFPALIAMMNIYGLVASPETVARQVE 125

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTI---SALAAAYFSSNGVEALRISLNRAYR 121
            +    PE  A  I D++  ++      L      S L A + +S GV  L  ++N AY 
Sbjct: 126 DLSAQLPESAADLIGDQLNAIVTNSGGALSFGLAASVLGALWSASGGVGNLVTAVNLAYD 185

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
            VE R +   + IS G  L A V ++I   +   +P  L  +    P      ++    R
Sbjct: 186 EVETRGFVKRKAISLGLTLGAIVFVLITFTLVAVVPNVLDAL----PLGPFATVLAQVVR 241

Query: 182 IYATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
               +      L  ++   P   +  +  +  G I   + W V ++ F+ Y+  F +Y  
Sbjct: 242 WVVLLGIFAGSLAVLYRVAPDRDAPQLRWVSLGAIVVTVIWAVVSLGFSIYVDNFGSYDK 301

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNAS 271
            Y  +A ++  +++LY+     +LGAE+N+ 
Sbjct: 302 TYGAIAGVIVLMLWLYLTCYLILLGAEINSE 332


>gi|162456942|ref|YP_001619309.1| hypothetical protein sce8659 [Sorangium cellulosum 'So ce 56']
 gi|161167524|emb|CAN98829.1| hypothetical protein sce8659 [Sorangium cellulosum 'So ce 56']
          Length = 337

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 65/280 (23%), Positives = 131/280 (46%), Gaps = 7/280 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +        D + D  +  +++    +A+ ++   +L++FPF++F   LAG +       
Sbjct: 3   LPGREIPWKDFLNDIKQECIKDKIDTIAASLAFFGVLAIFPFLLFAVALAGLVIDPAESA 62

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            ++  ++   P  +A  + + +  +    +  L T+ AL A + +S GV AL  +LN AY
Sbjct: 63  QLMSELYQVAPPAVANILGERLQALTGGQSPALLTVGALGAVWAASGGVTALMDALNSAY 122

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
            V + RS+   R I+    L  +V L I S + VA P   A++            ++   
Sbjct: 123 GVEDKRSYLKRRGIALLVTLGGAVLLTIASALAVATPALAAHLG-------PFATLVLWL 175

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R+  + L + + L  ++  LP  + +   I PG +   + WV+ ++ F+ Y+  F +Y  
Sbjct: 176 RMPVSALIVMVVLATLYYLLPDVEQQFKFITPGSVVAVVIWVLASLGFSFYVSRFGSYEV 235

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            Y  L  ++  L+++++  +  +LGAE+NA +       K
Sbjct: 236 SYGALGGVIILLLWMWISSLAVLLGAEINAIIEHRSPEGK 275


>gi|218528864|ref|YP_002419680.1| ribonuclease BN [Methylobacterium chloromethanicum CM4]
 gi|218521167|gb|ACK81752.1| ribonuclease BN [Methylobacterium chloromethanicum CM4]
          Length = 388

 Score =  169 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 52/275 (18%), Positives = 124/275 (45%), Gaps = 9/275 (3%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
            +DI       F ++   ++A+ ++   LLS+FP I       G +     +   +  + 
Sbjct: 94  WWDIATRVYLEFNKDRVLSVAAGVTFYTLLSLFPAIAALVTCYGLVADVNTINVHLSTLH 153

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTI---SALAAAYFSSNGVEALRISLNRAYRVVE 124
           G  PE   + I +++ ++    +  L      S   + + ++  ++A+  +LN  Y   E
Sbjct: 154 GVLPESAIEIIGEQVKRIATKGSGALGFTFFTSLTLSLWSANAAMKAMFDALNVVYEEEE 213

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R+++   + S  +   A + +++     V +P+   ++      LG+   +I  GR   
Sbjct: 214 KRNFFWLNVRSLTFTAGALLFIILALISIVVLPVVFNFL-----GLGDGARLIAMGRWPV 268

Query: 185 TMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            +L L  GL  ++ + P+  +++   +  G +   + W++ ++LF+ Y+  F  Y+  Y 
Sbjct: 269 LLLVLLGGLAVLYRYGPSRERARWRWVGAGSVVAGVLWLIASILFSWYVANFGNYNETYG 328

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            L +++  + ++++     +LG E+NA +     R
Sbjct: 329 SLGAVIGFMTWIWISATIVLLGGEINAEIEHQTAR 363


>gi|15597947|ref|NP_251441.1| hypothetical protein PA2751 [Pseudomonas aeruginosa PAO1]
 gi|107102287|ref|ZP_01366205.1| hypothetical protein PaerPA_01003345 [Pseudomonas aeruginosa PACS2]
 gi|116050744|ref|YP_790435.1| hypothetical protein PA14_28530 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218891066|ref|YP_002439932.1| hypothetical protein PLES_23291 [Pseudomonas aeruginosa LESB58]
 gi|254241206|ref|ZP_04934528.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|296388780|ref|ZP_06878255.1| hypothetical protein PaerPAb_11543 [Pseudomonas aeruginosa PAb1]
 gi|313107873|ref|ZP_07794045.1| putative membrane protein [Pseudomonas aeruginosa 39016]
 gi|9948830|gb|AAG06139.1|AE004703_5 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115585965|gb|ABJ11980.1| putative membrane protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126194584|gb|EAZ58647.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218771291|emb|CAW27056.1| putative membrane protein [Pseudomonas aeruginosa LESB58]
 gi|310880547|gb|EFQ39141.1| putative membrane protein [Pseudomonas aeruginosa 39016]
          Length = 299

 Score =  169 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 64/273 (23%), Positives = 126/273 (46%), Gaps = 1/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +F ++   +  F+E+D    AS ++   L S+FPF++    L G+L   +F   + +   
Sbjct: 11  LFGLVKRTVNEFLEDDMPTYASALAYQMLFSLFPFLLVLITLVGYLHLPEFFAWLREQAA 70

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P      +   I Q+      GL +I    A + SS G+ ++ I+LN AY V E R 
Sbjct: 71  LLLPPEAMDQVNPVIDQLQ-QQKGGLLSIGIAVALWTSSAGIRSMMIALNAAYDVKESRP 129

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            +    +S  Y L  ++ L++ + + V  P  +A++         L+ +    R    + 
Sbjct: 130 VWKRFSLSILYTLGIALLLLVAAGLMVTGPQVIAWIAGLVGLEQYLVTLWTWLRWPLAVF 189

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            L + +   +  +P  + +   I PG + + I+W+  ++ +  Y+  F+ Y+ MY  + +
Sbjct: 190 LLMLAVALFYYLVPDVEQRFRFITPGSVLSVIAWIAASLAYGFYVKNFANYNAMYGSIGA 249

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  L++ Y+     + GAELNA +  +    K
Sbjct: 250 IIILLLYFYLSAAVVLFGAELNAVIEHHSEDGK 282


>gi|70731937|ref|YP_261679.1| ribonuclease BN [Pseudomonas fluorescens Pf-5]
 gi|68346236|gb|AAY93842.1| ribonuclease BN, putative [Pseudomonas fluorescens Pf-5]
          Length = 316

 Score =  169 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 64/273 (23%), Positives = 125/273 (45%), Gaps = 1/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +  ++   +  F+ ++    AS ++   L S+FPFI+F   L GFL    F   +     
Sbjct: 11  LHRVLIRTVNEFIADEMSTYASALAYQMLFSLFPFILFLIALIGFLHLPDFFTWLRLQSE 70

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P    + +   I Q+      GL +I  + A + +S GV  +  ++N AY VVE R 
Sbjct: 71  LVLPHEALEQVNPVIDQLQQSK-GGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRP 129

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            +    +S  Y +  +  L+  + + V  P  +A++         ++ +    R    +L
Sbjct: 130 IWKRFPLSVFYTVGIAGMLLAAAALMVLGPQVMAWLAGQVGLEDFIVTLWTILRWPVIVL 189

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            + + +  ++  +P  + K   I PG +   + W+V ++ F +Y+ TF+ Y+ MY  + +
Sbjct: 190 LMMVAVALMYYVMPDVQQKFRFITPGSVLAVVVWIVASLGFAYYVKTFANYNAMYGSIGA 249

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  L++ Y+     +LGAE+NA +       K
Sbjct: 250 IIVLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|296114390|ref|ZP_06833044.1| ribonuclease BN [Gluconacetobacter hansenii ATCC 23769]
 gi|295979151|gb|EFG85875.1| ribonuclease BN [Gluconacetobacter hansenii ATCC 23769]
          Length = 397

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 61/277 (22%), Positives = 118/277 (42%), Gaps = 7/277 (2%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
             +  ++     +   +     A+  +  A LS+FP +    ++ G L   Q V   + V
Sbjct: 82  RHILPVMKQVATNIASDQITLAAAGCAFYATLSLFPAMSTMISIYGLLFDPQTVEPQLVV 141

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLNRAYRV 122
           +    P      I D I  ++A     L     +    A + +S    +L +++N AY  
Sbjct: 142 LRNLLPPAAYDLICDRIHVLVAQSHSSLTLNLIVSTTIAMWSASAATRSLLLAMNVAYNT 201

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPA---LGNLLLIIWN 179
            E RS+   + +     L A    ++   + VA+P+ L Y+ +        G+L L++  
Sbjct: 202 PETRSFLRFQAMGMIMTLCAICGGILTLALMVALPILLDYLPQKLSLAPPPGSLELLVRM 261

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTY 238
           G     +L +  G   ++ F P  +S     ILPG +   + W++ +  F++Y+   + Y
Sbjct: 262 GGPALMLLFVLSGCSLLYRFGPNRRSPSWRCILPGSVAATLLWLLTSFGFSYYVSHIAGY 321

Query: 239 STMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
              Y  L + +  +++ Y+     +LGAELNA + I 
Sbjct: 322 GATYGPLGAFVATMMWFYVSAYVVLLGAELNAGLEIQ 358


>gi|152983785|ref|YP_001347855.1| hypothetical protein PSPA7_2488 [Pseudomonas aeruginosa PA7]
 gi|150958943|gb|ABR80968.1| membrane protein, putative [Pseudomonas aeruginosa PA7]
          Length = 299

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 64/273 (23%), Positives = 126/273 (46%), Gaps = 1/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +F ++   +  F+E+D    AS ++   L S+FPF++    L G+L   +F   + +   
Sbjct: 11  LFGLVKRTVNEFLEDDMPTYASALAYQMLFSLFPFLLVLITLVGYLHLPEFFAWLREQAA 70

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P      +   I Q+      GL +I    A + SS G+ ++ I+LN AY V E R 
Sbjct: 71  LLLPPEAMDQVNPVIDQLQ-QQKGGLLSIGIAVALWTSSAGIRSMMIALNAAYDVKESRP 129

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            +    +S  Y L  ++ L++ + + V  P  +A++         L+ +    R    + 
Sbjct: 130 VWKRFSLSILYTLGIALLLLVAAGLMVTGPQVIAWIASLVGLEQYLVTLWTWLRWPLAVF 189

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            L + +   +  +P  + +   I PG + + I+W+  ++ +  Y+  F+ Y+ MY  + +
Sbjct: 190 LLMLAVALFYYLVPDVEQRFRFITPGSVLSVIAWIGASLAYGFYVKNFANYNAMYGSIGA 249

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  L++ Y+     + GAELNA +  +    K
Sbjct: 250 IIILLLYFYLSAAVVLFGAELNAVIEHHSKDGK 282


>gi|163850307|ref|YP_001638350.1| ribonuclease BN [Methylobacterium extorquens PA1]
 gi|240137378|ref|YP_002961849.1| Ribonuclease BN [Methylobacterium extorquens AM1]
 gi|163661912|gb|ABY29279.1| ribonuclease BN [Methylobacterium extorquens PA1]
 gi|240007346|gb|ACS38572.1| Ribonuclease BN [Methylobacterium extorquens AM1]
          Length = 388

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 51/275 (18%), Positives = 123/275 (44%), Gaps = 9/275 (3%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
            +DI       F ++   ++A+ ++   LLS+FP I       G +     +   +  + 
Sbjct: 94  WWDIATRVYLEFNKDRVLSVAAGVTFYTLLSLFPAIAALVTCYGLVADVNTINVHLSTLH 153

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTI---SALAAAYFSSNGVEALRISLNRAYRVVE 124
           G  PE   + I +++ ++    +  L      S   + + ++  ++A+  +LN  Y   E
Sbjct: 154 GVLPESAIEIIGEQVKRIATKGSGALGFTFFTSLTLSLWSANAAMKAMFDALNVVYEEEE 213

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R+++   + S  +   A + +++     V +P+   ++      LG+   +I   R   
Sbjct: 214 KRNFFWLNVRSLTFTAGALLFIILALISIVVLPVVFNFL-----GLGDGARLIAMARWPV 268

Query: 185 TMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            +L L  GL  ++ + P+  +++   +  G +   + W++ ++LF+ Y+  F  Y+  Y 
Sbjct: 269 LLLVLLGGLAVLYRYGPSRERARWRWVGAGSVVAGVLWLIASILFSWYVANFGNYNETYG 328

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            L +++  + ++++     +LG E+NA +     R
Sbjct: 329 SLGAVIGFMTWIWISATIVLLGGEINAEIEHQTAR 363


>gi|315303543|ref|ZP_07874107.1| transporter [Listeria ivanovii FSL F6-596]
 gi|313628085|gb|EFR96654.1| transporter [Listeria ivanovii FSL F6-596]
          Length = 289

 Score =  169 bits (427), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 66/273 (24%), Positives = 134/273 (49%), Gaps = 2/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +F +         + D    A+ ++   L S+FP ++  A L  ++   +   +V +++ 
Sbjct: 14  IFQVGQTVTGRVGQNDVSGNAAQLAYYMLFSIFPMMLIAATLLAYMHIDK--DSVFNMLK 71

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              PE I   + + +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R+
Sbjct: 72  EFAPEQILDFLEENLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRN 131

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           + + RL+S  + L    T+     + V       ++        + L    N R   T++
Sbjct: 132 YVMQRLLSMLFTLAMLATVGATLLLIVFGQQIGLFLINHLNFSEDFLDFWNNLRWTVTLI 191

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            +F+   F++   P  +S ++S+LPG IF+ + W + +V F +Y+  F+ YS  Y  +  
Sbjct: 192 VIFVVFTFLYWVAPNRRSTLISVLPGAIFSTVGWTIASVGFAYYVNNFANYSATYGSIGV 251

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  +++ Y+ G+  ++G ELNA++ I   +++
Sbjct: 252 IIILMLWFYLTGIILMVGGELNATLAIRKKKRQ 284


>gi|70726074|ref|YP_252988.1| hypothetical protein SH1073 [Staphylococcus haemolyticus JCSC1435]
 gi|68446798|dbj|BAE04382.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 403

 Score =  168 bits (426), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 62/267 (23%), Positives = 121/267 (45%), Gaps = 3/267 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L++FP       L   L       + I  +   
Sbjct: 66  NFLSYLIYRIGKDDASGLAAQMTYHFVLAMFPM---LIFLLTLLPLFNLDQSQITGLLSN 122

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  V    + GL +I  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 123 APADTSSLIKGVISDVTKNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDNRNGI 182

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +++S  + ++  V  ++   +     +   ++         +  I    R+   ++ +
Sbjct: 183 LLKILSVIFTIVLGVVFLVAMALPTMGSVIAHFLFGPLGLDSQVKWIFSLIRVVLPLIII 242

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            I    ++   P  K+K+ S+LPG IFT + W++G+  F  YI  F  YS  Y  +A I+
Sbjct: 243 LILFTILYSVAPNVKTKLKSVLPGAIFTSVIWLLGSFAFGFYISNFGNYSKTYGSIAGII 302

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYY 276
             L++LY+     I+GAE+NA +   +
Sbjct: 303 ILLIWLYLTSFIIIIGAEINAIIHQRH 329


>gi|284993043|ref|YP_003411597.1| ribonuclease BN [Geodermatophilus obscurus DSM 43160]
 gi|284066288|gb|ADB77226.1| ribonuclease BN [Geodermatophilus obscurus DSM 43160]
          Length = 347

 Score =  168 bits (425), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 48/272 (17%), Positives = 103/272 (37%), Gaps = 6/272 (2%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
           +   +  F E++    A+ ++    L++FP ++   ++ G L        + D +    P
Sbjct: 56  LKRTLTEFSEDNLTDWAAALTYYGTLALFPALIALVSIVGLLTNP---QQLTDALTAVVP 112

Query: 72  EVIAKPITDEILQVLAVPA--KGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
              A  +   I Q+    A       I   AA + +S  V A   + N  Y   E R  +
Sbjct: 113 AQAADTLNPVIEQLAGNTAPVGIGLVIGLAAAIWSASGYVGAFTRAANVVYETPEGRKVW 172

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
             + +     L+  +   ++  + V     +  V         ++ +    +    ++ +
Sbjct: 173 KLKPLQLLVTLIGVLFAALIVAMLVLSGGVVDAVAGAIGLPDAVVTVWSYAKWPVVVVLV 232

Query: 190 FIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
            + +  ++   P  K +      PG     + W   + LF  Y+  FS Y+  Y  LA +
Sbjct: 233 ALMIAVLYYSTPNVKLRGFRFTSPGAAVALLVWAAASALFAFYVANFSNYNATYGALAGV 292

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +  LV+ ++  +  + G EL+A +      K+
Sbjct: 293 IVFLVWFWITNLALLFGIELDAEIERTKELKE 324


>gi|332977963|gb|EGK14707.1| ribonuclease BN [Psychrobacter sp. 1501(2011)]
          Length = 523

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 44/275 (16%), Positives = 109/275 (39%), Gaps = 6/275 (2%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVID 64
              F+ +   I +F+E+D    A+ ++ + LLS+ P +     +   + A       + D
Sbjct: 13  KTWFNFLRFLIRNFIEDDSQQKAASLTYTTLLSIVPILTVLLMILSSIPALESVREQISD 72

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
           +++          ++  +    A  +  L  I A+A    S   +  +  + N+ +RV +
Sbjct: 73  LIYSNLLPQSGLQVSQYLNDF-AEKSSNLTAIGAMALFVTSIMTLTTIERAFNQIWRVED 131

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
                 + L  +  + L  + L     V   +       ++      +    I       
Sbjct: 132 RSGGVKSILRYWTIITLGPLVLGTAFIVSSTVQSLSFLNQQIGGYGIDWNFWIQ----LV 187

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
           +      G I ++ F+P AK  + +     +F  +++ +    F   +  F++Y  +Y  
Sbjct: 188 SFAITIAGFIGMYWFIPKAKVPLKNAAIAGVFVAVTFELLKYSFGIVMTNFTSYEAIYGA 247

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            A++   L+++Y+     +LG E++ ++ I+  ++
Sbjct: 248 FAALPIFLLWIYLSWNIILLGVEISYTLTIFATKE 282


>gi|313632903|gb|EFR99846.1| transport protein [Listeria seeligeri FSL N1-067]
 gi|313637503|gb|EFS02939.1| transport protein [Listeria seeligeri FSL S4-171]
          Length = 289

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 68/273 (24%), Positives = 134/273 (49%), Gaps = 2/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +F +         + D    A+ ++   L S+FP ++  A L  ++   +   +V +++ 
Sbjct: 14  IFQVGQTVTGRVGQNDVSGNAAQLAYYMLFSIFPMMLIAATLLAYMHIDK--DSVFNMLK 71

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              PE I   + + +  +L     GL +I  +A  + +SNG+ A+  +LN+AY V   R+
Sbjct: 72  EFAPEQILDFLEENLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKALNKAYGVTNKRN 131

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           + + RL+S  + L    T+     + V       ++        + L    N R   T++
Sbjct: 132 YVVQRLLSMLFTLAMLATVGATLLLIVFGQQIGLFLINHLNFSEDFLSFWNNLRWTVTLI 191

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            +F+   F++   P  +S ++S+LPG IF+ I W V +V F +Y+  F+ YS  Y  +  
Sbjct: 192 VIFVVFTFLYWVAPNRRSTLISVLPGAIFSTIGWTVASVGFAYYVNNFANYSATYGSIGV 251

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  +++ Y+ G+  ++G ELNA++ I   +K+
Sbjct: 252 IIILMLWFYLTGIILMVGGELNATLAIRKKKKQ 284


>gi|115374664|ref|ZP_01461942.1| ribonuclease BN [Stigmatella aurantiaca DW4/3-1]
 gi|310820812|ref|YP_003953170.1| ribonuclease bn [Stigmatella aurantiaca DW4/3-1]
 gi|115368332|gb|EAU67289.1| ribonuclease BN [Stigmatella aurantiaca DW4/3-1]
 gi|309393884|gb|ADO71343.1| Ribonuclease BN [Stigmatella aurantiaca DW4/3-1]
          Length = 352

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 55/271 (20%), Positives = 120/271 (44%), Gaps = 6/271 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           +      + +  +    +A  ++ SA+L++FPF++F  +LA  +        +I  +   
Sbjct: 12  EFFKSLKDEYTRDKVGDVAGALTFSAILAIFPFLLFLVSLASVIIDPAQAEQLIQELARV 71

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P+ +   + D +  + A    GL T+  + A + +S G+ AL  +LN AY V E R ++
Sbjct: 72  APKEVVTILGDRLHALAASNNVGLLTLGGVGAVWAASGGMVALMTALNTAYGVEESRPFW 131

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
             R ++    L+ +   ++ +   V  P     V   FP       ++   R+    + +
Sbjct: 132 KVRGVALLVTLVTAAISILAAAAAVVTPALAEKVGGPFP------TLVTWLRLPVAGVMM 185

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
                 ++  LP  + +   I PG +   + W++ +  F+ Y+  F +Y   Y  +  ++
Sbjct: 186 MFVWALLYYALPDVQQRFRFITPGSVAGVLIWLLASWGFSQYVANFGSYDANYGAIGGVI 245

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             L+++++     ++GAE+NA +       K
Sbjct: 246 VLLMWMWISSQVILVGAEINAILEHRSPEGK 276


>gi|313608345|gb|EFR84318.1| transport protein [Listeria monocytogenes FSL F2-208]
          Length = 289

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 66/263 (25%), Positives = 130/263 (49%), Gaps = 2/263 (0%)

Query: 18  HFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKP 77
              + D    A+ ++   L S+FP ++  A L  +L   +   +V +++    P+ I   
Sbjct: 24  RVGKNDVSGNAAQLAYYMLFSIFPMLLIAATLLAYLHIDK--DSVFNMIKEFAPDQIMDF 81

Query: 78  ITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFG 137
           + + +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R++ + RL+S  
Sbjct: 82  LEENLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRNYVVQRLLSMF 141

Query: 138 YVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVH 197
           + L    T+     + V       ++        + L    N R   T++ +F+   F++
Sbjct: 142 FTLAMLATVGATLLLLVFGQQIGMFLINHLNFSEDFLSFWNNLRWTVTLIVIFVVFTFLY 201

Query: 198 LFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
              P  +S ++S+LPG +F+ I W V ++ F +Y+  F  YS  Y  +  I+  +++ Y+
Sbjct: 202 WVAPNRRSTLISVLPGALFSTIGWTVASLGFAYYVNNFGNYSATYGSIGVIIILMLWFYL 261

Query: 258 LGVFFILGAELNASMIIYYWRKK 280
            G+  ++G ELNA++ I   +K+
Sbjct: 262 TGIILMIGGELNATLAIRKKKKE 284


>gi|49086024|gb|AAT51322.1| PA2751 [synthetic construct]
          Length = 300

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 64/273 (23%), Positives = 124/273 (45%), Gaps = 1/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +F ++   +  F+E D    AS ++   L S+FPF++    L G+L   +F   + +   
Sbjct: 11  LFGLVKRTVNEFLEGDMPTYASALAYQMLFSLFPFLLVLITLVGYLHLPEFFAWLREQAA 70

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P      +   I Q+      GL  I    A + SS G+ ++ I+LN AY V E R 
Sbjct: 71  LLLPPEAMDQVNPVIDQLQ-QQKGGLLPIGIAVALWTSSAGIRSMMIALNAAYDVKESRP 129

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            +    +S  Y L  ++ L++ + + V  P  +A++         L+ +    R    + 
Sbjct: 130 VWKRFSLSILYTLGIALLLLVAAGLMVTGPQVIAWIAGLVGLEQYLVTLWTWLRWPLAVF 189

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            L + +   +  +P  + +   I PG + + I+W+  ++ +  Y+  F+ Y+ MY  + +
Sbjct: 190 LLMLAVALFYYLVPDVEQRFRFITPGSVLSVIAWIAASLAYGFYVKNFANYNAMYGSIGA 249

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  L++ Y+     + GAELNA +  +    K
Sbjct: 250 IIILLLYFYLSAAVVLFGAELNAVIEHHSEDGK 282


>gi|291455251|ref|ZP_06594641.1| membrane protein [Streptomyces albus J1074]
 gi|291358200|gb|EFE85102.1| membrane protein [Streptomyces albus J1074]
          Length = 382

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 51/279 (18%), Positives = 105/279 (37%), Gaps = 6/279 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +R+       ++   +  F +++    A+ ++   +L++FP ++   +L G  G      
Sbjct: 78  LRKKSWK--AVLRRTVAEFQDDELADRAAALTYYGVLALFPGLLVLVSLLGVAG-ESTTR 134

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNR 118
            V++ +    P      +T  +  V      G  L  +  LAA + +S  V A   S N 
Sbjct: 135 RVLESIKKMAPGPARDVVTSAVEGVQGAGGVGSLLAVVGVLAALWSASGYVGAFIRSSNA 194

Query: 119 AYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIW 178
            Y + E R  +    +  G  +   V  V  + + V                   L +  
Sbjct: 195 VYDMPEGRPVWKVLPVRVGTTVALVVMAVGSALIVVFTGDLARRAGSLLGIGDTALTVWS 254

Query: 179 NGRIYATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
             +    +L +   +  +    P  K      + PG     + W++ +  F  Y+  F +
Sbjct: 255 IAKWPVLLLLVIGMIALLFWAAPNTKGPGFRWVTPGSFLALVIWLLASAGFAVYVANFGS 314

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           Y+  Y  LA ++  LV+L++  +  +LG E +A +    
Sbjct: 315 YNKTYGALAGVVVFLVWLWISNIAILLGLEFDAELARER 353


>gi|46907937|ref|YP_014326.1| ribonuclease BN [Listeria monocytogenes serotype 4b str. F2365]
 gi|47094251|ref|ZP_00231961.1| ribonuclease BN, putative [Listeria monocytogenes str. 4b H7858]
 gi|217964144|ref|YP_002349822.1| transporter [Listeria monocytogenes HCC23]
 gi|226224309|ref|YP_002758416.1| transport protein [Listeria monocytogenes Clip81459]
 gi|254826046|ref|ZP_05231047.1| YihY family protein [Listeria monocytogenes FSL J1-194]
 gi|254853622|ref|ZP_05242970.1| YihY family protein [Listeria monocytogenes FSL R2-503]
 gi|254932848|ref|ZP_05266207.1| YihY family protein [Listeria monocytogenes HPB2262]
 gi|255520201|ref|ZP_05387438.1| transport protein [Listeria monocytogenes FSL J1-175]
 gi|300764677|ref|ZP_07074668.1| ribonuclease BN [Listeria monocytogenes FSL N1-017]
 gi|46881206|gb|AAT04503.1| YihY family protein [Listeria monocytogenes serotype 4b str. F2365]
 gi|47017379|gb|EAL08202.1| ribonuclease BN, putative [Listeria monocytogenes str. 4b H7858]
 gi|217333414|gb|ACK39208.1| transporter [Listeria monocytogenes HCC23]
 gi|225876771|emb|CAS05480.1| Putative transport protein [Listeria monocytogenes serotype 4b str.
           CLIP 80459]
 gi|258606997|gb|EEW19605.1| YihY family protein [Listeria monocytogenes FSL R2-503]
 gi|293584402|gb|EFF96434.1| YihY family protein [Listeria monocytogenes HPB2262]
 gi|293595286|gb|EFG03047.1| YihY family protein [Listeria monocytogenes FSL J1-194]
 gi|300514563|gb|EFK41619.1| ribonuclease BN [Listeria monocytogenes FSL N1-017]
 gi|307571289|emb|CAR84468.1| ribonuclease BN, putative [Listeria monocytogenes L99]
 gi|328466464|gb|EGF37607.1| transport protein [Listeria monocytogenes 1816]
 gi|332312148|gb|EGJ25243.1| Transporter [Listeria monocytogenes str. Scott A]
          Length = 289

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 66/263 (25%), Positives = 129/263 (49%), Gaps = 2/263 (0%)

Query: 18  HFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKP 77
                D    A+ ++   L S+FP ++  A L  +L   +   +V +++    P+ I   
Sbjct: 24  RVGRNDVSGNAAQLAYYMLFSIFPMLLIAATLLAYLHIDK--DSVFNMIKEFAPDQIMDF 81

Query: 78  ITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFG 137
           + + +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R++ + RL+S  
Sbjct: 82  LEENLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRNYVVQRLLSMF 141

Query: 138 YVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVH 197
           + L    T+     + V       ++        + L    N R   T++ +F+   F++
Sbjct: 142 FTLAMLATVGATLLLLVFGQQIGMFLINHLNFSEDFLSFWNNLRWTVTLIVIFVVFTFLY 201

Query: 198 LFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
              P  +S ++S+LPG +F+ I W V ++ F +Y+  F  YS  Y  +  I+  +++ Y+
Sbjct: 202 WVAPNRRSTLISVLPGALFSTIGWTVASLGFAYYVNNFGNYSATYGSIGVIIILMLWFYL 261

Query: 258 LGVFFILGAELNASMIIYYWRKK 280
            G+  ++G ELNA++ I   +K+
Sbjct: 262 TGIILMIGGELNATLAIRKKKKE 284


>gi|284046224|ref|YP_003396564.1| ribonuclease BN [Conexibacter woesei DSM 14684]
 gi|283950445|gb|ADB53189.1| ribonuclease BN [Conexibacter woesei DSM 14684]
          Length = 367

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 45/276 (16%), Positives = 103/276 (37%), Gaps = 4/276 (1%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVID 64
                 +  A + F E+     A+ ++  ++LS+FP ++    L G  G   + V +++D
Sbjct: 70  RGWLATLKRAAKGFREDGLQDWAAALTYYSVLSLFPLLIVFVALIGVFGEYPRTVNSMLD 129

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISAL--AAAYFSSNGVEALRISLNRAYRV 122
           +V    P   A  +   +  V+         +      A + +S  + A   + N  Y V
Sbjct: 130 IVRQIAPGSTADTLESSLSGVVRNKGGAGALLGIGLLTALWSASGYIGAFMRAANAVYDV 189

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E R ++  R +      +  V + +++  FV        +        + + +    + 
Sbjct: 190 EEGRPFWKLRPLQLAVTAVMVVLIALLAIGFVLSGSVAKSLGDTIGLGDSAVTVWNIAKW 249

Query: 183 YATMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
              +L   + +  +    P  K  +   I PG        ++ ++ F  Y     +Y+  
Sbjct: 250 PVMLLIAVVMIALLTYVGPNVKHPRFRWITPGAAVGIGILILASLGFAFYAANLGSYNAT 309

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           Y  L  ++  L++L++  +  + G EL+  +     
Sbjct: 310 YGALGGVIVFLIWLWIANLALLFGVELDVELERQRE 345


>gi|289435039|ref|YP_003464911.1| hypothetical protein lse_1674 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289171283|emb|CBH27825.1| conserved hypothetical protein [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
          Length = 289

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 68/273 (24%), Positives = 134/273 (49%), Gaps = 2/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +F +         + D    A+ ++   L S+FP ++  A L  ++   +   +V +++ 
Sbjct: 14  IFQVGQTVTGRVGQNDVSGNAAQLAYYMLFSIFPMMLIAATLLAYMHIDK--DSVFNMLK 71

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              PE I   + + +  +L     GL +I  +A  + +SNG+ A+  +LN+AY V   R+
Sbjct: 72  EFAPEQILDFLEENLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKALNKAYGVTNKRN 131

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           + + RL+S  + L    T+     + V       ++        + L    N R   T++
Sbjct: 132 YVVQRLLSMFFTLAMLATVGATLLLIVFGQQIGLFLINHLNFSEDFLSFWNNLRWTVTLI 191

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            +F+   F++   P  +S ++S+LPG IF+ I W V +V F +Y+  F+ YS  Y  +  
Sbjct: 192 VIFVVFTFLYWVAPNRRSTLISVLPGAIFSTIGWTVASVGFAYYVNNFANYSATYGSIGV 251

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  +++ Y+ G+  ++G ELNA++ I   +K+
Sbjct: 252 IIILMLWFYLTGIILMVGGELNATLAIRKKKKQ 284


>gi|330807955|ref|YP_004352417.1| ribonuclease, ribonuclease_BN-like family [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327376063|gb|AEA67413.1| putative ribonuclease, Ribonuclease_BN-like family [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 316

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 62/273 (22%), Positives = 123/273 (45%), Gaps = 1/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +  ++   +  F++++    AS ++   L S+FPFI+F   L GFL    F   +     
Sbjct: 11  LHRVMMRTVTEFLDDEMSTYASALAYQMLFSLFPFILFLIALIGFLHLPDFFSWLRLQSE 70

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P    + +   I Q+      GL ++  + A + +S GV  +  ++N AY VVE R 
Sbjct: 71  LVLPPQALEQVNPVIDQLQQSK-GGLLSVGIVIALWTASAGVRLMMSAMNAAYDVVEGRP 129

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            +    +S  Y +  +  L+  + + V  P  + ++         ++ +    R    + 
Sbjct: 130 AWKRFPLSIFYTIGIAGMLLAAAALMVLGPQVMGWIAAQVGLETFIVTLWTIVRWPVIVF 189

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            L + +  ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +
Sbjct: 190 LLMVAVALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLGFAFYVKTFADYNAMYGSIGA 249

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  L++ Y+     +LGAE+NA +       K
Sbjct: 250 IIVLLLYFYISSAVLLLGAEMNAVIEHMSTEGK 282


>gi|313623420|gb|EFR93635.1| transport protein [Listeria innocua FSL J1-023]
          Length = 289

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 67/263 (25%), Positives = 129/263 (49%), Gaps = 2/263 (0%)

Query: 18  HFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKP 77
                D    A+ ++   L S+FP ++  A L  +L   +   +V +++    P+ I   
Sbjct: 24  RVGRNDVSGNAAQLAYYMLFSIFPMLLIAATLLAYLHIDK--DSVFNMIKEFAPDQIMDF 81

Query: 78  ITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFG 137
           + + +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R++ + RL+S  
Sbjct: 82  LEENLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRNYVVQRLLSMF 141

Query: 138 YVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVH 197
           + L    T+     + V       ++        + L    N R   T++ +F+   F++
Sbjct: 142 FTLAMLATVGATLLLLVFGQQIGMFLINHLNFSEDFLSFWNNLRWTVTLIVIFVVFTFLY 201

Query: 198 LFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
              P  +S ++S+LPG +F+ I W V +V F +Y+  F  YS  Y  +  I+  +++ Y+
Sbjct: 202 WVAPNRRSTLISVLPGALFSTIGWTVASVGFAYYVNNFGNYSATYGSIGVIIILMLWFYL 261

Query: 258 LGVFFILGAELNASMIIYYWRKK 280
            G+  ++G ELNA++ I   +K+
Sbjct: 262 TGIILMIGGELNATLAIRKKKKE 284


>gi|16803746|ref|NP_465231.1| hypothetical protein lmo1706 [Listeria monocytogenes EGD-e]
 gi|224499572|ref|ZP_03667921.1| hypothetical protein LmonF1_07697 [Listeria monocytogenes Finland
           1988]
 gi|224503369|ref|ZP_03671676.1| hypothetical protein LmonFR_12785 [Listeria monocytogenes FSL
           R2-561]
 gi|255028332|ref|ZP_05300283.1| hypothetical protein LmonL_02181 [Listeria monocytogenes LO28]
 gi|16411160|emb|CAC99784.1| lmo1706 [Listeria monocytogenes EGD-e]
          Length = 289

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 67/273 (24%), Positives = 131/273 (47%), Gaps = 2/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +  +           D    A+ ++   L S+FP ++  A L  +L   +   +V +++ 
Sbjct: 14  IVQVGQAVSARVGRNDVSGNAAQLAYYMLFSIFPMLLIAATLLAYLHIDK--DSVFNMIK 71

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P+ I   + + +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R+
Sbjct: 72  EFAPDQIMDFLEENLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRN 131

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           + + RL+S  + L    T+     + V       ++        + L    N R   T++
Sbjct: 132 YVVQRLLSMFFTLAMLATVGATLLLLVFGQQIGMFLINHLNFSEDFLSFWNNLRWTVTLI 191

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            +F+   F++   P  +S ++S+LPG +F+ I W V +V F +Y+  F  YS  Y  +  
Sbjct: 192 VIFVVFTFLYWVAPNRRSTLISVLPGALFSTIGWTVASVGFAYYVNNFGNYSATYGSIGV 251

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  +++ Y+ G+  ++G ELNA++ I   +K+
Sbjct: 252 IIILMLWFYLTGIILMIGGELNATLAIRKKKKE 284


>gi|319650226|ref|ZP_08004372.1| hypothetical protein HMPREF1013_00977 [Bacillus sp. 2_A_57_CT2]
 gi|317398057|gb|EFV78749.1| hypothetical protein HMPREF1013_00977 [Bacillus sp. 2_A_57_CT2]
          Length = 300

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 54/268 (20%), Positives = 113/268 (42%), Gaps = 2/268 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
            V        + F ++    +A+  +   +LS+FP ++   ++  +L         +  +
Sbjct: 3   KVIQFGKKLGKEFKKDRATGLAAEQAYYYMLSIFPLLILLISIVPYLSLDP--QKALSYL 60

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               P      I D ++ ++  P  GL T   +   + +SNG++A   ++N A+ V E R
Sbjct: 61  QSVMPSDSFNVIEDNVVDIITKPNGGLLTFGIIGTLWSASNGMQAFIRAMNDAFDVEETR 120

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+  +RLIS G  L      +I   + V   + + +V  F      + ++I   R     
Sbjct: 121 SFIKSRLISIGLTLGLLAAFIIAMVLPVFGKVIMNFVENFINIPDGMQILINVLRWAIAF 180

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           + +   L  ++   P        +LPG I   + W + +   + Y+  F  YS  Y  L 
Sbjct: 181 VIMVTVLAILYKVAPNKHFPFKQVLPGAIAATVMWQLISFGLSFYVSNFGNYSATYGSLG 240

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMII 274
            ++  +++ ++ G+  ++G E++A    
Sbjct: 241 GVIVLMLWFFLTGLALVIGGEISALYHR 268


>gi|170748550|ref|YP_001754810.1| ribonuclease BN [Methylobacterium radiotolerans JCM 2831]
 gi|170655072|gb|ACB24127.1| ribonuclease BN [Methylobacterium radiotolerans JCM 2831]
          Length = 375

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 57/273 (20%), Positives = 125/273 (45%), Gaps = 9/273 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI       F ++   A+A+ ++   LLS+FP I    +  G       +   +  +   
Sbjct: 83  DIAVRVYLEFNKDRVLAVAAGVTFYTLLSLFPAIAALVSCYGLFADVTVINDHLAQLHAV 142

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTI---SALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P    + I D++ ++ A  +  L      S L + + ++  ++A+  +LN  Y   E R
Sbjct: 143 LPSGAVELIGDQVKRIAAKGSGSLSITFFSSLLLSIWSANAAMKAMFDALNVVYEEEEKR 202

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           +++   L S  + + A + +++   V V +P+ L ++      LG+   ++   R  A +
Sbjct: 203 NFFWLNLRSLTFTVGALLFIIVALNVIVVVPVVLNFL-----GLGSTAWLLAALRWPAIL 257

Query: 187 LALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           + L  GL  ++ F P+   ++   +  G +   + W+  ++LF+ Y+  F TY+  Y  L
Sbjct: 258 IVLLGGLSVLYRFGPSREHARWRWVGVGSVVAGLLWLAASLLFSWYVANFGTYNETYGSL 317

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            +++  + ++++     +LG E+NA +     R
Sbjct: 318 GAVIGFMTWIWISSTIVLLGGEINAELEHQTAR 350


>gi|258652199|ref|YP_003201355.1| ribonuclease BN [Nakamurella multipartita DSM 44233]
 gi|258555424|gb|ACV78366.1| ribonuclease BN [Nakamurella multipartita DSM 44233]
          Length = 371

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 54/269 (20%), Positives = 108/269 (40%), Gaps = 2/269 (0%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           I       F ++    +A+ ++  A+L++FP ++   +L G +G       +I V+    
Sbjct: 54  IARRTFREFSDDQCTDLAAALTYYAVLALFPALLALVSLLGLVGQQGQTDQLIGVLTDMG 113

Query: 71  PEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
              +A  +   + Q+    + GL   I    A + +S  V A   ++NR Y + E R +Y
Sbjct: 114 AGTVADTLRGPLQQLTENSSTGLALVIGVAGALWSASAYVGAFGRAMNRIYEIREGRPFY 173

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
             R +     L A +   +++   V        V          +      +    +   
Sbjct: 174 KLRPLMMVITLAAVILAGLVAIGLVVSGPVARAVGDALGLGETAVTAWGIAKWPVLLGLA 233

Query: 190 FIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
            + +  ++   P  K      I  G     ++WV+ + LF  Y+  F+ Y+  Y  LA +
Sbjct: 234 ALVVAILYYATPNVKQPTFRWISVGAGIAIVTWVIASALFGLYVSQFANYNKTYGSLAGV 293

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYW 277
           +  L++L++  +  + GAEL+A M     
Sbjct: 294 IVFLLWLWITNLALLFGAELDAEMERGRQ 322


>gi|90418703|ref|ZP_01226614.1| possible membrane protein, ribonuclease [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336783|gb|EAS50488.1| possible membrane protein, ribonuclease [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 396

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 52/275 (18%), Positives = 122/275 (44%), Gaps = 8/275 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
           +    DI       F ++    +A+  +   LL++FP      +L GF+     +   I 
Sbjct: 76  WKGWKDICLRIYASFFDDRVMLIAAGATFYLLLALFPAFAVFVSLYGFVADPVSIGEHIA 135

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYR 121
            +    P    + +  ++ ++++  +  L        L A + ++NG++ L  ++N AY 
Sbjct: 136 FIGQFLPTAGTELLESQLARLVSQDSSSLSLGFVSGLLFALWSANNGIKTLFEAMNVAYG 195

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             E RS++   L++F + L A         V +     +  V   F       ++I   R
Sbjct: 196 EREQRSFFKLNLVAFCFTLGAIFIG----IVLIVTVGVVPVVMAVFGLQSFSEIMIAAMR 251

Query: 182 IYATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                  + + +  ++ + P+ +  +   ++ G +   + W++ ++ F+ Y+  F+ Y+ 
Sbjct: 252 WPVVFGLIVVAIAMIYRYGPSRRRARWKWVVSGALLAAVVWLLASLGFSWYLQNFANYNA 311

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           MY  L +++  ++++++  + FI+GAE+NA M   
Sbjct: 312 MYGSLGAVIGFMMWVWISSLIFIIGAEINAEMEHQ 346


>gi|47097606|ref|ZP_00235132.1| ribonuclease BN, putative [Listeria monocytogenes str. 1/2a F6854]
 gi|254829230|ref|ZP_05233917.1| YihY family protein [Listeria monocytogenes FSL N3-165]
 gi|254832411|ref|ZP_05237066.1| hypothetical protein Lmon1_13734 [Listeria monocytogenes 10403S]
 gi|254900789|ref|ZP_05260713.1| hypothetical protein LmonJ_13274 [Listeria monocytogenes J0161]
 gi|254913725|ref|ZP_05263737.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254938112|ref|ZP_05269809.1| YihY family protein [Listeria monocytogenes F6900]
 gi|284802152|ref|YP_003414017.1| hypothetical protein LM5578_1907 [Listeria monocytogenes 08-5578]
 gi|284995294|ref|YP_003417062.1| hypothetical protein LM5923_1859 [Listeria monocytogenes 08-5923]
 gi|47014019|gb|EAL05026.1| ribonuclease BN, putative [Listeria monocytogenes str. 1/2a F6854]
 gi|258601641|gb|EEW14966.1| YihY family protein [Listeria monocytogenes FSL N3-165]
 gi|258610724|gb|EEW23332.1| YihY family protein [Listeria monocytogenes F6900]
 gi|284057714|gb|ADB68655.1| hypothetical protein LM5578_1907 [Listeria monocytogenes 08-5578]
 gi|284060761|gb|ADB71700.1| hypothetical protein LM5923_1859 [Listeria monocytogenes 08-5923]
 gi|293591740|gb|EFG00075.1| conserved hypothetical protein [Listeria monocytogenes J2818]
          Length = 289

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 66/273 (24%), Positives = 131/273 (47%), Gaps = 2/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +  +           D    A+ ++   L S+FP ++  A L  +L   +   +V +++ 
Sbjct: 14  IVQVGQAVSARVGRNDVSGNAAQLAYYMLFSIFPMLLIAATLLAYLHIDK--DSVFNMIK 71

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P+ I   + + +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R+
Sbjct: 72  EFAPDQIMDFLEENLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRN 131

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           + + RL+S  + L    T+     + V       ++        + L    N R   T++
Sbjct: 132 YVVQRLLSMFFTLAMLATVGATLLLLVFGQQIGMFLINHLNFSEDFLSFWNNLRWTVTLI 191

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            +F+   F++   P  +S ++S+LPG +F+ I W V ++ F +Y+  F  YS  Y  +  
Sbjct: 192 VIFVVFTFLYWVAPNRRSTLISVLPGALFSTIGWTVASLGFAYYVNNFGNYSATYGSIGV 251

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  +++ Y+ G+  ++G ELNA++ I   +K+
Sbjct: 252 IIILMLWFYLTGIILMIGGELNATLAIRKKKKE 284


>gi|257455356|ref|ZP_05620591.1| tRNA-processing RNAse BN [Enhydrobacter aerosaccus SK60]
 gi|257447318|gb|EEV22326.1| tRNA-processing RNAse BN [Enhydrobacter aerosaccus SK60]
          Length = 673

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 37/278 (13%), Positives = 111/278 (39%), Gaps = 7/278 (2%)

Query: 4   YFCIVF-DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPT 61
            F   +   +   I++F++++    A+ ++ + LLS+ P +     +   +    +    
Sbjct: 13  IFKHKWVQFLMYLIKNFIDDNCSQKAALLTYTTLLSIVPILTLLVVILSTIPQLAEAREQ 72

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           + +++F          +T  + Q  +  +  L  I      + + + +  +  + N+ +R
Sbjct: 73  IQNLIFSNILPSTGLQVTKYLNQFTSNSSN-LTIIGVGILFFTTISTLMTIETAFNQIWR 131

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V +  + ++  +  +  + L  + L I+  +   +       +K      +  + +  G 
Sbjct: 132 VEKKETSWLNLVRYWVIITLLPIVLAIVMIISSTVQSLSFLNQKIGGYGIDWAIWVQIGS 191

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
           I   ++ L     F+    P  + +    L   +   I + +  + F   +  F++Y  +
Sbjct: 192 IAIVLMGLVTMYWFI----PRCQVRFKHALVAGVVVGIIFEILKLTFGAIVDNFTSYKAV 247

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           Y   A +   L+++Y+     +LG +++  + I+  ++
Sbjct: 248 YGAFAILPLFLLWIYISWNIILLGVQISYCLTIFETKE 285


>gi|315282669|ref|ZP_07871025.1| transport protein [Listeria marthii FSL S4-120]
 gi|313613685|gb|EFR87473.1| transport protein [Listeria marthii FSL S4-120]
          Length = 289

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 68/273 (24%), Positives = 131/273 (47%), Gaps = 2/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +  +           D    A+ ++   L S+FP ++  A L  +L   +   +V +++ 
Sbjct: 14  IVQVGQAVSARVGRNDVSGNAAQLAYYMLFSIFPMLLIAATLLAYLHIDK--DSVFNMIK 71

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P+ I   + D +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R+
Sbjct: 72  EFAPDQIMDFLEDNLNTLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRN 131

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           + + RL+S  + L    T+     + V       ++        + L    N R   T++
Sbjct: 132 YVVQRLLSMFFTLAMLATVGATLLLLVFGQQIGMFLINHLNFSEDFLSFWNNLRWTVTLV 191

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            +F+   F++   P  +S ++S+LPG +F+ I W V +V F +Y+  F  YS  Y  +  
Sbjct: 192 VIFVVFTFLYWVAPNRRSTLISVLPGALFSTIGWTVASVGFAYYVNNFGNYSATYGSIGV 251

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  +++ Y+ G+  ++G ELNA++ I   +K+
Sbjct: 252 IIILMLWFYLTGIILMIGGELNATLAIRKKKKE 284


>gi|290893364|ref|ZP_06556349.1| YihY family protein [Listeria monocytogenes FSL J2-071]
 gi|290557015|gb|EFD90544.1| YihY family protein [Listeria monocytogenes FSL J2-071]
          Length = 308

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 66/263 (25%), Positives = 129/263 (49%), Gaps = 2/263 (0%)

Query: 18  HFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKP 77
                D    A+ ++   L S+FP ++  A L  +L   +   +V +++    P+ I   
Sbjct: 24  RVGRNDVSGNAAQLAYYMLFSIFPMLLIAATLLAYLHIDK--DSVFNMIKEFAPDQIMDF 81

Query: 78  ITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFG 137
           + + +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R++ + RL+S  
Sbjct: 82  LEENLNNLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRNYVVQRLLSMF 141

Query: 138 YVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVH 197
           + L    T+     + V       ++        + L    N R   T++ +F+   F++
Sbjct: 142 FTLAMLATVGATLLLLVFGQQIGMFLINHLNFSEDFLSFWNNLRWTVTLIVIFVVFTFLY 201

Query: 198 LFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
              P  +S ++S+LPG +F+ I W V ++ F +Y+  F  YS  Y  +  I+  +++ Y+
Sbjct: 202 WVAPNRRSTLISVLPGALFSTIGWTVASLGFAYYVNNFGNYSATYGSIGVIIILMLWFYL 261

Query: 258 LGVFFILGAELNASMIIYYWRKK 280
            G+  ++G ELNA++ I   +K+
Sbjct: 262 TGIILMIGGELNATLAIRKKKKE 284


>gi|92119332|ref|YP_579061.1| ribonuclease BN, putative [Nitrobacter hamburgensis X14]
 gi|91802226|gb|ABE64601.1| ribonuclease BN, putative [Nitrobacter hamburgensis X14]
          Length = 386

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 53/272 (19%), Positives = 111/272 (40%), Gaps = 8/272 (2%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
               DI+     +  E   +A+A+ ++  +L ++FP +     + G       +    D 
Sbjct: 78  RRWKDILLRVYANVSEHRIFALAAGMTYYSLFAIFPALAAMVAVYGLFSDPATIAKHFDQ 137

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYRV 122
           V G  P        +++ +V +   + L     I    + + ++  +++L  +LN  Y  
Sbjct: 138 VSGFVPSGAIDVAREQLTRVASKGNQTLGLTFAIGLAVSLWSANAAMKSLFDTLNIVYGE 197

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E R +     +S  + +   V ++      V +P+ L YV           L++   R 
Sbjct: 198 KETRGFVKLNAMSLAFTMTGIVFVLAALGAVVVVPVILNYV----GLSNFADLLVRTARW 253

Query: 183 YATMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
            A  + + + L  ++ F P  +  +   I  G     I W+  + LF+ Y   F  ++  
Sbjct: 254 PAMFVGVALALALIYRFGPDREAPRWRWITWGSAVATILWLAASTLFSWYAANFGKFNET 313

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
           Y  L + +  + +L++  +  +LGAEL+A M 
Sbjct: 314 YGSLGAAIGFMTWLWISAIVILLGAELDAQME 345


>gi|289550401|ref|YP_003471305.1| Ribonuclease BN [Staphylococcus lugdunensis HKU09-01]
 gi|289179933|gb|ADC87178.1| Ribonuclease BN [Staphylococcus lugdunensis HKU09-01]
          Length = 409

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 61/270 (22%), Positives = 121/270 (44%), Gaps = 2/270 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + I   I    ++D   +A+ ++   +L++FP ++F   L            V D+V   
Sbjct: 69  NFISYLIYRIGKDDASGLAAQMTYHFVLALFPMLIFLLTLLPLFQIDP--QQVKDMVSQN 126

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   A  ++     +    +  + ++  +   + +SNG+ A+  S N AY V + R+  
Sbjct: 127 APAETASVVSKIFNDITKNASGSILSVGLILTIWSASNGMTAIMNSFNVAYDVEDGRNPI 186

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  + L +   +         ++         +  I    R+    + +
Sbjct: 187 VLKLLSVVFTVVMGLVLAVALTLPTFGTFIKDHLFGAIGLDKQVAWIFDLIRVILPFIII 246

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            +  I ++   P  K+KI S+ PG +FT I W++G+  F  Y+  F  YS  Y  LA I+
Sbjct: 247 LLLFITLYSVAPNVKTKIKSVFPGALFTSIIWLLGSFGFGWYLSNFGNYSKTYGSLAGII 306

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +   +  K
Sbjct: 307 ILLLWLYITCFIIIIGAEINAIIHQRHVIK 336


>gi|16800885|ref|NP_471153.1| hypothetical protein lin1818 [Listeria innocua Clip11262]
 gi|16414320|emb|CAC97049.1| lin1818 [Listeria innocua Clip11262]
 gi|313618455|gb|EFR90462.1| transport protein [Listeria innocua FSL S4-378]
          Length = 289

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 66/263 (25%), Positives = 129/263 (49%), Gaps = 2/263 (0%)

Query: 18  HFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKP 77
                D    A+ ++   L S+FP ++  A L  +L   +   +V +++    P+ I   
Sbjct: 24  RVGRNDVSGNAAQLAYYMLFSIFPMLLIAATLLAYLHIDK--DSVFNMIKEFAPDQIMDF 81

Query: 78  ITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFG 137
           + + +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R++ + RL+S  
Sbjct: 82  LEENLNTLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRNYVVQRLLSMF 141

Query: 138 YVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVH 197
           + L    T+     + V       ++        + L    N R   T++ +F+   F++
Sbjct: 142 FTLAMLATVGATLLLLVFGQQIGMFLINHLNFSEDFLSFWNNLRWTVTLVVIFVVFTFLY 201

Query: 198 LFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
              P  +S ++S+LPG +F+ I W + +V F +Y+  F  YS  Y  +  I+  +++ Y+
Sbjct: 202 WVAPNRRSTLISVLPGALFSTIGWTIASVGFAYYVNNFGNYSATYGSIGVIIILMLWFYL 261

Query: 258 LGVFFILGAELNASMIIYYWRKK 280
            G+  ++G ELNA++ I   +K+
Sbjct: 262 TGIILMIGGELNATLAIRKKKKE 284


>gi|315660133|ref|ZP_07912990.1| YihY family protein [Staphylococcus lugdunensis M23590]
 gi|315494814|gb|EFU83152.1| YihY family protein [Staphylococcus lugdunensis M23590]
          Length = 409

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 61/270 (22%), Positives = 121/270 (44%), Gaps = 2/270 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + I   I    ++D   +A+ ++   +L++FP ++F   L            V D+V   
Sbjct: 69  NFISYLIYRIGKDDASGLAAQMTYHFVLALFPMLIFLLTLLPLFQIDP--QQVKDMVSQN 126

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   A  ++     +    +  + ++  +   + +SNG+ A+  S N AY V + R+  
Sbjct: 127 APAETASVVSKIFNDITKNASGSILSVGLILTIWSASNGMTAIMNSFNVAYDVEDGRNPI 186

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  + L +   +         ++         +  I    R+    + +
Sbjct: 187 VLKLLSVVFTVVMGLVLAVALTLPTFGTFIKDHLFGAIGLDKQVAWIFDLIRVILPFIII 246

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            +  I ++   P  K+KI S+ PG +FT I W++G+  F  Y+  F  YS  Y  LA I+
Sbjct: 247 LLLFITLYSVAPNVKTKIKSVFPGALFTSIIWLLGSFGFGWYLSNFGNYSKTYGSLAGII 306

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +   +  K
Sbjct: 307 ILLLWLYITCFIIIIGAEINAIIHQRHVIK 336


>gi|290958769|ref|YP_003489951.1| ribonuclease [Streptomyces scabiei 87.22]
 gi|260648295|emb|CBG71406.1| putative ribonuclease [Streptomyces scabiei 87.22]
          Length = 356

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 51/274 (18%), Positives = 112/274 (40%), Gaps = 4/274 (1%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
                ++   ++ F +++    A+ ++   +L++FP ++   +L G +G       V+D 
Sbjct: 46  RSWRSVLKGTLKEFKKDELTDRAAALTYYGILALFPALLALVSLLGIVG-ESATREVLDN 104

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVV 123
           +    P      +T+ + Q+      G  +  +  + A + +S  V A   S N  Y + 
Sbjct: 105 IQKLAPGAARDVLTNAVQQMQNNAGLGSVMAIVGLVLAVWSASGYVAAFIRSANAVYDIP 164

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R  +    +  G  ++  V  VI + + V        V          L +    +  
Sbjct: 165 EGRPVWKVLPVRVGLTMVLMVMAVISALIVVFTGGLAREVGTALGVGDTALTVWSIAKWP 224

Query: 184 ATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
             +L + + +  ++   P AK +    I PG +   + W+  +  F  Y+  F +Y+  Y
Sbjct: 225 VLILLVTMMIAVLYWATPNAKVRGFRWITPGSLLALLIWMAASAGFAFYVANFGSYNKTY 284

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             +A ++  LV+L++  +  +LG E +A +    
Sbjct: 285 GAVAGVIIFLVWLWITNLAILLGLEFDAELARRR 318


>gi|188579427|ref|YP_001922872.1| ribonuclease BN [Methylobacterium populi BJ001]
 gi|179342925|gb|ACB78337.1| ribonuclease BN [Methylobacterium populi BJ001]
          Length = 367

 Score =  165 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 58/273 (21%), Positives = 120/273 (43%), Gaps = 9/273 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI     + F  +    +A+ ++  A+L++FP +    ++ G +     + T ++ + G 
Sbjct: 75  DIALRLYQEFGNDRILLVAAGVTFYAILALFPAVAALVSIYGAVADPSTISTHLNELRGI 134

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTI---SALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P+     +  ++ +++      L      S L + + ++ G++A+  +LN AY   E R
Sbjct: 135 LPDGAIDIVGGQVKRLVDKGDAALGLTALVSILLSLWSANGGMKAIFDALNIAYEEEEKR 194

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+ +  L S  +   A + +V+     V +P AL  +      L      I   R  A +
Sbjct: 195 SFVMLNLQSLAFTAGALLFVVLALTGIVVVPAALQVL-----GLDQKAWYIALLRFPALL 249

Query: 187 LALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
             +   L  ++ + P+ +  K   +  G       W+V + LF+ Y+  F +Y+  Y  L
Sbjct: 250 ALVIGTLAVLYRYGPSRRKPKWRWVTWGSAVAGTLWLVASGLFSWYVANFGSYNETYGSL 309

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            + +  + ++++     +LGAELNA M     R
Sbjct: 310 GAAIGFMTWIWISTTVVLLGAELNAEMEHQTAR 342


>gi|146339131|ref|YP_001204179.1| putative ribonuclease [Bradyrhizobium sp. ORS278]
 gi|146191937|emb|CAL75942.1| conserved hypothetical protein; putative membrane protein; putative
           ribonuclease [Bradyrhizobium sp. ORS278]
          Length = 353

 Score =  165 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 55/273 (20%), Positives = 119/273 (43%), Gaps = 8/273 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D++Y   E+  +    A+A+ ++   LL++FP +     + G       +   ++ + G 
Sbjct: 60  DVLYRVYENVGDHRIVALAAGMTFYTLLAIFPALAAMVAIYGLFSDPAKITGHLEQLQGL 119

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLNRAYRVVEMR 126
            P        D++ +V A  ++ L     +    + + ++  +++L  +LN  YR  E R
Sbjct: 120 MPGGAIDIARDQLTRVSAKGSQALGVTFLVSLAISLWSANAAMKSLFDTLNVVYREPERR 179

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            +     IS  +   A +  ++     V +P+ L YV           L++  GR  A  
Sbjct: 180 GFIKLNAISLLFTGGAILFALLAIAAIVVVPVILQYV----GLSDAADLLLRIGRWPAIF 235

Query: 187 LALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           + + +GL  ++ + P   + K   I  G       W+ G+ LF+ Y   F +++  Y  L
Sbjct: 236 ICVSLGLALIYRYGPDREEPKWRWISWGSALAAALWLGGSALFSWYAANFGSFNATYGSL 295

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            + +  + ++++  +  ++GAEL+A +     R
Sbjct: 296 GAAVGFMTWIWISAIVILIGAELDAELEHQTLR 328


>gi|307318689|ref|ZP_07598122.1| ribonuclease BN [Sinorhizobium meliloti AK83]
 gi|306895716|gb|EFN26469.1| ribonuclease BN [Sinorhizobium meliloti AK83]
          Length = 328

 Score =  165 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 57/277 (20%), Positives = 124/277 (44%), Gaps = 10/277 (3%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
             + D+ +  +    E+    +A+ ++   LLSVFP +    ++ G +     +     +
Sbjct: 32  RGLRDVFWRVVSQISEDRISLIAAGVTFYVLLSVFPALASLVSIYGLVSDPATIAEQATL 91

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRV 122
           +    P    + +TD++  + +     L        L A + + NGV AL  ++N AY  
Sbjct: 92  LAAVLPAQSLQMMTDQLETLSSQKTSSLSFGFIAGLLFALWSARNGVGALFEAMNIAYDE 151

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E RS+    L+S G+ L   +   ++      +P  LA++            ++   R 
Sbjct: 152 TEKRSFIRLTLLSIGFTLAGLILTAVLIAAIAVLPAVLAFLHLELEG------LLRFVRW 205

Query: 183 YATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
              +L +  G+  ++ + P+ +  K+  +  G   + I W+  ++ F++YI  F+ Y+  
Sbjct: 206 PVMLLLIAAGITLIYRYGPSREPAKLRWLTWGAALSTICWLGASLAFSYYIDNFANYNAT 265

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           Y  L +++  ++++++  +  I+GAELNA +     R
Sbjct: 266 YGALGALIGFMLWIWISTMIVIIGAELNAELEHQTAR 302


>gi|302532125|ref|ZP_07284467.1| ribonuclease BN family membrane protein [Streptomyces sp. C]
 gi|302441020|gb|EFL12836.1| ribonuclease BN family membrane protein [Streptomyces sp. C]
          Length = 343

 Score =  165 bits (417), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 46/274 (16%), Positives = 106/274 (38%), Gaps = 4/274 (1%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
                ++   ++ F +++    A+ ++   +L++FP  +        +        V+D 
Sbjct: 40  RSWKAVLRGTLKEFKDDELADRAAALTYYGVLALFPA-LLVLVSLLGVVGESTTKQVLDN 98

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVV 123
           +    P      I++ + Q+      G  L  +  L A + +S  V A   + N  Y + 
Sbjct: 99  LQKLTPGAARDVISNAVQQLQGNAGVGSLLAIVGLLVAIWSASGYVAAFIRASNAVYDMP 158

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R  +    +  G  ++  V  V  + + V                   + +    +  
Sbjct: 159 EGRPVWKVLPLRVGLTVVLMVLAVASALIVVFTGGLARQAGSALGVGDTAMTVWSIAKWP 218

Query: 184 ATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
             ++ +   +  ++   P AK +    + PG +   + W+V +  F  Y+  F +Y+  Y
Sbjct: 219 VLLVLVTGMIALLYWAAPNAKGRGFRWVTPGSLLALVIWMVASAGFAFYVANFGSYNKTY 278

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             LA ++  LV+L++  +  +LG E +A ++   
Sbjct: 279 GTLAGVIIFLVWLWITNLAVLLGLEFDAELVRQR 312


>gi|294499057|ref|YP_003562757.1| putative Ribonuclease BN [Bacillus megaterium QM B1551]
 gi|294348994|gb|ADE69323.1| putative Ribonuclease BN [Bacillus megaterium QM B1551]
          Length = 282

 Score =  165 bits (417), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 57/276 (20%), Positives = 120/276 (43%), Gaps = 2/276 (0%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
             +        +   E+    +A+  +   +LS+FP ++   ++  +L         ID+
Sbjct: 2   KKLLSFGKSLGKEIQEDQATGLAAEQAYYYMLSLFPMLILLISIVPYLSIKP--EEAIDL 59

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           +    P   A    D + Q ++ P  GL T+  L   + +SNG+ A   ++N+AY V E 
Sbjct: 60  LQSVMPGETAAIFKDNVAQFVSQPNGGLLTVGILGTIWSASNGMNAFIRAMNQAYDVKEQ 119

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           RS+   R +S    +   VT+V+   + V   + L ++ ++F       +++   R    
Sbjct: 120 RSFIKVRGLSILLTIGLIVTIVVSLLLPVFGGVLLNWISEWFSLPSGTTVVLNILRWIVG 179

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +  + + L  ++   P        + PG +   + W + ++ F+ Y+  F  YS  Y  L
Sbjct: 180 VGIMVLVLSVLYRLAPNKTFPFAHVWPGALAATLLWQLTSLGFSFYVSNFGNYSATYGSL 239

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
             ++  +++L++ G+  ++G E+NA          P
Sbjct: 240 GGVIVLMLWLFLTGLILVIGGEINAIYHRNKTAAPP 275


>gi|307303461|ref|ZP_07583215.1| ribonuclease BN [Sinorhizobium meliloti BL225C]
 gi|306902852|gb|EFN33444.1| ribonuclease BN [Sinorhizobium meliloti BL225C]
          Length = 328

 Score =  165 bits (417), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 58/277 (20%), Positives = 125/277 (45%), Gaps = 10/277 (3%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
             + D+ +  +    E+    +A+ ++   LLSVFP +    ++ G +     +     +
Sbjct: 32  RGLRDVFWRVVSQISEDRISLIAAGVTFYVLLSVFPALASLVSIYGLVSDPATIAEQATL 91

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRV 122
           +    P    + +TD++  + +     L        L A + + NGV AL  ++N AY  
Sbjct: 92  LAAVLPAQSLQMMTDQLETLSSQKTSSLSFGFIAGLLFALWSARNGVGALFEAMNIAYDE 151

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E RS+    L+S G+ L   +   ++      +P  LA++            ++   R 
Sbjct: 152 TEKRSFIRLTLLSIGFTLAGLILTAVLIAAIAVLPAVLAFLHLELEG------LLRFVRW 205

Query: 183 YATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
              +L +  G+  ++ + P+ +  K+  +  G   + I W+V ++ F++YI  F+ Y+  
Sbjct: 206 PVMLLLIAAGITLIYRYGPSREPAKLSWLTWGAALSTICWLVASLAFSYYIDNFANYNAT 265

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           Y  L +++  ++++++  +  I+GAELNA +     R
Sbjct: 266 YGALGALIGFMLWIWISTMIVIIGAELNAELEHQTAR 302


>gi|153005865|ref|YP_001380190.1| putative ribonuclease BN [Anaeromyxobacter sp. Fw109-5]
 gi|152029438|gb|ABS27206.1| putative ribonuclease BN [Anaeromyxobacter sp. Fw109-5]
          Length = 359

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 65/264 (24%), Positives = 121/264 (45%), Gaps = 6/264 (2%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAK 76
           E   ++    +A+ ++   +LS+FPF++F   LA  +        +++ +    P  + +
Sbjct: 12  EELSKDQVTDIAATVTYYGVLSLFPFVLFLVALASVVIEPSDAERMVEELGQVAPGAVTQ 71

Query: 77  PITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISF 136
            I D I Q+ A     L    A+AA + +S GV A+  +LN AY V E R ++  R I+ 
Sbjct: 72  IIGDRIRQLGAEQNVSLLGFGAVAALWAASGGVTAVMRALNTAYDVKEGRPFWKVRGIAI 131

Query: 137 GYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFV 196
              LLA    +I + V +A       +             I   R+    L + +    V
Sbjct: 132 LMTLLAGALGLIAALVAIAAAPLAEAIGGPLG------TAITWLRLPVAGLVMMLLWALV 185

Query: 197 HLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLY 256
           +  LP  + +   I PG +F  + WV+ +  F+ Y+ +F +Y   Y  LA ++  L++++
Sbjct: 186 YYVLPDVEQRFRFITPGSVFGVLVWVLASWGFSRYVTSFGSYDKTYGSLAGVIVLLLWMW 245

Query: 257 MLGVFFILGAELNASMIIYYWRKK 280
           +  +  ++GAE+NA +       K
Sbjct: 246 ITSLVLLVGAEVNAFIEHRSVEGK 269


>gi|148652442|ref|YP_001279535.1| putative ribonuclease BN [Psychrobacter sp. PRwf-1]
 gi|288559241|sp|A5WD44|Y630_PSYWF RecName: Full=UPF0761 membrane protein PsycPRwf_0630
 gi|148571526|gb|ABQ93585.1| putative ribonuclease BN [Psychrobacter sp. PRwf-1]
          Length = 538

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 43/269 (15%), Positives = 110/269 (40%), Gaps = 6/269 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVV 66
            F+ +   I +F+++DG   A+ ++ + LLS+ P +     +   + A       + +++
Sbjct: 15  WFNFLRFLIGNFIKDDGQQKAASLTYTTLLSIVPILTVLLMILSSVPALESVREQISNII 74

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
           +          +++ I    A  +  L  I ALA    +   +  +  + N+ +RV +  
Sbjct: 75  YSNLLPQSGLQVSEYINNF-AEKSSNLTAIGALALFVTTIMTLTTIERAFNQIWRVEDRS 133

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
               + +  +  + L  + L     V  A+       ++      +    +       + 
Sbjct: 134 GGIKSIVRYWTIITLGPLVLGTAFLVSSAVQSLSFLNQQVAGYGIDWGFWVQ----VVSF 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
                G I ++ F+P AK  + +     +F  +++ +    F   +  F++Y  +Y   A
Sbjct: 190 AVTIAGFIGMYWFIPKAKVPLKNAAIAGVFVAVTFELLKYSFGIIMSNFTSYEAIYGAFA 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIY 275
           ++   L+++Y+     +LG E++ ++ I+
Sbjct: 250 ALPIFLLWIYLSWNLILLGVEISYTLTIF 278


>gi|54023610|ref|YP_117852.1| putative ribonuclease [Nocardia farcinica IFM 10152]
 gi|54015118|dbj|BAD56488.1| putative ribonuclease [Nocardia farcinica IFM 10152]
          Length = 326

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 49/282 (17%), Positives = 110/282 (39%), Gaps = 4/282 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R  +   + ++   +  F  ++    A+ ++  ++LSVFP I+    L G L +      
Sbjct: 21  RLNWRSWWGVLRRTVTEFRADNVTDWAAALTYYSVLSVFPGIIVLTALLGAL-SPTATDE 79

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPA--KGLFTISALAAAYFSSNGVEALRISLNRA 119
           ++  +    P    + + D I ++    +    +       A + +S  + A   + N  
Sbjct: 80  LVTSIREIGPGSGTQLLVDAIEELRGASSLAGPMALFGVATALWTASGYIGAFMRAANAI 139

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           Y V E R  + T  +  G      V + + +   VA       V  +       + +   
Sbjct: 140 YEVEEGRPLWKTVPVRVGLTAAMVVLIAVTAVGVVATGGIARRVGDWLGLGPTAVAVWEV 199

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTY 238
            +     + + +    ++   P A+      + PG +   + WV+ +  F  Y+  F +Y
Sbjct: 200 AKWPVLAVLVSLAFALLYWVAPNARQPGFRWLSPGSVLAVLVWVLASAGFAFYVANFGSY 259

Query: 239 STMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           + +Y  L  +   LV++++  V  +LGAE +A +      ++
Sbjct: 260 NKVYGSLGGVAVFLVWVWISNVAVLLGAEFDAELARGRRIEQ 301


>gi|116873142|ref|YP_849923.1| hypothetical protein lwe1726 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|116742020|emb|CAK21144.1| conserved hypothetical protein [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 289

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 66/273 (24%), Positives = 131/273 (47%), Gaps = 2/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +  +           D    A+ ++   L S+FP ++  A L  +L   +   +V +++ 
Sbjct: 14  IVQVGQAVSARVGRNDVSGNAAQLAYYMLFSIFPMLLIAATLLAYLHIDK--DSVFNMIK 71

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P+ I   + + +  +L     GL +I  +A  + +SNG+ A+  SLN+AY V   R+
Sbjct: 72  EFAPDQIMDFLEENLNTLLTQKNGGLLSIGIIATLWSASNGMNAVMKSLNKAYGVTNKRN 131

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           + + RL+S  + +    T+     + V       ++        + L    N R   T++
Sbjct: 132 YVVQRLLSMFFTMSMLATVGATLLLLVFGQQIGMFLINHLHFSEDFLSFWNNLRWTVTLI 191

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            +F+   F++   P  +S ++S+LPG +F+ I W V +V F +Y+  F  YS  Y  +  
Sbjct: 192 VIFVVFTFLYWVAPNRRSTLISVLPGALFSTIGWTVASVGFAYYVNNFGNYSATYGSIGV 251

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  +++ Y+ G+  ++G ELNA++ I   +K+
Sbjct: 252 IIILMLWFYLTGIILMIGGELNATLAIRKKKKE 284


>gi|295704377|ref|YP_003597452.1| putative ribonuclease BN [Bacillus megaterium DSM 319]
 gi|294802036|gb|ADF39102.1| putative Ribonuclease BN [Bacillus megaterium DSM 319]
          Length = 282

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 59/276 (21%), Positives = 121/276 (43%), Gaps = 2/276 (0%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
             +        +   E+    +A+  +   +LS+FP ++   ++  +L         IDV
Sbjct: 2   KKLLSFGKSLGKEIQEDQATGLAAEQAYYYMLSLFPMLILLISIVPYLSIKP--EEAIDV 59

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           +    P   A    D ++Q ++ P  GL T+  L   + +SNG+ A   ++N+AY V E 
Sbjct: 60  LQSVMPGETAAIFKDNVVQFVSQPNGGLLTVGILGTIWSASNGMNAFIRAMNQAYDVKEQ 119

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           RS+   R +S    +   VT+V+   + V   + L ++ ++F       +I+   R    
Sbjct: 120 RSFIKVRGLSILLTIGLIVTIVVSLLLPVFGGVLLNWISEWFSLPSGTTVILNVLRWIIG 179

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +  + + L  ++   P        + PG +   + W + ++ F+ Y+  F  YS  Y  L
Sbjct: 180 VGIMVLVLSVLYRLAPNKTFPFAHVWPGALAATLLWQLTSLGFSFYVSNFGNYSATYGSL 239

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
             ++  +++L++ G+  ++G E+NA          P
Sbjct: 240 GGVIVLMLWLFLTGLILVIGGEINAIYHRNKTAAPP 275


>gi|283457804|ref|YP_003362396.1| hypothetical protein RMDY18_07440 [Rothia mucilaginosa DY-18]
 gi|283133811|dbj|BAI64576.1| predicted membrane protein [Rothia mucilaginosa DY-18]
          Length = 455

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 59/276 (21%), Positives = 116/276 (42%), Gaps = 6/276 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVV 66
           +  I+  AI  F    G  MA+ ++   +LS+FP ++   +L G  G   +    ++  +
Sbjct: 49  ILYILRRAIYKFGANGGTDMAAALTYFTVLSIFPALLAIVSLLGVFGHGEESAAVILAFL 108

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
               P  +   + D I Q+      GL      L+A + +S    +   +LN  Y V E 
Sbjct: 109 KDNAPAQMYAILEDPIKQITGDHGAGLVLLTGILSALWSASGYTGSFGRALNTVYNVREG 168

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGN---LLLIIWNGRI 182
           R  +I + ++     +  + +V+M  + +     L  V ++ P   +   + LI  NGR 
Sbjct: 169 RPGWILKPLNVFVTTVIIILVVLMMLMMLLGVTVLDMVGRYVPETVDMELIKLIWLNGRW 228

Query: 183 YATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
              +      +  ++   P  +  K   + PG         +GA  FT Y   FS Y+  
Sbjct: 229 VLILFMAIALITLLYAATPNVRRYKAWRLSPGAALALFGMGLGAFGFTLYANNFSKYNAT 288

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           Y  +  ++  L+F++++    + GA L+A +++   
Sbjct: 289 YGLIGGVIVMLLFIWIMNNMLLFGAHLDAEIMLMRQ 324


>gi|157963720|ref|YP_001503754.1| ribonuclease BN [Shewanella pealeana ATCC 700345]
 gi|189039573|sp|A8H9I2|Y3909_SHEPA RecName: Full=UPF0761 membrane protein Spea_3909
 gi|157848720|gb|ABV89219.1| putative ribonuclease BN [Shewanella pealeana ATCC 700345]
          Length = 340

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 49/275 (17%), Positives = 106/275 (38%), Gaps = 8/275 (2%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R +   ++      +  F E+     A H++   LLS+ P +    ++         +  
Sbjct: 11  RSFLLSIWAFFLHLLSRFKEDQVNIKAGHLAYVTLLSLVPIVAVMFSMLSAFPVFSGIRE 70

Query: 62  -VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            +   V+  +       +   I + +A  +KG  ++  +A    +   + A+  +LN  +
Sbjct: 71  KLEGFVYDNFLPAAGDTVQIYINEFVANASKG-TSVGIVALMVVALMLISAIDKALNSIW 129

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           R  E R   ++  + +  + L  V +         I     +          L  ++   
Sbjct: 130 RTKEKRQAAVSFSMYWMVLTLGPVLVGASLVATSYIVSLKLFSE------TELSGVVPIL 183

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                ML      + +++ +P  K K +  L G +   + + +G   F  Y+  F +Y  
Sbjct: 184 IERLPMLFSVAAFLLLYMVVPIKKVKFLHALLGALVAAMLFELGKKGFAFYVTQFPSYEA 243

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           +Y  LA+I    V++Y+  V  ++GAE+ A +  Y
Sbjct: 244 IYGALATIPILFVWVYVSWVIVLVGAEITAGLPEY 278


>gi|209964739|ref|YP_002297654.1| ribonuclease BN family protein [Rhodospirillum centenum SW]
 gi|209958205|gb|ACI98841.1| ribonuclease BN family protein [Rhodospirillum centenum SW]
          Length = 327

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 58/277 (20%), Positives = 119/277 (42%), Gaps = 8/277 (2%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
              + I+   +     ++ W +A+ ++   LL++FP +    +L G +   Q V   +  
Sbjct: 32  RGWWSILKRTLAESSRDNVWVVAAGVAFLTLLAIFPALTATFSLYGLVADPQQVEEQVAA 91

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRV 122
           +    P    + +  ++  +     + L     I    A + +S GV+AL  +LN  Y  
Sbjct: 92  LASVLPAQGREVLVGQLHALAGQSGEALGFGLVIGLGIALWSASGGVKALMSALNIVYEE 151

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E RS+      +    L   + L+ +  V +A P+ L ++       G   +++   R 
Sbjct: 152 EEKRSFLHFTGTALALTLGFILLLIFLIAVVIATPVVLGFL----GLGGTADVLVRLLRW 207

Query: 183 YATMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                 +   L  ++ + P+  +++   +  G     + W+VG++ F+ YI  F+ Y+  
Sbjct: 208 PLLACGIAGALAVLYRYGPSRARARWRWVSWGSAAATLLWIVGSIAFSLYITHFADYNAT 267

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           Y  L + +  L++LY+     +LGAEL+A M     R
Sbjct: 268 YGSLGAGIILLLWLYLGAYAVLLGAELDAEMEHQTAR 304


>gi|170745562|ref|YP_001767019.1| ribonuclease BN [Methylobacterium radiotolerans JCM 2831]
 gi|170659163|gb|ACB28217.1| ribonuclease BN [Methylobacterium radiotolerans JCM 2831]
          Length = 351

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 59/273 (21%), Positives = 123/273 (45%), Gaps = 8/273 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D+++  +  F  +   A A  ++  ALL+ FP +    ++         +   + ++ G 
Sbjct: 57  DVLFRVVYSFPRDRVLATAGGVAFFALLATFPALATIVSVYSLFADPHAISQHVSLLAGV 116

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISA---LAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P  +   ++D++++V       L T S    L A + +++GV AL  +LN  YR  E R
Sbjct: 117 LPSGVLDLLSDQLIRVAQQSTGALSTASLVSVLIAFWSANSGVSALFDALNVIYREREKR 176

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S       +F + L   +  +  + + V +P+AL  +            ++   R    +
Sbjct: 177 SLMRFYATTFLFTLSGILFALTATSLVVVLPIALNQL----GLGALTDALLRLVRWPGLL 232

Query: 187 LALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           + + +GL   + + P  + +K   +  G     +SWV  +V F+ Y+ +F +Y+ +Y  L
Sbjct: 233 ILVSLGLAVTYRYGPGRRDAKWRWVSWGGAAAAVSWVCASVSFSWYVASFDSYNRIYGSL 292

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            + +  + +++   V  +LGA+LNA +     R
Sbjct: 293 GAGIGFMTWIWFSVVIVLLGAKLNAEIERQTAR 325


>gi|91978756|ref|YP_571415.1| ribonuclease BN, putative [Rhodopseudomonas palustris BisB5]
 gi|91685212|gb|ABE41514.1| ribonuclease BN, putative [Rhodopseudomonas palustris BisB5]
          Length = 384

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 53/270 (19%), Positives = 115/270 (42%), Gaps = 8/270 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D++   +         A+A+ ++  +LL++FP I     + G       +    D + G 
Sbjct: 90  DMLLRVVRKMSAHRIMALAAGMTYYSLLAIFPAIAALVAVYGLFADPSTIARHSDQLAGF 149

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTI---SALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P        D++ +V +  A+ L          + + ++  +++L  +LN  Y   E R
Sbjct: 150 LPGGALDVAQDQLTRVASNGAQTLGLTFLIGLGISLWSANAAMKSLFDTLNVVYGEEEKR 209

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            +     IS G+ +   + ++      V IP+ L +V            ++  GR  A  
Sbjct: 210 GFVKLNAISLGFTIGGVLFVLAALGCIVMIPVILGFVGMSSFGDR----LLSAGRWPAMY 265

Query: 187 LALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           L L + L  ++ + P+ + +    I  G     + W+  + LF+ Y  +F  ++  Y  L
Sbjct: 266 LVLSVALAVIYRYGPSREATPWRWISWGSATAAMVWLAASTLFSWYAASFGQFNETYGSL 325

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            +++  + +L+M  +  +LGAE++A++   
Sbjct: 326 GAVVGFMTWLWMSAIVILLGAEIDAALEHQ 355


>gi|93005366|ref|YP_579803.1| ribonuclease BN, putative [Psychrobacter cryohalolentis K5]
 gi|92393044|gb|ABE74319.1| ribonuclease BN, putative [Psychrobacter cryohalolentis K5]
          Length = 525

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 45/274 (16%), Positives = 108/274 (39%), Gaps = 6/274 (2%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVIDV 65
             F  +     HF E++    A+ ++ + LLS+ P +     +   + A   V   + +V
Sbjct: 17  RWFQFLRFLTRHFFEDNCQQKAASLTYTTLLSIVPILTVLLMILSSVPALASVRAQIYEV 76

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           ++       +  ++  I    A  +  L  I A+   + +   +  +  + N+ +RV + 
Sbjct: 77  IYSNLLPQSSLQVSKYINNF-AEKSSNLTIIGAMFLLFTTIMTLTTIERAFNQIWRVEDR 135

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
                + L  +  V L  + L        A+       R+      +    +       +
Sbjct: 136 SGGMRSMLRYWTIVTLGPLVLGTAFIASSAVQSLSLLNRQIGGYGIDWSFWVQ----IVS 191

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +     G I ++ F+P A+    +     +F  I + +   LF   +  F++Y  +Y   
Sbjct: 192 IAVTIAGFISMYWFIPKARVPAKNAAIAGVFVAIVFELMKHLFGTVMANFTSYEAIYGAF 251

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           A++   L+++Y+     +LG E++ ++ I+  ++
Sbjct: 252 AALPIFLLWIYLSWNLILLGVEISYTLTIFETKE 285


>gi|239933081|ref|ZP_04690034.1| ribonuclease BN family membrane protein [Streptomyces ghanaensis
           ATCC 14672]
 gi|291441431|ref|ZP_06580821.1| membrane protein [Streptomyces ghanaensis ATCC 14672]
 gi|291344326|gb|EFE71282.1| membrane protein [Streptomyces ghanaensis ATCC 14672]
          Length = 359

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 47/268 (17%), Positives = 106/268 (39%), Gaps = 4/268 (1%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
           +  ++  F +++    A+ ++   +LS+FP  +        +        V++ +    P
Sbjct: 60  LKGSLREFKDDELTDRAAALTYYGVLSLFPA-LLVLVSLLGVVGKSATDNVLESLQQLAP 118

Query: 72  EVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
             +   IT  + Q+      G  +  +  + A + +S  V A   S N  Y + E R  +
Sbjct: 119 GAVRDIITRAVEQLEGSAGVGSIVAVVGLVLAVWSASGYVAAFIRSANAVYDMPEGRPIW 178

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
               +  G  ++  V  VI S + V                   + +    +    ++ +
Sbjct: 179 KVLPVRVGMTVVLMVLAVISSLIVVFTGGLARRAGDALGLGDTAVTVWSIAKWPVLVVLV 238

Query: 190 FIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
            I +  ++   P  K +    I PG +   + W++ +  F  Y+  F++Y+  Y  +A +
Sbjct: 239 TIMIALLYWAAPNTKIRGFRWITPGSLLALVIWLIASAGFAFYVANFASYNKTYGTMAGV 298

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYY 276
           +  LV+L++  +  +LG E +A +    
Sbjct: 299 IVFLVWLWITNLAILLGLEFDAEIARQR 326


>gi|302556884|ref|ZP_07309226.1| ribonuclease BN [Streptomyces griseoflavus Tu4000]
 gi|302474502|gb|EFL37595.1| ribonuclease BN [Streptomyces griseoflavus Tu4000]
          Length = 320

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 52/268 (19%), Positives = 107/268 (39%), Gaps = 4/268 (1%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
           +  ++  F +++    A+ ++   +LS+FP ++   ++ G  G       V++ +    P
Sbjct: 21  LKGSLREFKDDELTDRAAALTYYGVLSLFPALLALVSVLGLTGR-STTDKVLENLQDLAP 79

Query: 72  EVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
                 IT  + Q+      G  +  +  L A + +S  V A   S N  Y V E R  +
Sbjct: 80  GSARDIITQAVRQLQDNAGVGSLMAVVGLLLAVWSASGYVAAFIRSANAVYDVPEGRPVW 139

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
               + FG  +   V  V+ + + V                   L +    +    +L +
Sbjct: 140 KVLPVRFGVTVALLVLAVLSALIVVFTGGLARRAGDALGLGDTALTVWSIAKWPVLVLLV 199

Query: 190 FIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
            + +  ++   P AK +    I PG       W+V +  F  Y+  F +Y+  Y  +A +
Sbjct: 200 VVMIALLYWAAPNAKVRGFRWITPGSFLALAIWLVASAGFAFYVANFGSYNKTYGTMAGV 259

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYY 276
           +  L++L++  +  +LG E +A +    
Sbjct: 260 IVFLIWLWITNLAILLGLEFDAEIARQR 287


>gi|297563154|ref|YP_003682128.1| ribonuclease BN [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
 gi|296847602|gb|ADH69622.1| ribonuclease BN [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
          Length = 330

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 57/271 (21%), Positives = 113/271 (41%), Gaps = 3/271 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
            +  +   +  F E+    +A+ ++  A+LS+FP ++   +L G  G      T+ D + 
Sbjct: 30  WWASLRRTVGEFKEDALADLAAGLTYYAILSLFPALLVLVSLLGLAG-PSATQTLTDNIS 88

Query: 68  GAWPEVIAKPITDEILQVLAVP--AKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
              P   A+ +T  I  +      A     +S   A + +S  + A   + N  Y V E 
Sbjct: 89  ATMPADAARLVTTAIENLQGNQTAAGVFGLVSLAIALWSASGYIAAFMRASNVVYDVPEG 148

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R  + T  I  G  LL  V L +          A A+V +       ++ +    +    
Sbjct: 149 RPIWKTLPIRVGVTLLMVVLLSLTVVGVALTGSAAAWVGQLLGLGSTVVTVWNIAKWPVL 208

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +L +   +  ++   P A+     + PG +   + W++ +  F  Y+  F++Y   Y  +
Sbjct: 209 LLIVVFMIALLYWASPNARRGFRWVSPGSVLAVVLWLLASAAFAFYVANFASYGRTYGTM 268

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           A+++  LV+L++  +  +LG E NA +    
Sbjct: 269 ATVVVFLVWLWITNIAILLGEEFNAEIERGR 299


>gi|328880192|emb|CCA53431.1| Ribonuclease BN [Streptomyces venezuelae ATCC 10712]
          Length = 374

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 50/274 (18%), Positives = 103/274 (37%), Gaps = 4/274 (1%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
                I+  +   FV ++    A+ ++   LL++FP  +        +        V++ 
Sbjct: 50  RSWLAILRRSAREFVSDELTDRAAALTYYGLLALFPA-LLVLVSLLGVSGRSTTDKVLES 108

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             G  P      +   +  +   P  G  + T+  L A + +S  V A   S NR Y V 
Sbjct: 109 FGGITPGPAHDVLDQAVENLQGAPGTGAAMATVGVLLALWSASGYVGAFMRSANRVYGVP 168

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R  +    +  G   L  V     + + V                 + L +    +  
Sbjct: 169 EGRPLWKVLPVRLGLTALLVVMAAASALIVVLTGEVARRAGDLLGVGDSALTVWAIAKWP 228

Query: 184 ATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
             ++ + + L  ++   P  +S+    I PG     + W+  +  F  Y+  F+TY+ +Y
Sbjct: 229 VLVVLVTMMLALLYWASPNVESRGWRWITPGSALALLIWLAASAGFAVYVSEFATYNRVY 288

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             +  ++  L++L++  +  +LG E +A  +   
Sbjct: 289 GTMGGVVVFLIWLWISNLAVLLGLEFDAETLRQR 322


>gi|197116537|ref|YP_002136964.1| ribonuclease BN family protein [Geobacter bemidjiensis Bem]
 gi|197085897|gb|ACH37168.1| ribonuclease BN family protein [Geobacter bemidjiensis Bem]
          Length = 316

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 68/286 (23%), Positives = 131/286 (45%), Gaps = 5/286 (1%)

Query: 1   MREYFCI----VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH 56
           +R YF +      ++   A + F EED    A+ ++   L + FPF++F   L  +L   
Sbjct: 4   LRRYFKLGDTSYKELAKRAFKKFSEEDCPEHAAAMAYYFLFASFPFLLFLTTLIAYLPIP 63

Query: 57  QFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISL 116
             +  V+D      P      I D I  +     +GL ++  + A + SSN + ++  ++
Sbjct: 64  HLLDYVLDNASRVLPGETFTLIEDNIQALFTNKKQGLLSMGIVLALWASSNAIVSVMDAM 123

Query: 117 NRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLI 176
           N  Y V E R ++  RLI+ G V+  SV  ++     +       YV       G   + 
Sbjct: 124 NNLYDVKEGRPFWKVRLIAIGLVIGLSVLFLVAMAALMFGNQIGDYVAGLINFGGAFKVA 183

Query: 177 IWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFS 236
            +   +  T+  L + +  ++ F P  + + + I PG +    SW++ ++ F++YI  F 
Sbjct: 184 WFAALVPVTLFVLVLAVAVIYYFTPDVEHQWVWISPGAVIAIPSWILMSLAFSYYINNFG 243

Query: 237 TYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY-WRKKP 281
           +Y   Y  + +++  L++LY+ G+  + GA +N+ +       KKP
Sbjct: 244 SYDKTYGSIGAVIVLLLWLYLTGLIILAGAVVNSVIEHSSAEGKKP 289


>gi|302532213|ref|ZP_07284555.1| ribonuclease BN family membrane protein [Streptomyces sp. C]
 gi|302441108|gb|EFL12924.1| ribonuclease BN family membrane protein [Streptomyces sp. C]
          Length = 381

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 42/274 (15%), Positives = 103/274 (37%), Gaps = 4/274 (1%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
                ++   +  F +++    A+ ++   +L++FP  +        +        V+D 
Sbjct: 60  RSWKAVLRGTVREFGDDELADRAAALTYYGVLALFPG-LLVLVSLLGIAGDSVTRQVLDQ 118

Query: 66  VFGAWPEVIAKPITDEILQVLAVP--AKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
           +    P      I++ + ++ A    +  L  +  + A + +S  V A   + N  Y V 
Sbjct: 119 LQALTPGAARDVISEAVERLRADAGVSSFLAAVGPVVAVWSASGYVGAFIRAANAVYDVP 178

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R  +    +  G  +      V  + + V                   + +    +  
Sbjct: 179 EGRPVWRVLPLRLGLTVTLMGLAVASALIVVFTGGLARRAGAALGVGDTAMAVWSTVKWP 238

Query: 184 ATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
             ++ +   +  ++   P A+ +    + PG +   + W+  +  F  Y+  F++Y+  Y
Sbjct: 239 VLLVLVTAMIAILYWAAPNARGRGFRWVSPGSVLALVIWMTASGGFAFYVAHFASYNRTY 298

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             LA ++  LV+L++  +  +LG E +A +    
Sbjct: 299 GTLAGVIIFLVWLWITNLAVLLGLEFDAELSRQR 332


>gi|114704910|ref|ZP_01437818.1| hypothetical protein FP2506_08236 [Fulvimarina pelagi HTCC2506]
 gi|114539695|gb|EAU42815.1| hypothetical protein FP2506_08236 [Fulvimarina pelagi HTCC2506]
          Length = 373

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 53/275 (19%), Positives = 115/275 (41%), Gaps = 8/275 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
                DI       F E+    +A+  +   LL++FP      +L GF+     +   I 
Sbjct: 60  LKGWKDIGLRLYSSFFEDRVMLIAAGATFYLLLALFPAFAVFVSLYGFVSDPATISDHIA 119

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYR 121
            +    P+   + +  ++  +       L        L A + ++NG++ L  ++N AY 
Sbjct: 120 FIGQFLPQAGTELLESQLDTLARQDPASLSVGFLTGFLFAMWSANNGIKTLFEAMNVAYG 179

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             E RS+     ++F + +   +  +++      IP  +  +           + I   R
Sbjct: 180 ETEQRSFLKLNAVAFCFTIGMIIVGIVLITAIGVIPAIMKIL----GLQTFSEIFIAALR 235

Query: 182 IYATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                L +   +  ++ + P+ K  +   ++ G   T   W+V ++ F+ Y+  F+ Y+ 
Sbjct: 236 WPVVFLLIVAAIAAIYRYGPSRKRARWKWVIGGAFLTAFVWLVASISFSWYLQNFANYNA 295

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            Y  L +++  ++++++  V FI+GAE+NA M   
Sbjct: 296 TYGSLGAVIGFMMWVWVSSVIFIIGAEVNAEMEHQ 330


>gi|71065116|ref|YP_263843.1| tRNA-processing RNAse BN [Psychrobacter arcticus 273-4]
 gi|71038101|gb|AAZ18409.1| tRNA-processing RNAse BN [Psychrobacter arcticus 273-4]
          Length = 525

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 45/270 (16%), Positives = 106/270 (39%), Gaps = 6/270 (2%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVIDV 65
             F  +     HF E++    A+ ++ + LLS+ P +     +   + A   V   + +V
Sbjct: 17  RWFQFLRFLTRHFFEDNCQQKAASLTYTTLLSIVPILTVLLMILSSVPALASVRAQIYEV 76

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           ++       +  ++  I    A  +  L  I A+   + +   +  +  + N+ +RV + 
Sbjct: 77  IYSNLLPQSSLQVSKYINNF-AEKSSNLTIIGAMFLLFTTIMTLTTIERAFNQIWRVEDR 135

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
                + L  +  V L  + L        A+       R+      +    +       +
Sbjct: 136 SGGMRSMLRYWTIVTLGPLVLGTAFIASSAVQSLNLLNRQIGGYGIDWSFWVQ----IVS 191

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +     G I ++ F+P A+    +     +F  I + +   LF   +  F++Y  +Y   
Sbjct: 192 IAVTIAGFISMYWFIPKARVPAKNAAIAGVFVAIVFELMKHLFGTVMANFTSYEAIYGAF 251

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           A++   L+++Y+     +LG E++ ++ I+
Sbjct: 252 AALPIFLLWIYLSWNLILLGVEISYTLTIF 281


>gi|296534422|ref|ZP_06896866.1| ribonuclease BN [Roseomonas cervicalis ATCC 49957]
 gi|296265251|gb|EFH11432.1| ribonuclease BN [Roseomonas cervicalis ATCC 49957]
          Length = 340

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 59/277 (21%), Positives = 117/277 (42%), Gaps = 8/277 (2%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
              + I+  A     E+     A+ ++  ALLSVFP +    +L G       V   +  
Sbjct: 49  RGWWSILKRAAIEANEDRIMTEAAGVTFYALLSVFPALTALVSLFGLFADPAMVGQQLQQ 108

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRV 122
             G  P    + I +++ ++ +     L     +    A + ++ G +A+  +LN  Y  
Sbjct: 109 AEGFIPAGGMQIIDEQLRRLASGERGSLGFSAVLGLGVALWSANQGTKAMFDALNIVYEE 168

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E R +    LI+  + L A V  ++     V +P+ LA+         +  L++   R 
Sbjct: 169 KEKRGFLRRTLITLAFTLGALVFTMLAMSAVVVLPVVLAFA----GFESSTELLLRLARW 224

Query: 183 YATMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
              +L +   L  ++ F P+  K++   +  G +F  ++W   +  F+ Y+  F  Y   
Sbjct: 225 PLLILFITALLATLYRFGPSREKARWRWVSWGGVFAALAWAALSAGFSFYVGNFGNYDAT 284

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           Y  L +++  + ++++  +  + GAELNA M     R
Sbjct: 285 YGSLGAVIGFMTWIWLSAMVVLFGAELNAEMEHQTAR 321


>gi|253698774|ref|YP_003019963.1| ribonuclease BN [Geobacter sp. M21]
 gi|251773624|gb|ACT16205.1| ribonuclease BN [Geobacter sp. M21]
          Length = 316

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 63/270 (23%), Positives = 122/270 (45%), Gaps = 1/270 (0%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPE 72
             A + F EED    A+ ++   L + FPF++F   L  +L     +  V++      P 
Sbjct: 20  KRAYKKFSEEDCPEHAAAMAYYFLFASFPFLLFLTTLIAYLPVPHLLDYVLENASRLLPG 79

Query: 73  VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
                I D I  +     +GL ++  + A + SSN + ++  ++N  Y V E R ++  R
Sbjct: 80  ETFTLIKDNIQALFTNKKEGLLSMGIVLALWASSNAIVSVMDAMNNLYDVKEGRPFWKVR 139

Query: 133 LISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIG 192
           LI+ G V+  SV  ++     +       YV           ++ +   +  T+  L + 
Sbjct: 140 LIAIGLVVGLSVLFLLAMAALMFGNQIGDYVAGLIHFGEAFKVVWFAALVPITLFVLILA 199

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
           +  ++ F P  + + + I PG +    SW+  ++ F+ YI  F +Y   Y  + +++  L
Sbjct: 200 VAVIYYFTPDVEHQWVWISPGAVIAIPSWIFMSLGFSAYINNFGSYDKTYGSIGAVIVLL 259

Query: 253 VFLYMLGVFFILGAELNASMIIYYWR-KKP 281
           ++LY+ G+  + GA +N+ +       KKP
Sbjct: 260 LWLYLTGLIILAGAVINSVIEHSSEEGKKP 289


>gi|150376889|ref|YP_001313485.1| putative ribonuclease BN [Sinorhizobium medicae WSM419]
 gi|150031436|gb|ABR63552.1| putative ribonuclease BN [Sinorhizobium medicae WSM419]
          Length = 328

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 56/277 (20%), Positives = 122/277 (44%), Gaps = 10/277 (3%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
             + D+ +  +    E+    +A+ ++   LLSVFP +    ++ G +     +      
Sbjct: 32  RGLRDVFWRVVAQVSEDRISLVAAGVTFYVLLSVFPALASLVSIYGLVSDPGTIAEQASY 91

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRV 122
           +    P    + +TD++  + +     L        L A + + NGV AL  ++N AY  
Sbjct: 92  LAAILPAQSLQLMTDQLKALASQNTSSLSLGFIGGLLFALWSARNGVSALFEAMNIAYDE 151

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E R +    L+S G+ L   +   ++      +P  L+++            II   R 
Sbjct: 152 TEKRGFIRLALLSIGFTLAGLILTAVLIGAIAVLPALLSFLDLKLQG------IISFARW 205

Query: 183 YATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
              +L +   +  ++ + P+ +  K+  +  G   + + W+V ++ F++YI  F+ Y+  
Sbjct: 206 PVMLLLIAAVITLIYRYGPSREPAKLRWLTWGAALSTVCWLVASLAFSYYIDNFANYNAT 265

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           Y  L +++  ++++++  +  I+GAELNA +     R
Sbjct: 266 YGALGALIGFMLWIWISTMIVIVGAELNAELEHQTAR 302


>gi|109900439|ref|YP_663694.1| putative ribonuclease BN [Pseudoalteromonas atlantica T6c]
 gi|109702720|gb|ABG42640.1| putative ribonuclease BN [Pseudoalteromonas atlantica T6c]
          Length = 320

 Score =  162 bits (409), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 57/278 (20%), Positives = 120/278 (43%), Gaps = 8/278 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
           F   +DI+   ++  ++++   +A+ +    LL+VFP +V   ++ G L +   +   ++
Sbjct: 17  FSGWWDILRRTVKKMLDDNLSLIAAGVGFYFLLAVFPLLVAFISIYGLLVSPDELQQHLN 76

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYR 121
            + G  P+   + I+ ++ ++++     L      S L A + +S G +A+  + N  Y 
Sbjct: 77  QLIGVVPDQGRQIISQQVERIMSKSNTALSTGVVFSTLFAVWSASKGAQAMVTACNITYG 136

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             + R + +  ++       A + LV   F    +P+  +YV           +++    
Sbjct: 137 QNQNRGFLMMLVMRVLLTASAVMLLVAALFTIAVLPILFSYV----GLHHYASILVQWLT 192

Query: 182 IYATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                L   + L   + + P   + K   + PG +     WV  +  F+ Y+  F  Y  
Sbjct: 193 WPFLALVFNLALSAFYRYGPHRSTAKWRWVTPGSLLASTLWVAFSFAFSFYLGQFGQYDK 252

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           MY  L S++  L++ Y+     +LGAE NA+M     +
Sbjct: 253 MYGSLGSVVVLLMWFYLTAYIILLGAEFNAAMEHQTEK 290


>gi|148253887|ref|YP_001238472.1| hypothetical protein BBta_2397 [Bradyrhizobium sp. BTAi1]
 gi|146406060|gb|ABQ34566.1| putative membrane protein of unknown function with ribonuclease
           domain [Bradyrhizobium sp. BTAi1]
          Length = 352

 Score =  162 bits (409), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 54/277 (19%), Positives = 118/277 (42%), Gaps = 8/277 (2%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
               D++Y   ++  E    A+A+ ++   LL++FP +     + G       +   ++ 
Sbjct: 55  RGWKDVLYRVYQNITEHRIVALAAGMTFYTLLAIFPALAALVAIYGLFSDPARITGHLEQ 114

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYRV 122
           + G  P        D++ +V A  ++ L     IS   + + ++  +++L  +LN  YR 
Sbjct: 115 LQGLLPGGAIDIARDQLTRVSAKGSQALGLTFGISLAISLWSANAAMKSLFDTLNVVYRE 174

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E R ++    IS  +   A +  ++     V +P+ L              L++  GR 
Sbjct: 175 PETRGFFKLNAISLLFTGGAILFALVAIGAIVVVPVVLH----SMGLSDAADLLLRIGRW 230

Query: 183 YATMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
            A  + + +GL  ++ + P   + K   I  G       W+ G+ LF+ Y   F +++  
Sbjct: 231 PAIFVCVSLGLALIYRYGPDREEPKWRWISWGSALAAALWLGGSALFSWYAANFGSFNAT 290

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           Y  L + +  + ++++  +  ++G EL+A +     R
Sbjct: 291 YGSLGAAIGFMTWIWISAIVILIGGELDAELEHQTLR 327


>gi|94968858|ref|YP_590906.1| ribonuclease BN, putative [Candidatus Koribacter versatilis
           Ellin345]
 gi|94550908|gb|ABF40832.1| ribonuclease BN, putative [Candidatus Koribacter versatilis
           Ellin345]
          Length = 341

 Score =  162 bits (409), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 53/271 (19%), Positives = 107/271 (39%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +       +++  +          A A  ++   +LS+FP ++  A +   L        
Sbjct: 40  KLTLRGWKNVLRRSAVDIDNNHIMAFAGSLAYYFVLSLFPALIALAAVVSLLPMPDLFQN 99

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           ++ V     P+   K ++  +  V+   +  L +   + + + +S+G   +  SLN AY 
Sbjct: 100 IMSVFGRVLPDESMKLVSKVVADVIRPHSGRLLSFGLIGSLWTASSGFSGMIESLNVAYG 159

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E R+W+ TRL++ G  LL    L +        P  L             LL     R
Sbjct: 160 VPETRAWWKTRLLAIGLTLLVGGMLTVSILCMTVGPHFLEIFADKIGFGPMFLLTWKIVR 219

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                  + + +  ++   P  +   M  L G +    +WVV ++    Y   F+ ++  
Sbjct: 220 WPIAFALVVLSIEAIYFLAPNVRQHFMHTLTGALIAVGAWVVLSLALGVYFGKFAHFNKT 279

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           Y  L + +  L +LY   +  ++G E+N+ +
Sbjct: 280 YGVLGAAIGLLTWLYWTSLAILVGGEVNSEI 310


>gi|90418256|ref|ZP_01226168.1| putative Ribonuclease BN, possibly membrane-associated
           [Aurantimonas manganoxydans SI85-9A1]
 gi|90337928|gb|EAS51579.1| putative Ribonuclease BN, possibly membrane-associated
           [Aurantimonas manganoxydans SI85-9A1]
          Length = 420

 Score =  161 bits (408), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 56/273 (20%), Positives = 123/273 (45%), Gaps = 8/273 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D+ +  +    ++    +A+ ++   LL+  P +    ++ G       V     ++   
Sbjct: 78  DVAWRVLAEISDDRVMLVAAGVTYYLLLAFVPALSALVSVYGLFADPATVQEHAAMLQAL 137

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLNRAYRVVEMR 126
            P    + I +++ ++ +     L    A+    A + ++ G++AL  ++N AY   E R
Sbjct: 138 IPGGGMEIINEQLTRLASQGDTTLGFTFAISLAIALWSANAGMKALFEAMNVAYDEAEKR 197

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+    L SF + L A V  ++   + +A+PLAL  +        +   ++         
Sbjct: 198 SFVTLTLTSFVFTLGAIVAAILFIGLVIALPLALDLL----GIGTDTKWLVSIASYAGIF 253

Query: 187 LALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           L +  G+  ++ + P+  ++K   I PG + T +  VV ++LF+ Y+  F +Y+  Y  L
Sbjct: 254 LLVSFGIAALYHWGPSRTRAKWRWITPGTVLTVVVIVVVSMLFSWYVANFGSYNATYGSL 313

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            +++  + ++++     I+G E+NA M     R
Sbjct: 314 GALIGFMTWIWISTTILIVGGEVNAEMEHQTAR 346


>gi|182416151|ref|YP_001821217.1| ribonuclease BN [Opitutus terrae PB90-1]
 gi|177843365|gb|ACB77617.1| ribonuclease BN [Opitutus terrae PB90-1]
          Length = 331

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 51/274 (18%), Positives = 107/274 (39%), Gaps = 7/274 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
             D++        +++   +A+ ++    ++  P +    +  G +     V    + + 
Sbjct: 36  WRDVLLRTKNELAKDNLSIVAAGVAFYCFMAFVPMLGAIVSTYGLVADPVQVSEHAEALA 95

Query: 68  GAWPEVIAKPITDEILQVLAVP--AKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
              P  +   + +++ ++ +    A     +S L A Y S+   +AL   LN AY   E 
Sbjct: 96  QVVPAEVMPLLREQMQRLTSAGEAAGIGALVSLLLAVYASAKATKALITGLNIAYDEEER 155

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R +   + ++    L A +  V+   +   +P     V             +   R    
Sbjct: 156 RGFVRLQAVALALTLGAVLGAVLALGLVAVLPS----VAGHLGWSDAAGTAVNWLRWPLL 211

Query: 186 MLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
           +    +GL  ++ F P+        +  G +     W+V ++ F+ Y+ T   Y   Y  
Sbjct: 212 VGGFMLGLGVLYRFGPSRNPPQWRWLSAGAVVATGLWIVASLGFSFYVSTLGNYEKTYGS 271

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           L +++  L++LY+ G   +LGAELNA M     +
Sbjct: 272 LGALVVFLLWLYLTGYVVLLGAELNAEMERQTEK 305


>gi|196040219|ref|ZP_03107521.1| YihY family protein [Bacillus cereus NVH0597-99]
 gi|196029074|gb|EDX67679.1| YihY family protein [Bacillus cereus NVH0597-99]
          Length = 289

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 72/270 (26%), Positives = 126/270 (46%), Gaps = 2/270 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
             +    D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++
Sbjct: 12  RTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLL 69

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               PE     I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E R
Sbjct: 70  EPYVPEDAMSLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVKETR 129

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+  TR +S  + L     +V    V V   +  A V K      +   +    R+ A+ 
Sbjct: 130 SFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIGAAVFKEIGLSDSFSYVWSITRLVASF 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             LF    F++ F P  K K   ++ G  F  + W+V +  F +Y+  F+ Y+  Y GL 
Sbjct: 190 FVLFALFSFLYTFAPDRKLKRREVISGATFATVGWIVVSYSFAYYVDKFANYANTYGGLG 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            I+  +++ Y+ G   +LG E+N  +  Y 
Sbjct: 250 GIIILMLWFYLTGWVILLGGEINGLLHHYR 279


>gi|27383151|ref|NP_774680.1| hypothetical protein blr8040 [Bradyrhizobium japonicum USDA 110]
 gi|27356325|dbj|BAC53305.1| blr8040 [Bradyrhizobium japonicum USDA 110]
          Length = 392

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 60/277 (21%), Positives = 118/277 (42%), Gaps = 8/277 (2%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
               DI++    +  +    A+A+ ++  +LL++FP I     + G       +   +D 
Sbjct: 94  RGWKDILWRVYGNIGDHRVLALAAGMTYYSLLAIFPAIAALVAIYGLFSDPSSITKHLDD 153

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTI---SALAAAYFSSNGVEALRISLNRAYRV 122
           V    P    +   +++ +V     + L          + + ++  +++L  +LN  Y  
Sbjct: 154 VSSFIPGGAVEVAREQLTRVATKSNRTLGFTFAIGLAISLWSANAAMKSLFDTLNIVYGE 213

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E R ++    +S G+ + A   +V      V IP+ L YV           L++  GR 
Sbjct: 214 QEKRGFFKLNAMSLGFTVGAIAFVVAALGAVVVIPVVLHYV----GLSNATDLLVRIGRW 269

Query: 183 YATMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
            A  +AL   L  ++ F P+ +  +   I  G     + W+  + LF+ Y   F T++  
Sbjct: 270 PALFVALAFALACIYRFGPSRQAPRWTWITWGSAAAALLWLAASGLFSFYAANFGTFNAT 329

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           Y  L +++  + +L++  +  +LGAELNA M     R
Sbjct: 330 YGSLGAVVGFMTWLWISAIVILLGAELNAEMEHQTAR 366


>gi|197105285|ref|YP_002130662.1| hypothetical protein PHZ_c1822 [Phenylobacterium zucineum HLK1]
 gi|196478705|gb|ACG78233.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 367

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 53/277 (19%), Positives = 112/277 (40%), Gaps = 10/277 (3%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
               DI+  A++ F ++    +A+ ++   LL++FP +     L G           +  
Sbjct: 72  RGWKDILIRAVKEFADDQAPLVAAGVTFYTLLALFPALGALVALYGLFADVAQAREHLAA 131

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTI---SALAAAYFSSNGVEALRISLNRAYRV 122
           +    P    + + ++++++ A    GL        L + + ++   +A+  ++N AY  
Sbjct: 132 LSAVLPADAVRFLGEQMVRISASNEGGLSLAFAGGLLLSIWSANGATKAMITAMNIAYDE 191

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E RS+    L S  + L   +  +    V  A      +             ++     
Sbjct: 192 DEKRSFVAKTLTSLAFTLGFLMFGLAALAVIAAPAAVEPFAGP------AAAAMMRWITW 245

Query: 183 YATMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
              + AL +GL  ++ F P+  + +   I  G     I W+  +  F+ Y+  F+ Y   
Sbjct: 246 PILVAALGLGLALLYRFGPSRDRVRWRWISWGSAAALILWLAVSAAFSIYVANFADYEKT 305

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           Y  L +++  L++LY+     +LGAELN+ +     +
Sbjct: 306 YGSLGAVIGFLMWLYLSAQVVLLGAELNSEIEHQTVK 342


>gi|297198844|ref|ZP_06916241.1| ribonuclease BN family membrane protein [Streptomyces sviceus ATCC
           29083]
 gi|197711235|gb|EDY55269.1| ribonuclease BN family membrane protein [Streptomyces sviceus ATCC
           29083]
          Length = 354

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 46/274 (16%), Positives = 107/274 (39%), Gaps = 4/274 (1%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
                ++    +  ++++    A+ ++   +LS+FP ++   +L G +G  +    ++  
Sbjct: 47  RAWRAVLRRTAKELLDDELADRAAALTYYGVLSLFPALLVMVSLLGVVG-QRATDKILGN 105

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVV 123
           +    P      + D ++Q+      G  L  +  LAA + +S  V A   + N  Y + 
Sbjct: 106 IGDLAPGPARDILRDAVVQLGDSGGTGSVLAILGLLAALWSASGYVAAFIRASNAVYDLP 165

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R  +    +     +   + L + + + V          +        + +    +  
Sbjct: 166 EGRPVWKLTPLRLALTVTLMLMLAVSALIVVFTGPLAERAGRAVGFGDAAIALWGVTKWP 225

Query: 184 ATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
             +L + + +  ++   P  + +    I PG +   + WV  +  F  Y   F +Y+  Y
Sbjct: 226 VLLLLVVVMIGLLYWAAPNVRGRGFRWISPGSVVATLVWVAASAGFAVYAANFGSYNKTY 285

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             LA  +  LV+L++  +  +LG E +A +    
Sbjct: 286 GTLAGAIVFLVWLWLTNLAILLGLEFDAELARER 319


>gi|256395761|ref|YP_003117325.1| ribonuclease BN [Catenulispora acidiphila DSM 44928]
 gi|256361987|gb|ACU75484.1| ribonuclease BN [Catenulispora acidiphila DSM 44928]
          Length = 365

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 45/274 (16%), Positives = 108/274 (39%), Gaps = 4/274 (1%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
                ++      F +++    A+ ++   +L+VFP ++   ++ G +G      +++D 
Sbjct: 64  RSWLAVLRRTAGEFRDDELSDRAAALTYYGVLAVFPALLVVVSVLGLIG-PSATNSLLDN 122

Query: 66  VFGAWPEVIAKPITDEILQVLAVPA--KGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
           +    P  +   +   + QV +       L  +    A + +S  V A   + N  Y + 
Sbjct: 123 IQKLAPGSVRDLLRTAVTQVRSSRGAGGTLAVVGLAGALWSASGYVAAFIRASNVVYDMR 182

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R  + T  +  G  LL    L+  + + V                   L+     +  
Sbjct: 183 EGRPVWKTTPLRVGLTLLMMALLLASAVIVVFTGPLAQRAGDLLGLGHTALVAWSIAKWP 242

Query: 184 ATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
             ++ +   +  ++   P  + +    + PG +   + W++ +  F  Y+  F++Y+  Y
Sbjct: 243 VLVVLVAFMIALLYWAAPNVRDRGFRWVSPGSLLAVVLWLILSAGFALYVANFASYNKTY 302

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             +A ++  LV+L++  +  +LG E +A +    
Sbjct: 303 GTVAGVIVFLVWLWLSNLAILLGLEFDAELARER 336


>gi|312194341|ref|YP_004014402.1| ribonuclease BN [Frankia sp. EuI1c]
 gi|311225677|gb|ADP78532.1| ribonuclease BN [Frankia sp. EuI1c]
          Length = 360

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 45/272 (16%), Positives = 106/272 (38%), Gaps = 4/272 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
            + ++   +  F E+     A+ ++  ++L++FP ++   +L G +G      TV+D + 
Sbjct: 40  WWAVLRRTVAEFNEDALSDRAAALTYYSILAIFPALLVLVSLLGVIG-QSATTTVLDNLQ 98

Query: 68  GAWPEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
              P      ++  +  V      G  L  +    A + +S  V A   + N  Y + E 
Sbjct: 99  NLTPASARDVVSGAVDGVRGSAGTGSVLAIVGLAGALWSASGYVAAFIRAANAVYDIPEG 158

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R  +    +  G  +   V   + + + V                   + +    +    
Sbjct: 159 RPAWKIAPLRIGLTVALMVLAALSAVIVVFSGKVARQAGSALGIGQTAVDVWSYAKWPVL 218

Query: 186 MLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
           ++ + + +  ++   P  + +    + PG +     W+V +  F  Y+  F +Y+  Y  
Sbjct: 219 VVFVILMIAILYWAAPNVRHQGFRWLTPGTVLALAIWMVASAAFAFYVSNFGSYNKTYGA 278

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           +A ++  LV+L++  +  +LG E +A +    
Sbjct: 279 VAGVIIFLVWLWLTNLAILLGLEFDAELARQR 310


>gi|332142226|ref|YP_004427964.1| putative ribonuclease protein [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327552248|gb|AEA98966.1| putative ribonuclease protein [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 317

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 47/273 (17%), Positives = 115/273 (42%), Gaps = 8/273 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
               + I+        +++   +A+ ++   LL++FP +     L G + + Q + + + 
Sbjct: 17  LKSWWSILKRIFSSVQKDNIPLIAAGVAFYCLLAIFPLLGATIALYGLMVSPQELQSHMT 76

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYR 121
            +    P      I +++  ++      L      + + + + SS G  AL  + N  Y 
Sbjct: 77  FLVNVVPTDSRYIIEEQLTNLIEKSNSTLGWGFLFTLVLSLWSSSKGANALIKACNITYG 136

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             E R ++   L      +   +T+++       +P ++ ++     +    + +     
Sbjct: 137 ESEGRGFFKGILARVTCTVFMILTVIVALACITILPESIQWLSGNTVSAKEAMWVT---- 192

Query: 182 IYATMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
               +    I L  ++ + P  + ++   + PG IF  + WVV +  F+ Y+  F +Y+ 
Sbjct: 193 WPVMLGLFNIALSALYRYAPHRREAQWRWVTPGSIFATVLWVVASYGFSIYLNEFGSYNK 252

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
            Y  +  I+  L++LY+     ++GAE+N+++ 
Sbjct: 253 TYGSVGGIIILLMWLYLSAYIILIGAEVNSAIE 285


>gi|119961246|ref|YP_949390.1| YihY family protein [Arthrobacter aurescens TC1]
 gi|119948105|gb|ABM07016.1| YihY family protein [Arthrobacter aurescens TC1]
          Length = 359

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 51/270 (18%), Positives = 109/270 (40%), Gaps = 3/270 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH-QFVPTVIDVVFGA 69
           I    +  F ++     A+ ++  A+L++FP ++   +L G  G   +    ++D+V   
Sbjct: 40  IAKRTLREFTKDQCPDAAAGLTYYAVLALFPALLALVSLIGIFGDAGKTTGALLDIVQQF 99

Query: 70  WPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            P      +   I ++    A G    +  L A + +S    A   ++NR Y V E R +
Sbjct: 100 APGPGVDAMRQPIEELTQSNAAGFALILGILVALWSASGYTTAFSRAMNRVYEVDEGRGF 159

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
              R       +++ V   +++ + V        V          L +    +    ++ 
Sbjct: 160 VKLRGTMLAVTVVSVVGAALVAGMLVLSGPVAEAVGGAIGMSETFLTVWNIAKWPILIII 219

Query: 189 LFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           +   +  ++ F P  K      +  G +   + + + ++ F  Y+  FS Y+  Y  LA 
Sbjct: 220 VVAIIAVLYYFTPNVKQPKFRWMSMGSLIALVIFALASLGFGFYVANFSNYNKTYGALAG 279

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           ++  L++L++L +  + GAE +A M     
Sbjct: 280 VIIMLLWLWILNMSLLFGAEFDAEMERGRQ 309


>gi|301052124|ref|YP_003790335.1| putative ribonuclease BN [Bacillus anthracis CI]
 gi|300374293|gb|ADK03197.1| probable ribonuclease BN [Bacillus cereus biovar anthracis str. CI]
          Length = 289

 Score =  160 bits (404), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 72/270 (26%), Positives = 126/270 (46%), Gaps = 2/270 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
             +    D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++
Sbjct: 12  RTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLL 69

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               PE     I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E R
Sbjct: 70  EPYVPEDAMSLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVKETR 129

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+  TR +S  + L     +V    V V   +  A V K      +   +    R+ A+ 
Sbjct: 130 SFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIGAAVFKVIGLSDSFSYVWSITRLVASF 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             LF    F++ F P  K K   ++ G  F  + W+V +  F +Y+  F+ Y+  Y GL 
Sbjct: 190 FVLFALFSFLYTFAPDRKLKRREVISGATFATVGWIVVSYSFAYYVDKFANYANTYGGLG 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            I+  +++ Y+ G   +LG E+N  +  Y 
Sbjct: 250 GIIILMLWFYLTGWVILLGGEINGLLHHYR 279


>gi|88812854|ref|ZP_01128099.1| Ribonuclease BN [Nitrococcus mobilis Nb-231]
 gi|88789924|gb|EAR21046.1| Ribonuclease BN [Nitrococcus mobilis Nb-231]
          Length = 322

 Score =  160 bits (404), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 55/268 (20%), Positives = 108/268 (40%), Gaps = 8/268 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
             DI+         +     A+ ++  A+L++FP +    ++ G +   Q V   I  V 
Sbjct: 26  WRDILLRTKSEISNDHLSMAAAGVAFYAMLALFPALAAIISIWGLVSDPQQVMQQIQSVS 85

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTI---SALAAAYFSSNGVEALRISLNRAYRVVE 124
           G  P+  A  I  +  +V +     +      S L A Y +S G++AL   LN  Y   E
Sbjct: 86  GMLPDQTAAIIKSQATKVASASGGAVSLAALGSVLLAVYSASKGMKALIEGLNMVYDEEE 145

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R +    L++    +   + ++    +  AIP  L  +             +   R   
Sbjct: 146 KRGFIKLNLVALILTIGLVLVMIAALGMIAAIPALLGSL----GLGAVTKTAVIWLRWPL 201

Query: 185 TMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
             +     L  ++ + P+  + +   +  G +   + W+ G+  F+ Y   F +Y+  Y 
Sbjct: 202 LFVVAIASLALIYRYAPSRTQPRWRWVSVGAVVATLLWIAGSFAFSFYTRNFGSYNETYG 261

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNAS 271
            L +++  L +L++     +LGAELN+ 
Sbjct: 262 SLGAVIILLTWLWLSAFVVLLGAELNSE 289


>gi|332308360|ref|YP_004436211.1| ribonuclease BN [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332175689|gb|AEE24943.1| ribonuclease BN [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 318

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 50/275 (18%), Positives = 115/275 (41%), Gaps = 8/275 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
               +DI+   ++  ++++   +A+ +    LL++FP +    ++ G + +   +   ++
Sbjct: 17  LVGWWDILRRTVKKMLDDNLSLIAAGVGFYFLLAIFPMLAAFVSVYGLVVSPDELQQHLN 76

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYR 121
            + G  P    + I  +I  ++      L      S L A + +S G +A+  + N  Y 
Sbjct: 77  SLIGVVPAQGREIIQKQISNIINKSQAELSASVVFSTLFAVWSASKGAQAMVTASNITYD 136

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             E R      ++     ++ +++ V++    +     L  +        +   ++    
Sbjct: 137 QREKRGL----IMMLVMRVVLTLSAVLVLAGALLAIALLPILLNQIGLKEHSSFLVKLIT 192

Query: 182 IYATMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                +   + L   + + P    +K   + PG I   ++WV+ +V F++Y+  F  Y  
Sbjct: 193 WPFLAIVFNLALASFYRYGPHRSSAKWRWVTPGSILASVTWVMFSVGFSYYLGQFGQYDK 252

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            Y  L S++  L++ Y+     +LGAE NA+M   
Sbjct: 253 TYGSLGSVVVLLMWFYLTAFIILLGAEFNAAMEHQ 287


>gi|297204551|ref|ZP_06921948.1| ribonuclease BN family membrane protein [Streptomyces sviceus ATCC
           29083]
 gi|197710614|gb|EDY54648.1| ribonuclease BN family membrane protein [Streptomyces sviceus ATCC
           29083]
          Length = 353

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 51/269 (18%), Positives = 110/269 (40%), Gaps = 4/269 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           I+   ++ F  ++    A+ ++   +L++FP ++   +L G +  H     V+D +    
Sbjct: 54  ILKGTLKEFKRDELTDRAAALTYYGILALFPALLALISLLG-IAGHSATQKVLDNIQKLA 112

Query: 71  PEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
           P      ++  + Q+      G  +  +  + A + +S  V A   S N  Y V E R  
Sbjct: 113 PGAARDVLSSAVKQMQGNAGIGSIMAIVGLVLAVWSASGYVAAFIRSANAVYDVPEGRPV 172

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +    +  G  ++  +  VI + + V        +          L +    +    +L 
Sbjct: 173 WKVLPVRVGVTVVLLILAVISALIVVFTGSLAQQLGTTLGIGDTFLTVWSIAKWPVLVLL 232

Query: 189 LFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           +   +  ++   P AK +    I PG +   + W++ +  F  Y+  F++Y+  Y   A 
Sbjct: 233 VTTMIAILYWATPNAKVRGFRWITPGSLLALVIWMIVSAGFALYVANFASYNKTYGTFAG 292

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYY 276
           ++  LV+L++  +  +LG E +A M    
Sbjct: 293 VIIFLVWLWITNLAILLGLEFDAEMHRQR 321


>gi|327480116|gb|AEA83426.1| ribonuclease BN, putative [Pseudomonas stutzeri DSM 4166]
          Length = 291

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 69/272 (25%), Positives = 125/272 (45%), Gaps = 1/272 (0%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           F ++   ++ F  +D    AS ++   L ++FPF+VF   L GFL    F   +      
Sbjct: 12  FTLLKRTLKEFSSDDMSTYASALAYRGLFAMFPFLVFLIALLGFLDLQNFFDWLRMQAEL 71

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
           A P V  + I   I Q+    A GL +   L A + +S G  +L  +LNRAY V E R  
Sbjct: 72  ALPPVAMEQINPVIDQLQEQQA-GLLSFGILVALWTASIGFRSLMNALNRAYDVEEGRPT 130

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +   +++  Y    +V L+  + + V  P A+ ++         ++++    R    +L 
Sbjct: 131 WKLIILALAYTAGVAVLLLFTAGLMVIGPQAMEWLAGQVGMRELVVVLWTWLRWPVIVLM 190

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           L + +  ++   P  + +   I PG +   + W++ +V F  Y+  F+ Y+  Y  + +I
Sbjct: 191 LMLVVALLYYVAPDVEQEFRFITPGSVLAVLVWILASVAFGVYVQNFADYNATYGSIGAI 250

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +  L++LY+     + GAELNA +       K
Sbjct: 251 IVLLLYLYISAAVLLFGAELNAVIEHASVEGK 282


>gi|72160655|ref|YP_288312.1| ribonuclease BN [Thermobifida fusca YX]
 gi|71914387|gb|AAZ54289.1| ribonuclease BN [Thermobifida fusca YX]
          Length = 333

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 56/271 (20%), Positives = 114/271 (42%), Gaps = 3/271 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
            +  +   +  F E++   +A+ ++  A+LS+FP ++   +L G  G      T+ D + 
Sbjct: 32  WWASLKRTVVEFKEDNLTDLAAGLTYYAVLSIFPALLVLVSLLGLAG-QSATDTISDQLS 90

Query: 68  GAWPEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
              P+   + +T  +  + A  A    +  +S   A + +S  V A   + N  Y + E 
Sbjct: 91  AVAPDETVEIVTGVLTNLQANQATASLVGLLSLALAVWSASAYVAAFMRAANIVYDIREG 150

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R ++ T  +  G  LL    + I +   +       +V  F  A    + +    +    
Sbjct: 151 RPFWKTLPVRVGITLLLLTLVAISALAVILSGGVAQWVGNFIGAGPTAVTLWNIVKWPVL 210

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +L +   +  ++   P  K     + PG I   + W+  +  F  Y+  F+ Y+  Y  L
Sbjct: 211 VLLMMFMVSVLYWAAPNVKRPFRWVSPGGIVAVLIWLGASAAFAFYVANFANYNRTYGSL 270

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           A+++  LV+L++  +  +LG E NA +    
Sbjct: 271 AAVVIFLVWLWISNIAILLGIEYNAEIERSR 301


>gi|229165407|ref|ZP_04293191.1| YihY [Bacillus cereus AH621]
 gi|228618005|gb|EEK75046.1| YihY [Bacillus cereus AH621]
          Length = 288

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 71/270 (26%), Positives = 125/270 (46%), Gaps = 2/270 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
             +    D  +  + +D   +A+ ++   LL++FP +VF   L GF+        V+ ++
Sbjct: 12  RTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIPIQ--TEDVLSLL 69

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               P+     I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E R
Sbjct: 70  EVYVPDDAMNLIEVNVDKVVNQQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVKETR 129

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+  TR +S  + L     +V    V V   +  A V K      +   +    R+ A+ 
Sbjct: 130 SFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIGAAVFKALGLSDSFSYVWSITRLVASF 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             LF    F++ F P  K K   ++ G +F  + W+V +  F +Y+  F+ Y+  Y GL 
Sbjct: 190 FVLFALFSFLYTFAPDRKLKRREVISGALFATVGWIVVSYSFAYYVDKFANYANTYGGLG 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            I+  +++ Y+ G   +LG E+N  +  Y 
Sbjct: 250 GIIILMLWFYLTGWVILLGGEINGLLHHYR 279


>gi|172056670|ref|YP_001813130.1| ribonuclease BN [Exiguobacterium sibiricum 255-15]
 gi|171989191|gb|ACB60113.1| ribonuclease BN [Exiguobacterium sibiricum 255-15]
          Length = 302

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 64/266 (24%), Positives = 118/266 (44%), Gaps = 3/266 (1%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAK 76
           +   + +    A  ++    LS+FP I+F  ++  F    Q   T+   +    P     
Sbjct: 16  QRMSDHNITDYAGTLAYYWFLSIFPGIIFVISVLSFFDIDQ--QTLESQIRDLAPGGSVN 73

Query: 77  PITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISF 136
             TD I Q +  P  GL ++ A+ A + +S GV+ L  + N AY     R +   R I+ 
Sbjct: 74  TFTDVIFQAIKEPQGGLLSVGAILAIWSASKGVDRLITTANHAYGDFSPRGFVAARGIAL 133

Query: 137 GYVLLASVTLVIMSFVFVAIPLALAYVRKF-FPALGNLLLIIWNGRIYATMLALFIGLIF 195
              ++  + ++++  + V     ++Y+  F  P      +++   R   + + L + L  
Sbjct: 134 ILTIVLGIGMLLLIVLNVLGGPIISYLANFVIPIDMGQKILLTVLRYAISTVLLILILSI 193

Query: 196 VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFL 255
            +   P         +PG +F  I W + +V F  Y+  FS Y+  Y  L S++  L++L
Sbjct: 194 FYRVAPKRPITFKEAIPGAVFGVIVWQLLSVGFGFYVSNFSNYNQTYGSLGSVVIVLLWL 253

Query: 256 YMLGVFFILGAELNASMIIYYWRKKP 281
           Y  G+  +LG+ELNAS   +  +  P
Sbjct: 254 YFTGLIILLGSELNASWERFMKKADP 279


>gi|284029889|ref|YP_003379820.1| ribonuclease BN [Kribbella flavida DSM 17836]
 gi|283809182|gb|ADB31021.1| ribonuclease BN [Kribbella flavida DSM 17836]
          Length = 346

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 53/268 (19%), Positives = 116/268 (43%), Gaps = 11/268 (4%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
            + I+  A +    +    +A+ ++    LS+FP +       G +     + + ++ + 
Sbjct: 56  WWRIVRRAWKEASTDQVPLLAAGVAFFGFLSLFPAVAAIVLGYGLVAEPSQMRSQVEELT 115

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAA---AYFSSNGVEALRISLNRAYRVVE 124
            A P      +  ++  + A P +GL     +A     + +S GV  L  ++N AY   E
Sbjct: 116 AAVPASARDILLQQVESLAAAPQQGLGIGLVIALATALWSASGGVGYLISAVNLAYDEEE 175

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R +   +L++ G  L A V +++ + +     L              + +++   R+  
Sbjct: 176 TRGFVKRKLLALGLTLGAIVFVLLAAGLLAVGALIDDS-------STVVRVLLQVARLAV 228

Query: 185 TMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            ++ + I L  V+   P     ++  +  G     + W++ ++ F+ Y+ TF  Y+  Y 
Sbjct: 229 AIILITIALAVVYRVAPDRDAPRMRWVSVGAAVATVIWLLASIGFSVYVSTFGNYAKTYG 288

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNAS 271
            LA++   L++L++     +LGAE+NA 
Sbjct: 289 SLAAVAILLLWLWLTAYAILLGAEINAE 316


>gi|30260576|ref|NP_842953.1| ribonuclease BN, putative [Bacillus anthracis str. Ames]
 gi|42779603|ref|NP_976850.1| ribonuclease BN, putative [Bacillus cereus ATCC 10987]
 gi|47525680|ref|YP_017029.1| ribonuclease BN [Bacillus anthracis str. 'Ames Ancestor']
 gi|49183423|ref|YP_026675.1| ribonuclease BN [Bacillus anthracis str. Sterne]
 gi|49480098|ref|YP_034736.1| ribonuclease BN [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|52144837|ref|YP_081992.1| ribonuclease BN [Bacillus cereus E33L]
 gi|65317837|ref|ZP_00390796.1| COG1295: Predicted membrane protein [Bacillus anthracis str. A2012]
 gi|165870787|ref|ZP_02215440.1| YihY family protein [Bacillus anthracis str. A0488]
 gi|167634706|ref|ZP_02393025.1| YihY family protein [Bacillus anthracis str. A0442]
 gi|167641273|ref|ZP_02399526.1| YihY family protein [Bacillus anthracis str. A0193]
 gi|170688965|ref|ZP_02880166.1| YihY family protein [Bacillus anthracis str. A0465]
 gi|170707108|ref|ZP_02897564.1| YihY family protein [Bacillus anthracis str. A0389]
 gi|177654535|ref|ZP_02936391.1| YihY family protein [Bacillus anthracis str. A0174]
 gi|190567539|ref|ZP_03020452.1| YihY family protein [Bacillus anthracis Tsiankovskii-I]
 gi|217958004|ref|YP_002336548.1| YihY family protein [Bacillus cereus AH187]
 gi|222094204|ref|YP_002528261.1| ribonuclease bn [Bacillus cereus Q1]
 gi|227813080|ref|YP_002813089.1| YihY family protein [Bacillus anthracis str. CDC 684]
 gi|228913156|ref|ZP_04076795.1| YihY [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|229089528|ref|ZP_04220797.1| YihY [Bacillus cereus Rock3-42]
 gi|229137270|ref|ZP_04265886.1| YihY [Bacillus cereus BDRD-ST26]
 gi|229194786|ref|ZP_04321574.1| YihY [Bacillus cereus m1293]
 gi|229604696|ref|YP_002865023.1| YihY family protein [Bacillus anthracis str. A0248]
 gi|254686797|ref|ZP_05150655.1| YihY family protein [Bacillus anthracis str. CNEVA-9066]
 gi|254724872|ref|ZP_05186655.1| YihY family protein [Bacillus anthracis str. A1055]
 gi|254738978|ref|ZP_05196680.1| YihY family protein [Bacillus anthracis str. Western North America
           USA6153]
 gi|254744565|ref|ZP_05202244.1| YihY family protein [Bacillus anthracis str. Kruger B]
 gi|254756177|ref|ZP_05208206.1| YihY family protein [Bacillus anthracis str. Vollum]
 gi|254761995|ref|ZP_05213844.1| YihY family protein [Bacillus anthracis str. Australia 94]
 gi|300119033|ref|ZP_07056744.1| YihY family protein [Bacillus cereus SJ1]
 gi|4584097|emb|CAB40586.1| yfkH [Bacillus cereus ATCC 10987]
 gi|30253944|gb|AAP24439.1| YihY family protein [Bacillus anthracis str. Ames]
 gi|42735519|gb|AAS39458.1| ribonuclease BN, putative [Bacillus cereus ATCC 10987]
 gi|47500828|gb|AAT29504.1| YihY family protein [Bacillus anthracis str. 'Ames Ancestor']
 gi|49177350|gb|AAT52726.1| ribonuclease BN, putative [Bacillus anthracis str. Sterne]
 gi|49331654|gb|AAT62300.1| probable ribonuclease BN [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|51978306|gb|AAU19856.1| probable ribonuclease BN [Bacillus cereus E33L]
 gi|164713621|gb|EDR19145.1| YihY family protein [Bacillus anthracis str. A0488]
 gi|167510781|gb|EDR86174.1| YihY family protein [Bacillus anthracis str. A0193]
 gi|167529780|gb|EDR92528.1| YihY family protein [Bacillus anthracis str. A0442]
 gi|170127886|gb|EDS96757.1| YihY family protein [Bacillus anthracis str. A0389]
 gi|170667066|gb|EDT17828.1| YihY family protein [Bacillus anthracis str. A0465]
 gi|172080647|gb|EDT65730.1| YihY family protein [Bacillus anthracis str. A0174]
 gi|190561326|gb|EDV15298.1| YihY family protein [Bacillus anthracis Tsiankovskii-I]
 gi|217067694|gb|ACJ81944.1| YihY family protein [Bacillus cereus AH187]
 gi|221238259|gb|ACM10969.1| probable ribonuclease BN [Bacillus cereus Q1]
 gi|227003880|gb|ACP13623.1| YihY family protein [Bacillus anthracis str. CDC 684]
 gi|228588697|gb|EEK46727.1| YihY [Bacillus cereus m1293]
 gi|228646173|gb|EEL02391.1| YihY [Bacillus cereus BDRD-ST26]
 gi|228693835|gb|EEL47529.1| YihY [Bacillus cereus Rock3-42]
 gi|228846561|gb|EEM91574.1| YihY [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|229269104|gb|ACQ50741.1| YihY family protein [Bacillus anthracis str. A0248]
 gi|298723649|gb|EFI64380.1| YihY family protein [Bacillus cereus SJ1]
 gi|324324508|gb|ADY19768.1| YihY family protein [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 289

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 72/270 (26%), Positives = 126/270 (46%), Gaps = 2/270 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
             +    D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++
Sbjct: 12  RTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLL 69

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               PE     I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E R
Sbjct: 70  EPYVPEDAMSLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETR 129

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+  TR +S  + L     +V    V V   +  A V K      +   +    R+ A+ 
Sbjct: 130 SFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASF 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             LF    F++ F P  K K   ++ G  F  + W+V +  F +Y+  F+ Y+  Y GL 
Sbjct: 190 FVLFALFSFLYTFAPDRKLKRREVISGATFATVGWIVVSYSFAYYVDKFANYANTYGGLG 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            I+  +++ Y+ G   +LG E+N  +  Y 
Sbjct: 250 GIIILMLWFYLTGWVILLGGEINGLLHHYR 279


>gi|311113876|ref|YP_003985098.1| tRNA processing ribonuclease BN [Rothia dentocariosa ATCC 17931]
 gi|310945370|gb|ADP41664.1| tRNA processing ribonuclease BN [Rothia dentocariosa ATCC 17931]
          Length = 431

 Score =  159 bits (402), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 56/272 (20%), Positives = 109/272 (40%), Gaps = 5/272 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVVFGA 69
           I   A   F    G  +A+ ++   +LS FP ++   +L G  G        +++ +   
Sbjct: 28  IFRRAGFSFGAHGGTDLAAALTYFTVLSAFPALLAILSLLGIFGQGEDSAKVILEFLQER 87

Query: 70  WPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            P+ +   +   I Q+      G    I  L+A + +S  V +   +LN  Y V E R  
Sbjct: 88  APQQMYSILEGPIHQLTNGQGAGFALIIGILSALWSASGYVGSFGRALNNVYGVREGRPG 147

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPA--LGNLLLIIWNGRIYATM 186
           +  +  +        V +V+M  +F+     L +   + P   +  + ++  NGR    +
Sbjct: 148 WFLKPYNVLITTGVIVLVVLMMLMFLLGASVLDWAAPYMPGVDIELIKVLWLNGRWVLIL 207

Query: 187 LALFIGLIFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +     +  ++   P   + KI    PG +       +G + FT Y   FS Y+  Y  +
Sbjct: 208 ILAVFLIAMLYTATPNVRRLKIRWTSPGAVIALFGMGLGGLGFTIYTNNFSKYNATYGLI 267

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
             ++  LVFL+++    + GA ++A       
Sbjct: 268 GGVIVMLVFLWIMNNMLVFGAHVDAEFERMRQ 299


>gi|47567234|ref|ZP_00237948.1| ribonuclease BN, putative [Bacillus cereus G9241]
 gi|228983665|ref|ZP_04143867.1| YihY [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|47556077|gb|EAL14414.1| ribonuclease BN, putative [Bacillus cereus G9241]
 gi|228776072|gb|EEM24436.1| YihY [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1]
          Length = 289

 Score =  159 bits (402), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 72/270 (26%), Positives = 126/270 (46%), Gaps = 2/270 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
             +    D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++
Sbjct: 12  RTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLL 69

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               PE     I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E R
Sbjct: 70  EPYVPEDAMSLIEVNVDKVVNQQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETR 129

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+  TR +S  + L     +V    V V   +  A V K      +   +    R+ A+ 
Sbjct: 130 SFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASF 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             LF    F++ F P  K K   ++ G  F  + W+V +  F +Y+  F+ Y+  Y GL 
Sbjct: 190 FVLFALFSFLYTFAPDRKLKRREVISGATFATVGWIVVSYSFAYYVDKFANYANTYGGLG 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            I+  +++ Y+ G   +LG E+N  +  Y 
Sbjct: 250 GIIILMLWFYLTGWVILLGGEINGLLHHYR 279


>gi|158316017|ref|YP_001508525.1| putative ribonuclease BN [Frankia sp. EAN1pec]
 gi|158111422|gb|ABW13619.1| putative ribonuclease BN [Frankia sp. EAN1pec]
          Length = 420

 Score =  159 bits (401), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 44/275 (16%), Positives = 103/275 (37%), Gaps = 4/275 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
               F ++   +  F  +D    A+ ++   +L++FP  +        +   Q   +V++
Sbjct: 93  LRSWFWVLVRTVREFRRDDLPDRAAALTYYGVLAIFPA-LLVLVSLLGVVGRQATDSVLE 151

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAA--YFSSNGVEALRISLNRAYRV 122
            +    P      + D +  +   P           AA  + +S  + A   + N  Y +
Sbjct: 152 NLQELTPGSARDIVHDAVTGLRDAPGTSGLLAVLGLAAALWSASGYIAAFIRAANAIYDM 211

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E R  +    +     +L  V L   + + V        V +       ++ +    + 
Sbjct: 212 PEGRPVWKVAPLRLAVTVLLMVLLAGSAVIVVFSGGLARQVGRMIGLDDAMITLWSVAKW 271

Query: 183 YATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
              +L + + +  ++   P A+ +    + PG +   + W+  +  F  Y+  F +Y+  
Sbjct: 272 PVLVLFVVVMIALLYWSTPNARVRGFRWMTPGSLLAVLIWLAASAAFAFYVSNFGSYNKT 331

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           Y  LA ++  LV+L++  +  +LG E +  +    
Sbjct: 332 YGALAGVIVFLVWLWLSNLAILLGLEFDTEIARGR 366


>gi|331696161|ref|YP_004332400.1| ribonuclease BN [Pseudonocardia dioxanivorans CB1190]
 gi|326950850|gb|AEA24547.1| ribonuclease BN [Pseudonocardia dioxanivorans CB1190]
          Length = 350

 Score =  159 bits (401), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 61/275 (22%), Positives = 115/275 (41%), Gaps = 8/275 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
            + +   A      ++   +A  ++  A L++FP ++    + G +     V   +D + 
Sbjct: 48  WWQVTRRAWAEAKADNVPILAGGVAFFAFLALFPALIAAITVYGLVADPAQVGDQVDRLA 107

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYRVVE 124
              P      + D++  V +     L     +S LAA + +S G   L  + N AY   E
Sbjct: 108 AILPAAARPIVADQLGAVSSAGTGALGVGLVVSLLAALWSASAGTMNLIRATNLAYDEEE 167

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R +   R  + G  L A V +++   +  A+P     V       G  L++    R   
Sbjct: 168 TRGFLRLRGTALGLTLAAIVFVLLAVALVAAMPAVFEAV----GLGGAGLVVAQVVRWVL 223

Query: 185 TMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            ++ + + L  V+   P     K   +  G +   + W+VG+++F+ Y+  F +Y+  Y 
Sbjct: 224 LVVLVVVALAVVYRVAPDRDAPKFRWVSVGAVVATVLWLVGSIVFSVYVDNFGSYNKTYG 283

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            LA  +  L++LY+     +LGAE+NA       R
Sbjct: 284 ALAGAVVLLLWLYLTSYIVLLGAEINAESERQTAR 318


>gi|229154172|ref|ZP_04282296.1| YihY [Bacillus cereus ATCC 4342]
 gi|228629308|gb|EEK86011.1| YihY [Bacillus cereus ATCC 4342]
          Length = 289

 Score =  159 bits (401), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 72/270 (26%), Positives = 126/270 (46%), Gaps = 2/270 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
             +    D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++
Sbjct: 12  RTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLL 69

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               PE     I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E R
Sbjct: 70  EPYVPEDAMSLIEVNVDKVVNQQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETR 129

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+  TR +S  + L     +V    V V   +  A V K      +   +    R+ A+ 
Sbjct: 130 SFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASF 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             LF    F++ F P  K K   ++ G  F  + W+V +  F +Y+  F+ Y+  Y GL 
Sbjct: 190 FVLFALFSFLYTFAPDRKLKRKEVISGATFATVGWIVVSYSFAYYVDKFANYANTYGGLG 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            I+  +++ Y+ G   +LG E+N  +  Y 
Sbjct: 250 GIIILMLWFYLTGWVILLGGEINGLLHHYR 279


>gi|209544202|ref|YP_002276431.1| ribonuclease BN [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531879|gb|ACI51816.1| ribonuclease BN [Gluconacetobacter diazotrophicus PAl 5]
          Length = 321

 Score =  159 bits (401), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 59/281 (20%), Positives = 120/281 (42%), Gaps = 8/281 (2%)

Query: 2   REYFCIVFD-IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           R     ++  ++     +   +     A+  +  A LS+FP I    ++ G +     V 
Sbjct: 22  RPMLRQMWKPVLGRMARNLSSDQITLAAAGCAFYATLSLFPAISTLISIYGLMFDPDTVE 81

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLN 117
             +DV+    P      I + I  ++A P   L     L      + +S    ++  ++N
Sbjct: 82  PQMDVLRHLLPPSAFTLIDERIHTLVAEPHSSLTLNLILSTTITLWSASAATRSIISAVN 141

Query: 118 RAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPA---LGNLL 174
            AY   E R +    L++ G  L A    V+   V VA+P+ + +V           ++ 
Sbjct: 142 IAYDTRETRGFVQFHLMALGMTLCAICGAVLTLSVLVALPVLIDFVPARLGLAPPPWSVE 201

Query: 175 LIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIV 233
           L++  G     +L +      ++ F P  +    + ILPG     + W+V ++ F++Y+ 
Sbjct: 202 LLVQTGGPALMLLFVLAACSLLYRFSPNRRIVHWICILPGSCTATLIWIVSSIGFSYYVS 261

Query: 234 TFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMII 274
           T ++Y+  Y  L +++  +++ ++     +LGAELNA +  
Sbjct: 262 TIASYNATYGPLGAVVATMMWFFVTAYVILLGAELNAGLEA 302


>gi|118476162|ref|YP_893313.1| ribonuclease BN [Bacillus thuringiensis str. Al Hakam]
 gi|196045195|ref|ZP_03112427.1| YihY family protein [Bacillus cereus 03BB108]
 gi|225862450|ref|YP_002747828.1| YihY family protein [Bacillus cereus 03BB102]
 gi|229182794|ref|ZP_04310033.1| YihY [Bacillus cereus BGSC 6E1]
 gi|118415387|gb|ABK83806.1| ribonuclease BN [Bacillus thuringiensis str. Al Hakam]
 gi|196023779|gb|EDX62454.1| YihY family protein [Bacillus cereus 03BB108]
 gi|225790204|gb|ACO30421.1| YihY family protein [Bacillus cereus 03BB102]
 gi|228600674|gb|EEK58255.1| YihY [Bacillus cereus BGSC 6E1]
          Length = 289

 Score =  159 bits (401), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 72/270 (26%), Positives = 126/270 (46%), Gaps = 2/270 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
             +    D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++
Sbjct: 12  RTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLL 69

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               PE     I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E R
Sbjct: 70  EPYVPEDAMSLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETR 129

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+  TR +S  + L     +V    V V   +  A V K      +   +    R+ A+ 
Sbjct: 130 SFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASF 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             LF    F++ F P  K K   ++ G  F  + W+V +  F +Y+  F+ Y+  Y GL 
Sbjct: 190 FVLFALFSFIYTFAPDRKLKRREVISGATFATVGWIVVSYSFAYYVDKFANYANTYGGLG 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            I+  +++ Y+ G   +LG E+N  +  Y 
Sbjct: 250 GIIILMLWFYLTGWVILLGGEINGLLHHYR 279


>gi|228989594|ref|ZP_04149578.1| YihY [Bacillus pseudomycoides DSM 12442]
 gi|228770131|gb|EEM18711.1| YihY [Bacillus pseudomycoides DSM 12442]
          Length = 289

 Score =  158 bits (400), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 73/275 (26%), Positives = 126/275 (45%), Gaps = 2/275 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +     V+    D  +  + +D   +A+ ++   LL++FP +VF   L GF+        
Sbjct: 7   KARGNRVYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIPIQ--TED 64

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           V+ ++    PE     I   + +V+     GL +   L+  +F+SNGV A+  + NRAY 
Sbjct: 65  VLSLLEAYVPEDAMNLIEVNVDKVVNEQNGGLLSFGLLSTLWFASNGVNAVMNAFNRAYD 124

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E RS+  TR +S    L     +V    V V   +  A V K      +   +    R
Sbjct: 125 VKETRSFIATRALSIVLTLAMIFMIVFALIVPVFGQVIGAAVFKALGLSESFSFVWSIIR 184

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
           + A+ L LF    F++ F P  K K   ++ G +F  + W+V +  F +Y+  F+ Y+  
Sbjct: 185 LVASFLVLFALFSFLYTFAPDRKLKRREVISGALFATVGWIVVSYSFAYYVDKFANYANT 244

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           Y GL  I+  +++ Y+     +LG E+N  +  Y 
Sbjct: 245 YGGLGGIIILMLWFYLTAWVILLGGEINGLLHFYR 279


>gi|229028258|ref|ZP_04184396.1| YihY [Bacillus cereus AH1271]
 gi|228733064|gb|EEL83908.1| YihY [Bacillus cereus AH1271]
          Length = 289

 Score =  158 bits (400), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 72/270 (26%), Positives = 126/270 (46%), Gaps = 2/270 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
             +    D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++
Sbjct: 12  RTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLL 69

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               PE     I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E R
Sbjct: 70  EPYVPEDAMSLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETR 129

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+  TR +S  + L     +V    V V   +  A V K      +   +    R+ A+ 
Sbjct: 130 SFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSIMRLVASF 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             LF    F++ F P  K K   ++ G  F  + W+V +  F +Y+  F+ Y+  Y GL 
Sbjct: 190 FVLFALFSFLYTFAPDRKLKRREVISGATFATVGWIVVSYSFAYYVDKFANYANTYGGLG 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            I+  +++ Y+ G   +LG E+N  +  Y 
Sbjct: 250 GIIILMLWFYLTGWVILLGGEINGLLHHYR 279


>gi|332284550|ref|YP_004416461.1| ribonuclease [Pusillimonas sp. T7-7]
 gi|330428503|gb|AEC19837.1| ribonuclease [Pusillimonas sp. T7-7]
          Length = 468

 Score =  158 bits (400), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 50/276 (18%), Positives = 98/276 (35%), Gaps = 7/276 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH-QFVPTVI 63
                 I   A++   E+    +AS ++ + +LS+ P +     L         F   + 
Sbjct: 42  LRNFRKIARFALQRAAEKKLTQVASSLTFTTVLSIVPLLAVVLALFTAFPLFGDFQLALE 101

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
           D +                L   A  A GL     L     S      +  + N  ++V 
Sbjct: 102 DFLTRNLMPPSVSDNAMLYLNQFAAKASGLTAAGTLFLIVTSVMLFMTIDQAFNSIWQVE 161

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
             R      L+ +  + L  V +    +    +       R+    +  L  +I     +
Sbjct: 162 RQRPLRQRMLVYWAIISLGPVLIGASLWATSVL------ARESLGDVNELPALIGFALSF 215

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
             MLA  +G   + + +P  K      L G   T I   +  + F +Y+  F +Y+ +Y 
Sbjct: 216 VPMLATGLGFTALFVTVPNRKVLWKDALTGGFGTAIVLEIMRIGFAYYLTRFPSYTVIYG 275

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             A++   L++LY+  +  +LGA + + +     R+
Sbjct: 276 AFATLPIFLLWLYLSWLVVLLGATVASILPDLRMRR 311


>gi|163938399|ref|YP_001643283.1| putative ribonuclease BN [Bacillus weihenstephanensis KBAB4]
 gi|229056246|ref|ZP_04195667.1| YihY [Bacillus cereus AH603]
 gi|163860596|gb|ABY41655.1| putative ribonuclease BN [Bacillus weihenstephanensis KBAB4]
 gi|228721051|gb|EEL72589.1| YihY [Bacillus cereus AH603]
          Length = 289

 Score =  158 bits (400), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 74/281 (26%), Positives = 129/281 (45%), Gaps = 7/281 (2%)

Query: 1   MREYF-----CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA 55
           MR++         F    D  +  + +D   +A+ ++   LL++FP +VF   L GF+  
Sbjct: 1   MRKFLEKAKRNRTFSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDL 60

Query: 56  HQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRIS 115
                +V++++    PE     I   + +V+     GL +   L+  +F+SNGV A+  +
Sbjct: 61  Q--TESVLNLLEPYVPEDAMNLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNA 118

Query: 116 LNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLL 175
            NRAY V E RS+  TR +S  + L     +V    V V   +  A V K      +   
Sbjct: 119 FNRAYDVTETRSFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSY 178

Query: 176 IIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF 235
           +    R+ A+   L     F++ F P  K K   ++ G IF  + W+V +  F +Y+  F
Sbjct: 179 VWSITRLVASFFVLIALFSFLYTFAPDRKLKRREVISGAIFATVGWIVVSYSFAYYVDKF 238

Query: 236 STYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           + Y+  Y GL  I+  +++ Y+     +LG E+N  +  Y 
Sbjct: 239 ANYANTYGGLGGIIILMLWFYLTAWVILLGGEINGLLHHYR 279


>gi|111224904|ref|YP_715698.1| hypothetical protein FRAAL5539 [Frankia alni ACN14a]
 gi|111152436|emb|CAJ64172.1| Putative membrane protein (partial) [Frankia alni ACN14a]
          Length = 388

 Score =  158 bits (400), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 44/267 (16%), Positives = 99/267 (37%), Gaps = 4/267 (1%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
              F ++   +  F+++D    A+ ++  A+L++FP  +        L        ++D 
Sbjct: 84  RSWFGVLRRTVREFMDDDLPDRAAALTYYAVLAIFPA-LLVLVSLVGLLGRSTTDRLLDN 142

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVV 123
           +    P      + + +  +      G  +  I    A + +S  + A   + N  Y + 
Sbjct: 143 IEQLTPGAARDILHNAVNGLRDSAGSGGVVAIIGLAGALWSASGYIAAFIRAANAVYDMP 202

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R  +    +     +   V L + S + V                   +      +  
Sbjct: 203 EGRPVWKIAPLRLLITITLVVLLAVSSVIVVFSGALAEQAGTAIGLGHEAITAWSFAKWP 262

Query: 184 ATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
             +L +   +  ++   P  +      + PG +   + W+V +  F  Y+ TF +Y+  Y
Sbjct: 263 VLVLIVTAVIALLYWSTPNVRPHGFRWLTPGSVLAVVIWLVASGAFAFYVATFGSYNKTY 322

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELN 269
             LA ++  LV+L++  +  +LG E +
Sbjct: 323 GTLAGVIVFLVWLWLSNLAILLGLEFD 349


>gi|170747781|ref|YP_001754041.1| ribonuclease BN [Methylobacterium radiotolerans JCM 2831]
 gi|170654303|gb|ACB23358.1| ribonuclease BN [Methylobacterium radiotolerans JCM 2831]
          Length = 406

 Score =  158 bits (400), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 50/270 (18%), Positives = 117/270 (43%), Gaps = 9/270 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI   A     E     +A+ ++   LL++FP +    +  G +     +   +  + G 
Sbjct: 113 DIALRAYHDVGENRLSLIAAGVTFFTLLAIFPAVAALVSCYGLVADASTINDQLASLQGI 172

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLNRAYRVVEMR 126
            P+   + + D++ ++       L     +    + + ++ GV+ +  +LN  Y   E R
Sbjct: 173 LPQGALEIVGDQVKRLNEQGNTTLGFSLLISIALSVWSANGGVKHVFDALNLVYNEREKR 232

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           ++ +  L+S  +   A + L++         + +  V   F  LG     +   R    +
Sbjct: 233 NFLVLNLVSLAFTAGALLFLLLAL-----AAVVVVPVVLDFVGLGADAWWLALLRWPVLL 287

Query: 187 LALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +A+ +GL  ++ + P+    +   + PG     + W+V ++LF+ Y+  F +Y+  Y  L
Sbjct: 288 VAVLLGLALLYRYGPSRDAPRWRWVTPGGALAALLWIVASLLFSWYVAHFGSYNKTYGSL 347

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            + +  + ++++  +  + GA++NA M   
Sbjct: 348 GAAIGFMTWIWLSTMIVLTGAQVNAEMEHQ 377


>gi|228995781|ref|ZP_04155441.1| YihY [Bacillus mycoides Rock3-17]
 gi|229003401|ref|ZP_04161222.1| YihY [Bacillus mycoides Rock1-4]
 gi|228757849|gb|EEM07073.1| YihY [Bacillus mycoides Rock1-4]
 gi|228763942|gb|EEM12829.1| YihY [Bacillus mycoides Rock3-17]
          Length = 289

 Score =  158 bits (399), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 73/275 (26%), Positives = 126/275 (45%), Gaps = 2/275 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +     V+    D  +  + +D   +A+ ++   LL++FP +VF   L GF+        
Sbjct: 7   KARGNRVYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIPIQ--TED 64

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           V+ ++    PE     I   + +V+     GL +   L+  +F+SNGV A+  + NRAY 
Sbjct: 65  VLSLLEAYVPEDAMNLIEVNVDKVVNEQNGGLLSFGLLSTLWFASNGVNAVMNAFNRAYD 124

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E RS+  TR +S    L     +V    V V   +  A V K      +   +    R
Sbjct: 125 VKETRSFIATRALSIVLTLAMIFMIVFALIVPVFGQVIGAAVFKALGLSESFSFVWSIIR 184

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
           + A+ L LF    F++ F P  K K   ++ G +F  + W+V +  F +Y+  F+ Y+  
Sbjct: 185 LVASFLVLFALFSFLYTFAPDRKLKRREVISGALFATVGWIVVSYSFAYYVDKFANYANT 244

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           Y GL  I+  +++ Y+     +LG E+N  +  Y 
Sbjct: 245 YGGLGGIIILMLWFYLTAWVILLGGEINGLLHFYR 279


>gi|89097736|ref|ZP_01170624.1| hypothetical protein B14911_15112 [Bacillus sp. NRRL B-14911]
 gi|89087595|gb|EAR66708.1| hypothetical protein B14911_15112 [Bacillus sp. NRRL B-14911]
          Length = 286

 Score =  158 bits (399), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 53/271 (19%), Positives = 118/271 (43%), Gaps = 2/271 (0%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
             +   +    +   ++    +A+  +   +LS+FP ++   ++  +L         I  
Sbjct: 2   KKMIAYLKKLGKEIKDDRATGLAAEQAYYYMLSIFPILILLLSIVPYLNIDP--QKAISF 59

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           +    P   A    + ++ ++  P+ GL T   +   + +SNG++A   ++N+A+ V E 
Sbjct: 60  LQTVMPSETAAVFEENVVNIVTQPSGGLLTFGIIGTLWSASNGMQAFIRAMNQAFDVEET 119

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           RS+   RLIS G  L    +L++   + V   + L  V+ F      + ++    R    
Sbjct: 120 RSFIKARLISIGLTLGLIFSLIVALVLPVFGNVILDLVQSFINIPDEMQILFSVLRWVVA 179

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           ++ +   L  ++   P        ++PG +   + W + ++  + YI  F+ YS  Y  L
Sbjct: 180 IIVIAAVLSVLYKLAPNKHYPFKHVIPGAVAATVIWQLISLGLSIYIGNFANYSGTYGSL 239

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             ++  +++ Y+ G+  ++G E+NA      
Sbjct: 240 GGVIVLMLWFYLTGLTLVVGGEINAIYHRER 270


>gi|27382587|ref|NP_774116.1| hypothetical protein blr7476 [Bradyrhizobium japonicum USDA 110]
 gi|27355759|dbj|BAC52741.1| blr7476 [Bradyrhizobium japonicum USDA 110]
          Length = 376

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 59/273 (21%), Positives = 116/273 (42%), Gaps = 8/273 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI +   +   ++   A A  +    LL++FP +    +  G       +   +  +   
Sbjct: 81  DIFWRTYQRIDDDRLLATAGGVVFFGLLAIFPAVTALVSSYGLFADPSTISANLQTLATM 140

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTI---SALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            PE   + + D++ +V++     L        L A + ++ GV+++  +LN AY   E R
Sbjct: 141 LPEGSFQIVEDQVARVVSKGNTTLGVTFLLGLLLAIWSANAGVKSIFDALNVAYEEREKR 200

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+     +S  +     V L++M    VA PLAL              LI+   R     
Sbjct: 201 SFIRLNSVSLAFTAGGIVALLLMVGAVVAFPLAL----DHLGLAPESKLIVALARWPLLF 256

Query: 187 LALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           L L + L  ++ F P+    +   +  G +   + W+ G+ L + Y+  F+ Y+  Y  L
Sbjct: 257 LILLVALAILYRFAPSRDAPRWQWLSLGAVAAALLWIAGSALLSWYLSEFANYNATYGSL 316

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            + +  +++++M  +  + GAELN+ +     R
Sbjct: 317 GAAIGLMMWMWMSAIVIMFGAELNSEIERQTLR 349


>gi|229009893|ref|ZP_04167112.1| YihY [Bacillus mycoides DSM 2048]
 gi|228751324|gb|EEM01131.1| YihY [Bacillus mycoides DSM 2048]
          Length = 289

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 74/281 (26%), Positives = 128/281 (45%), Gaps = 7/281 (2%)

Query: 1   MREYF-----CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA 55
           MR++         F    D  +  + +D   +A+ ++   LL++FP +VF   L GF+  
Sbjct: 1   MRKFLEKAKRNRTFSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIPI 60

Query: 56  HQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRIS 115
                 V+ ++    P+     I   + +V+     GL +   L+  +F+SNGV A+  +
Sbjct: 61  Q--TEDVLSLLEVYVPDDAMNLIEVNVDKVVNQQNGGLLSFGLLSMLWFASNGVNAVMNA 118

Query: 116 LNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLL 175
            NRAY V E RS+  TR +S  + L     +V    V V   +  A V K      +   
Sbjct: 119 FNRAYDVTETRSFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSY 178

Query: 176 IIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF 235
           +    R+ A+   L     F++ F P  K K   ++ G +F  I W+V +  F +Y+  F
Sbjct: 179 VWSITRLVASFFVLIALFSFLYTFAPDRKLKRREVVSGALFATIGWIVVSYSFAYYVDKF 238

Query: 236 STYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           + Y+  Y GL  I+  +++ Y+ G   +LG E+N  +  Y 
Sbjct: 239 ANYANTYGGLGGIIILMLWFYLTGWVILLGGEINGLLHHYR 279


>gi|229131406|ref|ZP_04260303.1| YihY [Bacillus cereus BDRD-ST196]
 gi|228652052|gb|EEL07992.1| YihY [Bacillus cereus BDRD-ST196]
          Length = 289

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 72/270 (26%), Positives = 125/270 (46%), Gaps = 2/270 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
             F    D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++
Sbjct: 12  RTFSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLL 69

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               PE     I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E R
Sbjct: 70  EPYVPEDAMNLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETR 129

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+  TR +S  + L     +V    V V   +  A V K      +   +    R+ A+ 
Sbjct: 130 SFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASF 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             L     F++ F P  K K   ++ G IF  + W+V +  F +Y+  F+ Y+  Y GL 
Sbjct: 190 FVLIALFSFLYTFAPDRKLKRREVISGAIFATVGWIVVSYSFAYYVDKFANYANTYGGLG 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            I+  +++ Y+     +LG E+N  +  Y 
Sbjct: 250 GIIILMLWFYLTAWVILLGGEINGLLHHYR 279


>gi|152974229|ref|YP_001373746.1| putative ribonuclease BN [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|152022981|gb|ABS20751.1| putative ribonuclease BN [Bacillus cytotoxicus NVH 391-98]
          Length = 289

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 74/275 (26%), Positives = 129/275 (46%), Gaps = 2/275 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +     V+    D  +  + +D   +A+ ++   LL++FP +VF   L GF+        
Sbjct: 7   KARGNRVYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFVITLLGFIDLQ--TEN 64

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           V++++    PE     I   + QV+     GL +   L+  +F+SNGV A+  + NRAY 
Sbjct: 65  VLNLLEPYVPEEAMNLIEVNVDQVINNQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYD 124

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E RS+ +TR +S  + L     +V    V V   +  A V K      +   +    R
Sbjct: 125 VKETRSFIVTRALSIVFTLAMIFMIVFALIVPVFGQVIGAAVFKVLGLSESFSFVWSIIR 184

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
           + A+ L LF    F++ F P  K K   ++ G +F  + W+V +  F +Y+  F+ Y+  
Sbjct: 185 LVASFLVLFALFSFLYTFAPDRKLKRREVISGALFATVGWIVVSYSFAYYVDKFANYANT 244

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           Y GL  I+  +++ Y+     +LG E+N  +  Y 
Sbjct: 245 YGGLGGIIILMLWFYLTAWVILLGGEINGLLYFYR 279


>gi|229171254|ref|ZP_04298844.1| YihY [Bacillus cereus MM3]
 gi|228612211|gb|EEK69443.1| YihY [Bacillus cereus MM3]
          Length = 289

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 72/270 (26%), Positives = 127/270 (47%), Gaps = 2/270 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
             +    D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++
Sbjct: 12  RTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLL 69

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               PE     I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E R
Sbjct: 70  EPYVPEDAMSLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETR 129

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+  TR +S  + L     +V    V V   +  A V K      +   +    R+ A+ 
Sbjct: 130 SFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASF 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             LF    F++ F P  K K   ++ G IF  + W++ +  F +Y+  F+ Y+  Y GL 
Sbjct: 190 FVLFALFSFLYTFAPDRKLKRREVISGAIFATVGWIMVSYSFAYYVDKFANYANTYGGLG 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            I+  +++ Y+ G   +LG E+N  +  Y 
Sbjct: 250 GIIILMLWFYLTGWVILLGGEINGLLHHYR 279


>gi|269795024|ref|YP_003314479.1| hypothetical protein Sked_17180 [Sanguibacter keddieii DSM 10542]
 gi|269097209|gb|ACZ21645.1| predicted membrane protein [Sanguibacter keddieii DSM 10542]
          Length = 381

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 47/271 (17%), Positives = 104/271 (38%), Gaps = 4/271 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH-QFVPTVIDVVFGA 69
           ++      F  +    +A+ ++  A+L+  P ++   ++ G +G     V  V+ +V   
Sbjct: 35  VLRSTARQFTRDQCLDLAAALTYYAVLASAPALLALVSILGLVGDGGALVEDVLGIVSSV 94

Query: 70  WPEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
            P      +   + QV +  +       I    A + +S  V A   +LNR Y + E R 
Sbjct: 95  LPAETMATVEPLVDQVASQSSGAGLALVIGLAGALWSASGYVGAFGRALNRVYEIEEGRP 154

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            +  R  +    L+ +V   ++    V        V          L +    +    +L
Sbjct: 155 VWKLRPANLLITLVVAVGAALVVVALVLSGGVAQAVGDTIGLGSVALTVWSVAKWPVVLL 214

Query: 188 ALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
            +   +  ++   P  +      +  G +   + W V +  F  Y+ T  +Y + Y  L 
Sbjct: 215 VVIGMVALLYHSTPNVRQPRFRWLSVGALVAILVWAVASAGFGVYVATLGSYGSTYGTLG 274

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           +++  L++L++  +  + GAEL++ +     
Sbjct: 275 TVIVFLLWLWITNLALLFGAELDSELERGRE 305


>gi|162147146|ref|YP_001601607.1| ribonuclease protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785723|emb|CAP55294.1| putative ribonuclease protein [Gluconacetobacter diazotrophicus PAl
           5]
          Length = 321

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 59/281 (20%), Positives = 120/281 (42%), Gaps = 8/281 (2%)

Query: 2   REYFCIVFD-IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           R     ++  ++     +   +     A+  +  A LS+FP I    ++ G +     V 
Sbjct: 22  RSMLRQMWKPVLGRMARNLSSDQITLAAAGCAFYATLSLFPAISTLISIYGLMFDPDTVE 81

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLN 117
             +DV+    P      I + I  ++A P   L     L      + +S    ++  ++N
Sbjct: 82  PQMDVLRHLLPPSAFTLIDERIHTLVAEPHSSLTLNLILSTTITLWSASAATRSIISAVN 141

Query: 118 RAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPA---LGNLL 174
            AY   E R +    L++ G  L A    V+   V VA+P+ + +V           ++ 
Sbjct: 142 IAYDTRETRGFVQFHLMALGMTLCAICGAVLTLSVLVALPVLIDFVPARLGLAPPPWSVE 201

Query: 175 LIIWNGRIYATMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIV 233
           L++  G     +L +      ++ F P  +    + ILPG     + W+V ++ F++Y+ 
Sbjct: 202 LLVQTGGPALMLLFVLAACSLLYRFSPNRRIVHWICILPGSCTATLIWIVSSIGFSYYVS 261

Query: 234 TFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMII 274
           T ++Y+  Y  L +++  +++ ++     +LGAELNA +  
Sbjct: 262 TIASYNATYGPLGAVVATMMWFFVTAYVILLGAELNAGLEA 302


>gi|220923045|ref|YP_002498347.1| ribonuclease BN [Methylobacterium nodulans ORS 2060]
 gi|219947652|gb|ACL58044.1| ribonuclease BN [Methylobacterium nodulans ORS 2060]
          Length = 347

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 62/273 (22%), Positives = 126/273 (46%), Gaps = 8/273 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI++       ++   A A  ++  ALL+VFP +    +L G +     +   + ++ G 
Sbjct: 53  DIVWRVFWSLPQDRVLATAGGVAFFALLAVFPGLATIVSLYGLVADPSVIYQHLSLLTGV 112

Query: 70  WPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P  +   +  E+ ++    A  L     +S L A + +++GV AL  +LN  Y+  E R
Sbjct: 113 LPSGVLDLLASELTRITKQGAGTLSTTSVLSLLIAFWSANSGVSALFDALNVIYKEREKR 172

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           +       +  + L + V  +I + + VA+P+ L  +        +    +   R  A +
Sbjct: 173 TLVRFYGTTLLFTLSSVVFALIATGMVVAMPIILNQI----GLRSSADAALRLVRWPALL 228

Query: 187 LALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           + + +GL  ++ + P+ + +K   +  G     + WV  + LF+ Y+ +F +Y+  Y  L
Sbjct: 229 VVVSLGLSAIYRYGPSRREAKWRWVTWGSSVAALLWVCASALFSWYVASFDSYNRTYGSL 288

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            + +  + ++++  V  +LGAELNA M     R
Sbjct: 289 GAGVGFMTWIWLSVVIVLLGAELNAEMERQTAR 321


>gi|229015792|ref|ZP_04172770.1| YihY [Bacillus cereus AH1273]
 gi|229022000|ref|ZP_04178557.1| YihY [Bacillus cereus AH1272]
 gi|228739306|gb|EEL89745.1| YihY [Bacillus cereus AH1272]
 gi|228745508|gb|EEL95532.1| YihY [Bacillus cereus AH1273]
          Length = 289

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 73/270 (27%), Positives = 127/270 (47%), Gaps = 2/270 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
             F    D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++
Sbjct: 12  RTFSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLL 69

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               PE     I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E R
Sbjct: 70  EPYVPEDAMNLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETR 129

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+  TR +S  + L     +V    V V   +  A V K      +   +    R+ A+ 
Sbjct: 130 SFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASF 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             LF    F++ F P  K K   ++ G +F  + W+V +  F +Y+  F+ Y+  Y GL 
Sbjct: 190 FVLFALFSFLYTFAPDRKLKRREVISGALFATVGWIVVSYSFAYYVDKFANYANTYGGLG 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            I+  +++ Y+ G   +LG E+N  +  Y 
Sbjct: 250 GIIILMLWFYLTGWVILLGGEINGLLHHYR 279


>gi|167035062|ref|YP_001670293.1| ribonuclease BN [Pseudomonas putida GB-1]
 gi|166861550|gb|ABY99957.1| ribonuclease BN [Pseudomonas putida GB-1]
          Length = 319

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 62/273 (22%), Positives = 126/273 (46%), Gaps = 1/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +  ++   ++ F++++    AS ++  AL S+FPF++F   L GFL    F   +     
Sbjct: 11  LHRVLVRTVKEFLDDEMSTYASALAYQALFSLFPFLLFLIALIGFLHLPDFFSWLRLQSE 70

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P    + +   I Q+      GL ++  + A + +S GV  +  ++N AY V E R 
Sbjct: 71  LVLPPQALEQVNPVIDQLQQSK-GGLLSVGIVIALWTASAGVRLMMSAMNAAYDVPEGRP 129

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            +    +S  Y +  +  L+  + + V  P  + ++         ++ +    R    ++
Sbjct: 130 VWKRIPLSIFYTVGLAGMLLAAAALMVLGPQVMEWIAAQIGMQEFIVTLWTILRWPVIII 189

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            L + +  ++  +P  K K   I PG +   + W+V ++ F +Y+ TF+ Y+ MY  + +
Sbjct: 190 LLMVAVALIYYVMPDVKQKFRFITPGSVLAVVVWIVASLGFAYYVKTFADYNAMYGSIGA 249

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  L++ Y+     +LGAE+NA +       K
Sbjct: 250 IIVLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|228906214|ref|ZP_04070101.1| YihY [Bacillus thuringiensis IBL 200]
 gi|228919337|ref|ZP_04082707.1| YihY [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228956886|ref|ZP_04118667.1| YihY [Bacillus thuringiensis serovar pakistani str. T13001]
 gi|228963518|ref|ZP_04124675.1| YihY [Bacillus thuringiensis serovar sotto str. T04001]
 gi|228796212|gb|EEM43663.1| YihY [Bacillus thuringiensis serovar sotto str. T04001]
 gi|228802729|gb|EEM49565.1| YihY [Bacillus thuringiensis serovar pakistani str. T13001]
 gi|228840444|gb|EEM85715.1| YihY [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228853370|gb|EEM98140.1| YihY [Bacillus thuringiensis IBL 200]
          Length = 289

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 71/270 (26%), Positives = 125/270 (46%), Gaps = 2/270 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
             +    D  +  + +D   +A+ ++   LL++FP +VF   L GF+        V+ ++
Sbjct: 12  RTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIPIQ--TEDVLSLL 69

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               P+     I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E R
Sbjct: 70  EVYVPDDAMNLIEVNVDKVVNQQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVKETR 129

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+  TR +S  + L     +V    V V   +  A V K      +   +    R+ A+ 
Sbjct: 130 SFITTRALSIVFTLAIIFMIVFALIVPVFGQVIGAAVFKALGLSDSFSFVWSITRLVASF 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             LF    F++ F P  K K   ++ G +F  + W+V +  F +Y+  F+ Y+  Y GL 
Sbjct: 190 FVLFALFSFLYTFAPDRKLKRREVISGALFATVGWIVVSYSFAYYVDKFANYANTYGGLG 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            I+  +++ Y+ G   +LG E+N  +  Y 
Sbjct: 250 GIIILMLWFYLTGWVILLGGEINGLLHHYR 279


>gi|300741768|ref|ZP_07071789.1| YihY family protein [Rothia dentocariosa M567]
 gi|300380953|gb|EFJ77515.1| YihY family protein [Rothia dentocariosa M567]
          Length = 431

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 57/272 (20%), Positives = 110/272 (40%), Gaps = 5/272 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVVFGA 69
           I   A   F    G  +A+ ++   +LS FP ++   +L G  G        +++ +   
Sbjct: 28  IFRRAGFSFGAHGGTDLAAALTYFTVLSAFPALLAILSLLGIFGQGEDSAKVILEFLQER 87

Query: 70  WPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            P+ +   +   I Q+      G    I  L+A + +S  V +   +LN  Y V E R  
Sbjct: 88  APQQMYSILEGPIHQLTNGQGAGFALIIGILSALWSASGYVGSFGRALNNVYGVREGRPA 147

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPA--LGNLLLIIWNGRIYATM 186
           ++    +        V +V+M  +F+     L +V  + P   +  + ++  NGR    +
Sbjct: 148 WLLIPYNVFVTTGVIVLVVLMMLMFLLGASVLDWVAPYMPGVDIELIKVLWLNGRWVLIL 207

Query: 187 LALFIGLIFVHLFLPA-AKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +     +  ++   P   + KI    PG +       +G + FT Y   FS Y+  Y  +
Sbjct: 208 ILAVFLIAMLYTATPNVRRLKIRWTSPGAVIALFGMGLGGLGFTIYTNNFSKYNATYGLI 267

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
             ++  LVFL+++    + GA ++A       
Sbjct: 268 GGVIVMLVFLWIMNNMLVFGAHVDAEFERMRQ 299


>gi|226950854|ref|YP_002805945.1| YihY family protein [Clostridium botulinum A2 str. Kyoto]
 gi|226843946|gb|ACO86612.1| YihY family protein [Clostridium botulinum A2 str. Kyoto]
 gi|322807727|emb|CBZ05302.1| ribonuclease BN [Clostridium botulinum H04402 065]
          Length = 285

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 64/277 (23%), Positives = 129/277 (46%), Gaps = 2/277 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +  F I+   I      F+E++  A++S ++ + ++SVFPF++F   L G+L  H     
Sbjct: 3   KNLFKIIPKSIKKLANRFLEDEVLALSSQLAYALIISVFPFLMFVITLIGYLPIHS--ED 60

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           ++  +    P      + + I +++      L + S +   + +S G  A+   LNRAY 
Sbjct: 61  LLLGLKEIMPSNTYLLLKNTIEEIIYTQNGNLLSFSIIFTIWTASAGFRAVVRGLNRAYD 120

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E RS+   ++++    L  +  LV+  F+ V        +            I    R
Sbjct: 121 VKERRSFVKVQIMTIFCTLGMAFVLVMSIFLLVFGKTIGRTLVYKLGFSLEFNRIWNLIR 180

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
               +      L  ++ + P+ + +   +LPG IF  I+W++ ++ F+ Y+  F+ YS +
Sbjct: 181 YIIMIGVTIFILAALYYYTPSKRLRWRDVLPGAIFATIAWIIASMGFSFYVDNFNNYSRL 240

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           Y  + +++  LV+LY+  +  I G E+NA ++    +
Sbjct: 241 YGSIGAVIVFLVWLYLTSIIVITGGEINALLVSSREK 277


>gi|254560152|ref|YP_003067247.1| hypothetical protein METDI1672 [Methylobacterium extorquens DM4]
 gi|254267430|emb|CAX23269.1| conserved hypothetical protein; putative Ribonuclease BN domain
           [Methylobacterium extorquens DM4]
          Length = 347

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 66/275 (24%), Positives = 131/275 (47%), Gaps = 8/275 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
             DI++  +     +   A A  ++  ALL+VFP +V   +L G     + +   + ++ 
Sbjct: 51  WRDILWRVVLSLQRDRVLATAGGVAFFALLAVFPALVTIVSLYGLFSDPKAIGQHLSLLA 110

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLNRAYRVVE 124
           G  P  +   ++++++++       L T S L    A + +++GV AL  +LN  YR  E
Sbjct: 111 GVLPNGVLDLLSEQLVRIARQSTGALSTASLLSMIIAFWSANSGVSALFDALNVIYRERE 170

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            RS     + +F + L   V ++  + + V +P+ L  +       G     +   R  A
Sbjct: 171 KRSLVGFYVTTFLFTLTGIVFVLASTGMVVILPIVLNRI----GLGGLADTALRILRWPA 226

Query: 185 TMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            +L + + L   + + P+ + +K   +  G +   +SWV  +VLF+ Y+ +F +Y+ +Y 
Sbjct: 227 LLLLVSMSLSLTYRYGPSRREAKWRWVSWGSVAASLSWVCTSVLFSWYVASFDSYNRVYG 286

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            L + +  + ++++  V  +LGAELNA M     R
Sbjct: 287 SLGAGVGFMTWIWLSVVIVLLGAELNAEMERQTAR 321


>gi|115372638|ref|ZP_01459945.1| ribonuclease BN [Stigmatella aurantiaca DW4/3-1]
 gi|310823830|ref|YP_003956188.1| ribonuclease bn family protein [Stigmatella aurantiaca DW4/3-1]
 gi|115370359|gb|EAU69287.1| ribonuclease BN [Stigmatella aurantiaca DW4/3-1]
 gi|309396902|gb|ADO74361.1| Ribonuclease BN family protein [Stigmatella aurantiaca DW4/3-1]
          Length = 349

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 68/274 (24%), Positives = 120/274 (43%), Gaps = 1/274 (0%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG-AHQFV 59
           ++       +     I+ F E+     A+ +S   L S+FP + F   LA +L  A   V
Sbjct: 4   LKLKHLSWREFGRRFIKEFQEDTATDCAAQLSYYFLFSLFPLLFFLVTLAAYLPFAPGTV 63

Query: 60  PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             ++  +    P      I + +  ++  P   L T+  L A + +S GV+ALR +LN A
Sbjct: 64  EAMLQRIAPLVPGDALSLIDEHLRSLVNQPRPKLLTLGFLVALWSASRGVDALRKALNLA 123

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           Y V E R  + T+ ++    L+ ++ L +   VF+       +  +    +    L    
Sbjct: 124 YDVPESRPVWKTQGVAMLMTLVGTLLLPLSFTVFLLGGRVGQWFAERLQLIDAFHLFWSW 183

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
            R   T   + + L   +  LP  K +   I PG +   + W+V    FT Y+  F  Y+
Sbjct: 184 LRWPFTASLVMLMLALCYYVLPDVKQRFKYITPGSVLGTVLWLVSTWGFTQYVDEFGNYN 243

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
             Y  +  ++  L +LY+ G+ FI+G E+NA + 
Sbjct: 244 VTYGSIGGVVVLLTWLYISGLIFIVGGEVNAILE 277


>gi|291302773|ref|YP_003514051.1| ribonuclease BN [Stackebrandtia nassauensis DSM 44728]
 gi|290571993|gb|ADD44958.1| ribonuclease BN [Stackebrandtia nassauensis DSM 44728]
          Length = 301

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 57/271 (21%), Positives = 108/271 (39%), Gaps = 5/271 (1%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
           +   I+ F  ++    A+ ++   +LS+FP ++  A+L G  G        +  V    P
Sbjct: 11  LKRTIKEFNADNLTDAAAALTYYGVLSIFPGLLVLASLMGLFGQSATTS--MKDVTAVAP 68

Query: 72  EVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
             +   +TD    V A PA    +  +  LAA + +S  + A   + N  Y V E R  +
Sbjct: 69  GPVRDILTDATTGVAAQPATAGVMAIVGLLAALWAASGYIGAFMRASNVVYDVPEGRPIW 128

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
            T  +     +   V LV  + + V        V +        + +    +    ++ +
Sbjct: 129 KTLPLRLAVTICVGVLLVASALIVVLTGQLAGTVGELLGVGATAVTVWDIAKWPVLVVLV 188

Query: 190 FIGLIFVHLFLPAAKSKIM-SILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
            +    ++   P AK        PG +     W+V +  F  Y+  F++Y+  Y  L  I
Sbjct: 189 ALIFSILYWASPNAKVGGPLRQAPGGLVAVGLWLVASAGFAFYVANFASYNKTYGTLGGI 248

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           +   ++L++  +  + GAELNA +      K
Sbjct: 249 IVFFIWLWVSNLAILFGAELNAELERGRAIK 279


>gi|170723022|ref|YP_001750710.1| ribonuclease BN [Pseudomonas putida W619]
 gi|169761025|gb|ACA74341.1| ribonuclease BN [Pseudomonas putida W619]
          Length = 317

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 61/273 (22%), Positives = 126/273 (46%), Gaps = 1/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +  I+   ++ F++++    AS ++   L S+FPF++F   L GFL    F   +     
Sbjct: 11  LHRILVRTVKEFLDDEMSTYASALAYQMLFSLFPFLLFLIALIGFLHLPDFFSWLRMQSE 70

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P    + +   I Q+      GL ++  + A + +S GV  +  ++N AY V E R 
Sbjct: 71  LVLPPQALEQVNPVIDQLQQSK-GGLLSVGIVIALWTASAGVRLMMSAMNAAYDVPEGRP 129

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            +    +S  Y +  +  L+  + + V  P  + ++         ++ +    R  A ++
Sbjct: 130 VWKRIPLSIIYTVGIAGMLLAAAALMVLGPQVMEWIAAQIGMQEVIVTVWTILRWPAIII 189

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            + + +  ++  +P  K K   I PG +   + W++ ++ F +Y+ TF+ Y+ MY  + +
Sbjct: 190 LMMVAVAVIYYVMPDVKQKFRFITPGSVLAVVVWIIASLAFAYYVKTFADYNAMYGSIGA 249

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  L++ Y+     +LGAE+NA +       K
Sbjct: 250 IIVLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|148381344|ref|YP_001255885.1| YihY family protein [Clostridium botulinum A str. ATCC 3502]
 gi|153933068|ref|YP_001385721.1| YihY family protein [Clostridium botulinum A str. ATCC 19397]
 gi|153935062|ref|YP_001389128.1| YihY family protein [Clostridium botulinum A str. Hall]
 gi|148290828|emb|CAL84963.1| putative membrane-associated ribonuclease [Clostridium botulinum A
           str. ATCC 3502]
 gi|152929112|gb|ABS34612.1| YihY family protein [Clostridium botulinum A str. ATCC 19397]
 gi|152930976|gb|ABS36475.1| YihY family protein [Clostridium botulinum A str. Hall]
          Length = 285

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 63/277 (22%), Positives = 127/277 (45%), Gaps = 2/277 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +    I+   I      F+E++  A++S ++ + ++SVFPF++F   L G+L  H     
Sbjct: 3   KNLSKIIPKSIKKLANRFLEDEVLALSSQLAYALIISVFPFLMFVITLIGYLPIHS--ED 60

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           ++  +    P      + + I +++      L + S +   + +S G  A+   LNRAY 
Sbjct: 61  LLLGLKEIMPSNTYLLLKNTIEEIIYTQNGNLLSFSIIFTIWTASAGFRAVVRGLNRAYD 120

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E RS+   + ++    L  +  LV+  F+ V        +            I    R
Sbjct: 121 VKERRSFVKVQTMTIFCTLGMAFVLVMSIFLLVFGKTIGRTLVYKLGFSLEFNRIWNLIR 180

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
               +      L  ++ + P+ + +   +LPG IF  I+W++ ++ F+ Y+  F+ YS +
Sbjct: 181 YIIMIGVTIFILAALYYYTPSKRLRWRDVLPGAIFATIAWIIASMGFSFYVDNFNNYSRL 240

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           Y  + +++  LV+LY+  +  I G E+NA ++    +
Sbjct: 241 YGSIGAVIVFLVWLYLTSIIVITGGEINALLVSSREK 277


>gi|170741936|ref|YP_001770591.1| ribonuclease BN [Methylobacterium sp. 4-46]
 gi|168196210|gb|ACA18157.1| ribonuclease BN [Methylobacterium sp. 4-46]
          Length = 348

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 63/273 (23%), Positives = 122/273 (44%), Gaps = 7/273 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI++       ++   A A  ++  ALL+VFP +    +L G +     +   + ++ G 
Sbjct: 53  DILWRVAWSVPQDRVLATAGGVAFFALLAVFPGLALIVSLYGLVADPGAIYKHLSLLTGL 112

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P+ +   +  E+ +V       L     +S L A + +++GV AL  +LN  Y+  E R
Sbjct: 113 LPQAVLDLLAAELSRVAGKSTGALGAASGVSLLVAFWSANSGVSALFDALNVIYKEREKR 172

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
                   +F + L   +  ++ + + VA+P+ L  V             +   R  A +
Sbjct: 173 PLLHFYATTFLFTLTGVLFALVATGMVVALPVVLNQVGFQ---SYASDAALRLLRWPALL 229

Query: 187 LALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           + + +GL  ++ + P+   +K   +  G     + WV  + LF+ Y+  F +Y+ MY  L
Sbjct: 230 VLVSLGLAAIYRYGPSRHEAKWRWVTWGSGIAALLWVCASALFSWYVARFDSYNRMYGSL 289

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            + +  + +++   V  +LGAELNA M     R
Sbjct: 290 GAGVGFMTWIWFSIVIVLLGAELNAEMERQTVR 322


>gi|300114541|ref|YP_003761116.1| ribonuclease BN [Nitrosococcus watsonii C-113]
 gi|299540478|gb|ADJ28795.1| ribonuclease BN [Nitrosococcus watsonii C-113]
          Length = 328

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 52/272 (19%), Positives = 119/272 (43%), Gaps = 8/272 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
             DI Y   +   +++   +A+ ++  ALL++FP +V   ++ G +     V    D + 
Sbjct: 26  WRDIAYRIKDSLNDDNISIVAAGVAFYALLAIFPALVAMVSIYGIIADPADVQRQFDALS 85

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYRVVE 124
           G  P      +++++ ++ +  +  L        + A + ++ G +A  I+LN  Y   E
Sbjct: 86  GILPTEAQVLLSEQLRRITSQASTALSVGVGAGVILALWSATRGTKAFMIALNIVYGEKE 145

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R +     I+    L A V  ++   + V +P+ L+Y+           ++        
Sbjct: 146 KRGFLKLNAIALILTLGAIVLAILALGMIVVLPILLSYLD----LPEIFQVLASLLPWLL 201

Query: 185 TMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
                 +GL  ++ + P+  +++   +  G +   + W+ G+ LF+ Y+  F+ Y+  Y 
Sbjct: 202 LAFTFILGLAVLYRYGPSRSEARWRWVSWGAVAATVLWIAGSALFSFYVANFAQYNKTYG 261

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            + +++  L++ ++     +L AE NA M   
Sbjct: 262 SVGALIILLMWFFVTAYIILLAAEFNAEMEHQ 293


>gi|295400591|ref|ZP_06810569.1| ribonuclease BN [Geobacillus thermoglucosidasius C56-YS93]
 gi|294977494|gb|EFG53094.1| ribonuclease BN [Geobacillus thermoglucosidasius C56-YS93]
          Length = 275

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 66/272 (24%), Positives = 129/272 (47%), Gaps = 2/272 (0%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
              I +    F E++   +++ ++   LLS+FPF++F   L  +L        ++ V+  
Sbjct: 5   LTFIREMARRFQEDEIPRLSAELAYYFLLSLFPFLIFLITLLAYLPIPH--EDLLSVIRQ 62

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
             P+     +   + +V+      L ++S + A + +SNG+ A+  + NRAY VVE R +
Sbjct: 63  YAPKEAIHLVEANVHRVMDEQNGRLLSLSIIGAIWSASNGMNAIVRAFNRAYDVVENRPF 122

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
            + R +S    L   V +++   + V   +   ++   F      L I    R   + L 
Sbjct: 123 LVARGMSVLLTLGMIVVIIVALVLPVFGKMIGLFLFSAFGFSATFLTIWNAMRWVISSLI 182

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LF     ++ F P  K +  +++ G IF  I W++ ++ F++Y+  F+ Y+ MY  L  +
Sbjct: 183 LFAVFTALYYFAPNKKLRCANVVRGAIFATIGWIITSLAFSYYVNHFAHYAAMYGSLGGM 242

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +  +V+ Y+ G+  +LG E+NA        +K
Sbjct: 243 IILMVWFYLSGMIIVLGGEMNAIFDCEREGRK 274


>gi|312112319|ref|YP_003990635.1| ribonuclease BN [Geobacillus sp. Y4.1MC1]
 gi|311217420|gb|ADP76024.1| ribonuclease BN [Geobacillus sp. Y4.1MC1]
          Length = 275

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 65/272 (23%), Positives = 129/272 (47%), Gaps = 2/272 (0%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
              I +    F E++   +++ ++   LLS+FPF++F   L  +L        ++ V+  
Sbjct: 5   LTFIREMARRFQEDEIPRLSAELAYYFLLSLFPFLIFLITLLAYLPIPH--EDLLSVIRQ 62

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
             P+     +   + +V+      L ++S + A + +SNG+ A+  + NRAY VVE R +
Sbjct: 63  YAPKEAIHLVEANVHRVMDEQNGRLLSLSIIGAIWSASNGMNAIVRAFNRAYDVVENRPF 122

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
            + R +S    +   V +++   + V   +   ++   F      L I    R   + L 
Sbjct: 123 LVARGMSVLLTIGMIVVIIVALVLPVFGKMIGLFLFSAFGFSATFLTIWNAMRWVISSLI 182

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LF     ++ F P  K +  +++ G IF  I W++ ++ F++Y+  F+ Y+ MY  L  +
Sbjct: 183 LFAVFTALYYFAPNKKLRCANVVRGAIFATIGWIITSLAFSYYVNHFAHYAAMYGSLGGM 242

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +  +V+ Y+ G+  +LG E+NA        +K
Sbjct: 243 IILMVWFYLSGMIIVLGGEMNAIFDCEREGRK 274


>gi|269838968|ref|YP_003323660.1| ribonuclease BN [Thermobaculum terrenum ATCC BAA-798]
 gi|269790698|gb|ACZ42838.1| ribonuclease BN [Thermobaculum terrenum ATCC BAA-798]
          Length = 363

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 63/273 (23%), Positives = 117/273 (42%), Gaps = 5/273 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           + D +   ++   E+     A H++ S L +VFPF+VF  +L G   A + V  ++    
Sbjct: 29  LVDFVKQVLKEAQEDHLSVFAGHLTYSGLFAVFPFMVFLLSLLGIFRAEELVNELLSRAS 88

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLF----TISALAAAYFSSNGVEALRISLNRAYRVV 123
            A P      I   I Q+    A G F     +S L A +  S    ++  ++N  Y V 
Sbjct: 89  TAMPREAVDLIGGPIRQIAQSKATGAFGLSALVSILLALWGVSGAFRSVMEAMNVMYEVK 148

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR-I 182
           E R ++   LIS    L A+V ++    + V        + +    LG +    W     
Sbjct: 149 EGRPFWKRYLISILLSLGAAVLIIAALVLVVFGADIATAIARASAGLGPVFRWTWIILQW 208

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
              +  + +    ++ F P  + +   I PG +     W+V ++LF+ Y+  F +Y+  Y
Sbjct: 209 PVLVGFVLLAFALIYYFAPDVEQQFRFITPGSLVAVALWLVFSLLFSLYVNNFGSYNKTY 268

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
             LA ++  ++++Y      +LG E+N  +  +
Sbjct: 269 GALAGVIILMLYMYYSAYILLLGTEINQVIEEH 301


>gi|229159554|ref|ZP_04287568.1| YihY [Bacillus cereus R309803]
 gi|228623856|gb|EEK80668.1| YihY [Bacillus cereus R309803]
          Length = 287

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 72/270 (26%), Positives = 126/270 (46%), Gaps = 2/270 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
             +    D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++
Sbjct: 12  RTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLL 69

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               PE     I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E R
Sbjct: 70  EPYVPEDAMYLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETR 129

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+  TR +S  + L     +V    V V   +  A V K      +   +    R+ A+ 
Sbjct: 130 SFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASF 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             LF    F++ F P  K K   ++ G  F  + W+V +  F +Y+  F+ Y+  Y GL 
Sbjct: 190 FVLFALFSFLYTFAPDRKLKRREVISGATFATVGWIVVSYSFAYYVDKFANYANTYGGLG 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            I+  +++ Y+ G   +LG E+N  +  Y 
Sbjct: 250 GIIILMLWFYLTGWVILLGGEINGLLHHYR 279


>gi|297583355|ref|YP_003699135.1| ribonuclease BN [Bacillus selenitireducens MLS10]
 gi|297141812|gb|ADH98569.1| ribonuclease BN [Bacillus selenitireducens MLS10]
          Length = 290

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 57/276 (20%), Positives = 123/276 (44%), Gaps = 2/276 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +     V        + F +++   +A+  +   +LS+FP ++   ++  +      +  
Sbjct: 4   KAIARSVIGFFKSLGQEFTKDNVPLLAAAQAYYYMLSLFPMLILILSIIPYFDLDPNI-- 61

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           V+++++   P  IA  I  +I+ ++     GL T   LA  + +SNG+     + N AY 
Sbjct: 62  VVELMYQFIPGEIASMIEGQIVNLVTEQRGGLLTFGILATIWSASNGMNTFIKAQNEAYN 121

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V   R ++  RL+S        + L++   + V     ++++  F      L  +    R
Sbjct: 122 VKVQRPFWKARLVSIALTFGLILALIVALILPVMGDAIISFISSFGILTAELEELFRLLR 181

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
              ++  L +    ++   P  K      LPG +F  ++W +    F+ YI  F+ +S  
Sbjct: 182 WVVSISLLAMIFAALYYLAPNTKIPFRYALPGALFATLAWQLTGFGFSIYISNFANFSQT 241

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           Y  L  I+  +++L+++G+  ++GAE+NA +   + 
Sbjct: 242 YGSLGGIIVLMLWLFLIGIVLVVGAEINAVLYRKHR 277


>gi|315503112|ref|YP_004081999.1| ribonuclease bn [Micromonospora sp. L5]
 gi|315409731|gb|ADU07848.1| ribonuclease BN [Micromonospora sp. L5]
          Length = 340

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 47/283 (16%), Positives = 100/283 (35%), Gaps = 7/283 (2%)

Query: 1   MREYFCIVFD-IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV 59
           +R+     +  ++  + + FV ++    A+ ++   +L++FP  +    L G +      
Sbjct: 21  IRQLNWRTWRGVLVRSGKGFVTDNCADWAAALTYYGVLALFPSTIVVVALVGLVSDGPRT 80

Query: 60  PTVIDVVFGAWPEVIA---KPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRI 114
              +  +                  +  V+        L +   L A + +S  + A   
Sbjct: 81  VDTVIDLAREIGAGSVVGNDAFVGVVRNVVEQQGSAKVLLSFGLLGALWSASGFIGAFTR 140

Query: 115 SLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL 174
           + N  Y V E R +Y  R +  G   +  V L +++   +        V     A     
Sbjct: 141 ASNAIYGVREGRPFYRLRPLQIGMAAVTIVLLAVVATGLIVSGPVTDAVGDLLHAGAVAR 200

Query: 175 LIIWNGRIYATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIV 233
                 +     +     L  +    P  +      + PG     ++WV+ +  F  Y+ 
Sbjct: 201 TTWSVAKWPLLAVVAMTLLSLLFWIAPNVRQPRFRWLTPGGALALVAWVLASFGFGLYVA 260

Query: 234 TFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            F +Y   Y  L +++  LV+LY+     +LG ++NA +    
Sbjct: 261 NFGSYDVTYGSLGAVIAFLVWLYLSNCALMLGVQVNAELQRGR 303


>gi|314936062|ref|ZP_07843411.1| YihY family protein [Staphylococcus hominis subsp. hominis C80]
 gi|313655879|gb|EFS19622.1| YihY family protein [Staphylococcus hominis subsp. hominis C80]
          Length = 402

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 63/270 (23%), Positives = 124/270 (45%), Gaps = 2/270 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L++FP ++F   L            + D+V   
Sbjct: 66  NFLSYLIYRIGKDDASGLAAQMTYHFVLALFPMLIFLLTLLPLFQIDP--QQIKDLVSQN 123

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   A  +T     + +  +  L ++  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 124 APAETADVVTKIFKDITSNSSGSLLSVGLILAIWSASNGMTAIMNSFNVAYDVEDARNPI 183

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++ ++ L I   +         ++         +  I    RI   ++ +
Sbjct: 184 VLKLLSILFTIVMAIVLAIALTLPTFGNFIKDHLFGPLGLDQQVAWIFDLVRILLPLIVI 243

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            I  + ++   P  K+K  S+ PG IFT I W++G+  F  Y+  F  YS  Y  LA I+
Sbjct: 244 IILFLTLYSVAPNVKTKFKSVYPGAIFTSIVWLLGSFAFGWYLSNFGNYSKTYGSLAGII 303

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L+++Y+     I+GAE+NA +   +  K
Sbjct: 304 ILLLWIYITCFIIIIGAEINAVIHQRHVIK 333


>gi|229074335|ref|ZP_04207373.1| YihY [Bacillus cereus Rock4-18]
 gi|229095110|ref|ZP_04226105.1| YihY [Bacillus cereus Rock3-29]
 gi|229101212|ref|ZP_04231976.1| YihY [Bacillus cereus Rock3-28]
 gi|229114064|ref|ZP_04243489.1| YihY [Bacillus cereus Rock1-3]
 gi|228669334|gb|EEL24751.1| YihY [Bacillus cereus Rock1-3]
 gi|228682180|gb|EEL36293.1| YihY [Bacillus cereus Rock3-28]
 gi|228688295|gb|EEL42178.1| YihY [Bacillus cereus Rock3-29]
 gi|228708777|gb|EEL60912.1| YihY [Bacillus cereus Rock4-18]
          Length = 288

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 73/270 (27%), Positives = 127/270 (47%), Gaps = 2/270 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
             +    D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++
Sbjct: 12  RTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLL 69

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               PE     I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E R
Sbjct: 70  EPYVPEDAMYLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETR 129

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+  TR +S  + L     +V    V V   +  A V K      +   +    R+ A+ 
Sbjct: 130 SFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASF 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             LF    F++ F P  K K   ++ G IF  + W+V +  F +Y+  F+ Y+  Y GL 
Sbjct: 190 FVLFALFSFLYTFAPDRKLKRREVISGAIFATVGWIVVSYSFAYYVDKFANYANTYGGLG 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            I+  +++ Y+ G   +LG E+N  +  Y 
Sbjct: 250 GIIILMLWFYLTGWVILLGGEINGLLHHYR 279


>gi|255327084|ref|ZP_05368160.1| tRNA processing ribonuclease BN [Rothia mucilaginosa ATCC 25296]
 gi|255296301|gb|EET75642.1| tRNA processing ribonuclease BN [Rothia mucilaginosa ATCC 25296]
          Length = 463

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 58/276 (21%), Positives = 115/276 (41%), Gaps = 6/276 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVV 66
           +  I+  AI  F    G  MA+ ++   +LS+FP ++   +L G  G   +    ++  +
Sbjct: 49  ILYILRRAIYKFGANGGTDMAAALTYFTVLSIFPALLAIVSLLGVFGHGEESAAVILAFL 108

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
               P  +   + D I Q+      GL      L+A + +S    +   +LN  Y V E 
Sbjct: 109 KDNAPAQMYAILEDPIKQITGDHGAGLVLLTGILSALWSASGYTGSFGRALNTVYNVREG 168

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGN---LLLIIWNGRI 182
           R  +I + ++     +  + +V+M  + +     L  V ++ P   +   + LI  NGR 
Sbjct: 169 RPGWILKPLNVFVTTVLIILVVLMMLMMLLGVTVLDMVGQYVPETVDMELIKLIWLNGRW 228

Query: 183 YATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
              +      +  ++   P  +  K   + PG         +G   FT Y   FS Y+  
Sbjct: 229 ILILFMAIGLITLLYAATPNVRRFKQWKLSPGAALALFGMGLGGFGFTLYANNFSKYNAT 288

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           Y  +  ++  L+F++++    + GA L+A +++   
Sbjct: 289 YGLIGGVIVMLLFIWIMNNMLLFGAHLDAEIMLMRQ 324


>gi|30018660|ref|NP_830291.1| ribonuclease BN [Bacillus cereus ATCC 14579]
 gi|75762510|ref|ZP_00742370.1| Ribonuclease BN [Bacillus thuringiensis serovar israelensis ATCC
           35646]
 gi|206967706|ref|ZP_03228662.1| YihY family protein [Bacillus cereus AH1134]
 gi|218234197|ref|YP_002365252.1| YihY family protein [Bacillus cereus B4264]
 gi|218895526|ref|YP_002443937.1| YihY family protein [Bacillus cereus G9842]
 gi|228899127|ref|ZP_04063399.1| YihY [Bacillus thuringiensis IBL 4222]
 gi|228937697|ref|ZP_04100333.1| YihY [Bacillus thuringiensis serovar berliner ATCC 10792]
 gi|228950960|ref|ZP_04113081.1| YihY [Bacillus thuringiensis serovar kurstaki str. T03a001]
 gi|228970585|ref|ZP_04131235.1| YihY [Bacillus thuringiensis serovar thuringiensis str. T01001]
 gi|228977155|ref|ZP_04137556.1| YihY [Bacillus thuringiensis Bt407]
 gi|229042309|ref|ZP_04190060.1| YihY [Bacillus cereus AH676]
 gi|229068157|ref|ZP_04201464.1| YihY [Bacillus cereus F65185]
 gi|229077762|ref|ZP_04210390.1| YihY [Bacillus cereus Rock4-2]
 gi|229108075|ref|ZP_04237700.1| YihY [Bacillus cereus Rock1-15]
 gi|229125902|ref|ZP_04254927.1| YihY [Bacillus cereus BDRD-Cer4]
 gi|229143195|ref|ZP_04271627.1| YihY [Bacillus cereus BDRD-ST24]
 gi|229148807|ref|ZP_04277055.1| YihY [Bacillus cereus m1550]
 gi|229176994|ref|ZP_04304389.1| YihY [Bacillus cereus 172560W]
 gi|229188674|ref|ZP_04315713.1| YihY [Bacillus cereus ATCC 10876]
 gi|296501234|ref|YP_003662934.1| ribonuclease BN [Bacillus thuringiensis BMB171]
 gi|29894201|gb|AAP07492.1| Ribonuclease BN [Bacillus cereus ATCC 14579]
 gi|74490006|gb|EAO53362.1| Ribonuclease BN [Bacillus thuringiensis serovar israelensis ATCC
           35646]
 gi|206736626|gb|EDZ53773.1| YihY family protein [Bacillus cereus AH1134]
 gi|218162154|gb|ACK62146.1| YihY family protein [Bacillus cereus B4264]
 gi|218544049|gb|ACK96443.1| YihY family protein [Bacillus cereus G9842]
 gi|228594863|gb|EEK52643.1| YihY [Bacillus cereus ATCC 10876]
 gi|228606469|gb|EEK63895.1| YihY [Bacillus cereus 172560W]
 gi|228634601|gb|EEK91182.1| YihY [Bacillus cereus m1550]
 gi|228640276|gb|EEK96674.1| YihY [Bacillus cereus BDRD-ST24]
 gi|228657560|gb|EEL13373.1| YihY [Bacillus cereus BDRD-Cer4]
 gi|228675350|gb|EEL30569.1| YihY [Bacillus cereus Rock1-15]
 gi|228705553|gb|EEL57911.1| YihY [Bacillus cereus Rock4-2]
 gi|228714971|gb|EEL66839.1| YihY [Bacillus cereus F65185]
 gi|228727029|gb|EEL78235.1| YihY [Bacillus cereus AH676]
 gi|228782603|gb|EEM30780.1| YihY [Bacillus thuringiensis Bt407]
 gi|228789172|gb|EEM37101.1| YihY [Bacillus thuringiensis serovar thuringiensis str. T01001]
 gi|228808687|gb|EEM55185.1| YihY [Bacillus thuringiensis serovar kurstaki str. T03a001]
 gi|228821984|gb|EEM67976.1| YihY [Bacillus thuringiensis serovar berliner ATCC 10792]
 gi|228860568|gb|EEN04956.1| YihY [Bacillus thuringiensis IBL 4222]
 gi|296322286|gb|ADH05214.1| ribonuclease BN [Bacillus thuringiensis BMB171]
 gi|326938192|gb|AEA14088.1| ribonuclease BN [Bacillus thuringiensis serovar chinensis CT-43]
          Length = 288

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 71/270 (26%), Positives = 125/270 (46%), Gaps = 2/270 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
             +    D  +  + +D   +A+ ++   LL++FP +VF   L GF+        V+ ++
Sbjct: 12  RTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIPIQ--TEDVLSLL 69

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               P+     I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E R
Sbjct: 70  EVYVPDDAMNLIEVNVDKVVNQQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVKETR 129

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+  TR +S  + L     +V    V V   +  A V K      +   +    R+ A+ 
Sbjct: 130 SFITTRALSIVFTLAIIFMIVFALIVPVFGQVIGAAVFKALGLSDSFSFVWSITRLVASF 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             LF    F++ F P  K K   ++ G +F  + W+V +  F +Y+  F+ Y+  Y GL 
Sbjct: 190 FVLFALFSFLYTFAPDRKLKRREVISGALFATVGWIVVSYSFAYYVDKFANYANTYGGLG 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            I+  +++ Y+ G   +LG E+N  +  Y 
Sbjct: 250 GIIILMLWFYLTGWVILLGGEINGLLHHYR 279


>gi|239825980|ref|YP_002948604.1| ribonuclease BN [Geobacillus sp. WCH70]
 gi|239806273|gb|ACS23338.1| ribonuclease BN [Geobacillus sp. WCH70]
          Length = 277

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 64/272 (23%), Positives = 129/272 (47%), Gaps = 2/272 (0%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
              I + +  F +++   +++ ++   LLS+FPF++F   L  +L        ++ ++  
Sbjct: 5   LTFIREMVRRFQKDEIPRLSAELAYYFLLSLFPFLIFLFTLLAYLPIPH--EDILSIIRQ 62

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
             P+     +   I +V+      L + S +AA + +SNG+ A+  + NRAY V E R +
Sbjct: 63  YAPKEALHLVEANIRRVMDDQNWKLLSFSIIAAIWSASNGMNAIVRAFNRAYDVEENRPF 122

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +I R +S    +     +++  F+ V       ++   F      L I    R   +   
Sbjct: 123 FIARGMSVLLTIGMIFVIIVALFLPVFGKTIGLFLFSAFGFSETFLTIWNALRWVISSFI 182

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LF+    ++ F P  K +  +I+ G IF  + W++ ++ F++Y+  F+ Y+ MY  L  +
Sbjct: 183 LFVVFTALYYFAPNKKLRCANIVRGAIFATVGWIMTSLAFSYYVNNFANYTAMYGSLGGM 242

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +  +V+ Y+ G+  +LG E+NA        +K
Sbjct: 243 IILMVWFYLSGMIIVLGGEMNAIFDCEREGRK 274


>gi|254465241|ref|ZP_05078652.1| ribonuclease BN [Rhodobacterales bacterium Y4I]
 gi|206686149|gb|EDZ46631.1| ribonuclease BN [Rhodobacterales bacterium Y4I]
          Length = 315

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 55/270 (20%), Positives = 113/270 (41%), Gaps = 8/270 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI     +    +    +A+ ++   L+++FP I     + G +     +   I  + G 
Sbjct: 20  DIALRVKDEIAADHVGLIAAGVAFYGLMALFPAITALLAIGGLMVEPAQIVDQISQLEGV 79

Query: 70  WPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P+ + + I  +  QV      GL        L A Y +S G+ +L   +N AY   E R
Sbjct: 80  VPDEVMEIIIGQATQVAGSREGGLGLAAVAGILIALYSASKGMNSLIEGMNVAYDEEEKR 139

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            +++   ++    L     L++     +A+P  +A V         +  +         +
Sbjct: 140 GFFMKTFVTLVLTLFLIAGLLMGLLAALAVPSVIALVDA----GPVIEALGTLLAWGVLL 195

Query: 187 LALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +    GL  ++ + P+  K +++   PG     + W+ G+  F  Y+  F +Y+  +  L
Sbjct: 196 VMTMAGLAVLYRYGPSRDKPELLWTSPGAAAACVLWLAGSAGFAFYVGNFGSYNESFGAL 255

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           A ++  L++L++     +LGAE+NA +   
Sbjct: 256 AGVVVLLMWLWISAFIVLLGAEINAEVEAQ 285


>gi|187776658|ref|ZP_02993131.1| hypothetical protein CLOSPO_00173 [Clostridium sporogenes ATCC
           15579]
 gi|187775317|gb|EDU39119.1| hypothetical protein CLOSPO_00173 [Clostridium sporogenes ATCC
           15579]
          Length = 285

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 63/277 (22%), Positives = 130/277 (46%), Gaps = 2/277 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +  F I+   I +    F+E++  A++S ++ + ++SVFPF++F   L G+L  H     
Sbjct: 3   KNLFKIIPKGIKELTNRFLEDEVLALSSQLAYALIISVFPFLMFVITLIGYLPIHS--ED 60

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           ++  +    P      + + I +++      L + S +   + +S G  A+   LN+AY 
Sbjct: 61  LLLGLKEIIPSNAYLLLKNTIEEIIYTQNGNLLSFSIIFTIWTASAGFRAVVRGLNKAYD 120

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E RS+   ++++    L  +  LV+  F+ V        +            I    R
Sbjct: 121 VKERRSFVKVQIMTIFCTLGMAFVLVMSIFLLVFGRTIGRTLVYKLGFSWEFNRIWNLIR 180

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
               +      L  ++ + P+ + +   +LPG IF  I+W++ ++ F+ Y+  F+ YS +
Sbjct: 181 YTIMIGVTIFILAALYYYTPSKRLRWRDVLPGSIFATIAWIIASMGFSFYVDNFNNYSRL 240

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           Y  + +++  LV+LY+  +  I G E+NA ++    +
Sbjct: 241 YGSIGAVIVFLVWLYLTSIIVITGGEINALLVSSREK 277


>gi|148273269|ref|YP_001222830.1| hypothetical protein CMM_2087 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147831199|emb|CAN02152.1| conserved hypothetical protein [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 395

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 59/268 (22%), Positives = 114/268 (42%), Gaps = 3/268 (1%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH-QFVPTVIDVVFGAWP 71
             A+  F++  G  MA+ ++  + LS+ P  V   +L G +G     V  V+ V+     
Sbjct: 40  RRAVYGFMKHRGIDMAASLTFYSTLSLVPAAVAVLSLIGVVGDTRAGVEGVLGVLTAVLG 99

Query: 72  EVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           +     I D + Q+   P  G+ FT+S L A + S+  V A   ++NR     E R    
Sbjct: 100 DSAVDVIRDPVEQLADGPRSGIAFTVSFLGALWTSAAYVTAFGRAMNRVQETEEGRPLVK 159

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            R +  G  +   V  V+M  + +        + +        L++    +       L 
Sbjct: 160 YRALMLGVTVALLVVSVVMVGMLLLTDDGARALGQQLGLGDTTLVVWAIVKWPLLAALLT 219

Query: 191 IGLIFVHLFLPAAKSKIMSIL-PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
             +  ++   P  + + + +L  G +   ++W +G   F  Y+ T +TY + Y  L +++
Sbjct: 220 GIIGVLYAATPNLRRRRVDLLTWGSLVAIVAWGLGTAGFVWYVTTIATYESTYGVLGAVI 279

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYW 277
             L++LY+  +  +LG EL+  +I    
Sbjct: 280 VLLLWLYIGNLSLVLGGELDVEIIRARQ 307


>gi|163850547|ref|YP_001638590.1| ribonuclease BN [Methylobacterium extorquens PA1]
 gi|218529263|ref|YP_002420079.1| ribonuclease BN [Methylobacterium chloromethanicum CM4]
 gi|163662152|gb|ABY29519.1| ribonuclease BN [Methylobacterium extorquens PA1]
 gi|218521566|gb|ACK82151.1| ribonuclease BN [Methylobacterium chloromethanicum CM4]
          Length = 347

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 65/275 (23%), Positives = 130/275 (47%), Gaps = 8/275 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
             DI++  +     +   A A  ++  ALL+VFP +    +L G       +   + ++ 
Sbjct: 51  WRDILWRVVLSLQRDRVLATAGGVAFFALLAVFPALATIVSLYGLFSDPTAIGQHLSLLA 110

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLNRAYRVVE 124
           G  P  +   ++++++++       L T S L    A + +++GV AL  +LN  YR  E
Sbjct: 111 GVLPNGVLDLLSEQLVRIARQSTGALSTASLLSMIIAFWSANSGVSALFDALNVIYRERE 170

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            RS     + +F + L   V ++  + + V +P+ L+ +       G     +   R  A
Sbjct: 171 KRSLVGFYVTTFLFTLTGIVFVLASTGMVVILPIVLSRI----GLGGLADTALRILRWPA 226

Query: 185 TMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            +L + + L   + + P+ + +K   +  G +   +SWV  +VLF+ Y+ +F +Y+ +Y 
Sbjct: 227 LLLLVSLSLSLTYRYGPSRREAKWRWVSWGSVAASLSWVCTSVLFSWYVASFDSYNRVYG 286

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            L + +  + ++++  V  +LGAELNA M     R
Sbjct: 287 SLGAGVGFMTWIWLSVVIVLLGAELNAEMERQTAR 321


>gi|148546571|ref|YP_001266673.1| putative ribonuclease BN [Pseudomonas putida F1]
 gi|148510629|gb|ABQ77489.1| putative ribonuclease BN [Pseudomonas putida F1]
          Length = 318

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 61/273 (22%), Positives = 126/273 (46%), Gaps = 1/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +  ++   ++ F++++    AS ++  AL S+FPF++F   L GFL    F   +     
Sbjct: 11  LHRVLVRTVKEFLDDEMSTYASALAYQALFSLFPFLLFLIALIGFLHLPDFFSWLRLQSE 70

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P    + +   I Q+      GL ++  + A + +S GV  +  ++N AY V E R 
Sbjct: 71  LVLPPQALEQVNPVIDQLQQSK-GGLLSVGIVIALWTASAGVRLMMSAMNAAYDVPEGRP 129

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            +    +S  Y +  +  L+  + + V  P  + ++         ++ +    R    ++
Sbjct: 130 VWKRIPLSIFYTVGLAGMLLAAAALMVLGPQVMEWIAAQIGMQEFIVTLWTILRWPVIII 189

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            L + +  ++  +P  K +   I PG +   + W+V ++ F +Y+ TF+ Y+ MY  + +
Sbjct: 190 LLMVAVALIYYVMPDVKQQFRFITPGSVLAVVVWIVASLGFAYYVKTFADYNAMYGSIGA 249

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  L++ Y+     +LGAE+NA +       K
Sbjct: 250 IIVLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|167644948|ref|YP_001682611.1| ribonuclease BN [Caulobacter sp. K31]
 gi|167347378|gb|ABZ70113.1| ribonuclease BN [Caulobacter sp. K31]
          Length = 414

 Score =  155 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 52/275 (18%), Positives = 118/275 (42%), Gaps = 9/275 (3%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
           +    DI++        +   A+A  ++   LL++FP I    +L G       V   + 
Sbjct: 83  WRGWRDIVWRTGREVSVDRLPAVAGGVTFYTLLAIFPAIGAFVSLYGLFADIGGVEKQLR 142

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYR 121
            +   +P  +   I +++L++ +     L     +S L + + ++  ++AL   LN AY 
Sbjct: 143 EMSSVFPASVVNIIGEQMLRLASQEQAKLGVAFVVSLLLSIWSANASMKALFDGLNVAYD 202

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             E R++      ++ +   A V  VI++ V +  P+ +  +      L     +    R
Sbjct: 203 EDEKRNFVAKTAWTYAFTFCALVYAVILAGVLIGAPIVMERI-----GLSAAAAVWIPLR 257

Query: 182 IYATMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
               +         ++ F P   + +   ++ G +F   +W++G++ F+ Y+   + Y  
Sbjct: 258 WLIVLAVTAFAFAMLYRFAPCRARPRWRWVIWGAVFGAAAWLLGSLGFSLYVNNIAHYDA 317

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            Y  L +++  +V+++   +  ++GAELNA +   
Sbjct: 318 TYGPLGAVIAFMVWMWFSILTVLIGAELNAEIEHQ 352


>gi|327438684|dbj|BAK15049.1| predicted membrane protein [Solibacillus silvestris StLB046]
          Length = 311

 Score =  155 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 71/272 (26%), Positives = 118/272 (43%), Gaps = 5/272 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
            I D I      D   M + ++   LLS FP ++F   L  +L   Q    + D +    
Sbjct: 33  FIQDLIYRTKNVDMSGMGAQLAYFFLLSFFPMLIFMVTLLPYLNLEQ--GQIFDFLSDVM 90

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           PE +   I   +  VL     GL +I  +   + +S GV+AL  SLNRAY V E R+ ++
Sbjct: 91  PEEVYGLIETTLTDVLNNQNGGLLSIGIIGTLWSASRGVDALMKSLNRAYDV-EGRAGFL 149

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            RL S  + +     ++I     V        V  +     +   +    R       +F
Sbjct: 150 NRLWSLVFTIALVAVILIALVFPVFGQQIGNIVFGYLGVEESFANVWTFVRWITPPTLIF 209

Query: 191 IGLIFVHLFLPAA--KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           I +  ++  +P    +  + S++PG +F  + W+V    F+ YI  F  YS+ Y  +  +
Sbjct: 210 IVISVMYWIVPNTDPRLTMFSVIPGAVFATLGWLVLTYGFSFYINNFGNYSSTYGSIGGV 269

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +  +++LY  G+  ILG  LNAS       K+
Sbjct: 270 IILMLWLYFTGMIIILGGLLNASFQKRQLAKE 301


>gi|77164583|ref|YP_343108.1| ribonuclease BN [Nitrosococcus oceani ATCC 19707]
 gi|254434849|ref|ZP_05048357.1| YihY family protein [Nitrosococcus oceani AFC27]
 gi|76882897|gb|ABA57578.1| Ribonuclease BN [Nitrosococcus oceani ATCC 19707]
 gi|207091182|gb|EDZ68453.1| YihY family protein [Nitrosococcus oceani AFC27]
          Length = 328

 Score =  155 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 53/272 (19%), Positives = 121/272 (44%), Gaps = 8/272 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
             DI Y   +   +++   +A+ ++  ALL++FP +V   ++ G +     V    D + 
Sbjct: 26  WRDIAYRIKDSLDDDNISIVAAGVAFYALLAIFPALVAMVSIYGIIADPADVQRQFDALS 85

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYRVVE 124
           G  P      +++++ ++ +  +  L     +  + A + ++ G +A  I+LN  Y   E
Sbjct: 86  GILPTEAQVLLSEQLRRITSQASTALSVGVGVGVILALWSATRGTKAFIIALNIVYGEKE 145

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R +     I+    L A V  ++   + V +P+ L+Y+           ++        
Sbjct: 146 KRGFLKLNAIALMLTLGAIVLAILALGMIVVLPILLSYLD----LPEIFQVLASLLPWLL 201

Query: 185 TMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
                 +GL  ++ + P+  +++   +  G +   + W+VG+ LF+ Y+  F+ Y+  Y 
Sbjct: 202 LAFTFILGLAVLYRYGPSRSEARWRWVSWGAVAATVLWIVGSALFSFYVANFAQYNKTYG 261

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            + +++  L++ ++     +L AE NA M   
Sbjct: 262 SVGALIILLMWFFVTAYIILLAAEFNAEMEHQ 293


>gi|104782989|ref|YP_609487.1| ribonuclease BN [Pseudomonas entomophila L48]
 gi|95111976|emb|CAK16703.1| putative ribonuclease BN [Pseudomonas entomophila L48]
          Length = 318

 Score =  155 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 61/273 (22%), Positives = 127/273 (46%), Gaps = 1/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +  ++   ++ F++++    AS ++   L S+FPF++F   L GFL    F   +     
Sbjct: 11  LHRVLVRTVKEFLDDEMSTYASALAYQMLFSLFPFLLFLIALIGFLHLPDFFSWLRLQSE 70

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P    + +   I Q+      GL ++  + A + +S GV  +  ++N AY V E R 
Sbjct: 71  LVLPPQALEQVNPVIDQLQQSK-GGLLSVGIVIALWTASAGVRLMMSAMNAAYDVPEGRP 129

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            +    +S  Y +  +  L+  + + V  P  + ++         ++++    R  A ++
Sbjct: 130 VWKRFPLSIIYTVGIAGMLLAAAALMVLGPQVMEWIASQVGLEEAVVVVWTILRWPAIII 189

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            + + +  ++  +P  K K   I PG +   + W+V ++ F +Y+ TF+ Y+ MY  + +
Sbjct: 190 LMMVAVALIYYVMPDVKQKFRFITPGSVLAVVVWIVASLGFAYYVKTFADYNAMYGSIGA 249

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  L++ Y+     +LGAE+NA +       K
Sbjct: 250 IIVLLLYFYISAAVLLLGAEMNAVIEHLSAEGK 282


>gi|332992062|gb|AEF02117.1| putative ribonuclease protein [Alteromonas sp. SN2]
          Length = 318

 Score =  155 bits (392), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 46/273 (16%), Positives = 114/273 (41%), Gaps = 8/273 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
               + I+     +    +   +A+ ++   LL++FP +    +L G + + + +   + 
Sbjct: 17  LKNWWSIVKRTFTNIQSHNIPLIAAGVAFYCLLAIFPLLGATISLYGLMVSPEELQNHMA 76

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAA---AYFSSNGVEALRISLNRAYR 121
           ++    P   +  I +++  +    +  L     L      + SS G  AL  + N  Y 
Sbjct: 77  LLVNVVPSDSSYIIEEQLKNLTQKSSSALGWGFFLTLFLSLWSSSKGANALITACNITYI 136

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
               R ++   +      +   +T+++       +P  ++++     +      I     
Sbjct: 137 EDNGRGFFKGLIARITGTICMIITVIVALVCITVLPELISWISGGLISFKQASWIT---- 192

Query: 182 IYATMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
               +L   IGL  ++ + P  + ++   + PG +F  + W+  +  F+ Y+  F++Y+ 
Sbjct: 193 WPVLLLLFNIGLSALYRYAPHRRSAQWRWVTPGSLFATLLWIAASYGFSIYLNEFASYNK 252

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
            Y  +  I+  L++LY+     ++GAE+N+S+ 
Sbjct: 253 TYGSVGGIIILLMWLYLSAYIILIGAEVNSSIE 285


>gi|168178914|ref|ZP_02613578.1| YihY family protein [Clostridium botulinum NCTC 2916]
 gi|182670173|gb|EDT82149.1| YihY family protein [Clostridium botulinum NCTC 2916]
          Length = 285

 Score =  155 bits (392), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 63/277 (22%), Positives = 128/277 (46%), Gaps = 2/277 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +    I+   I      F+E++  A++S ++ + ++SVFPF++F   L G+L  H     
Sbjct: 3   KNLIKIMPKSIKKLANRFLEDEVLALSSQLAYALIISVFPFLMFVITLIGYLPIHS--ED 60

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           ++  +    P      + + I +++      L + S +   + +S G  A+   LNRAY 
Sbjct: 61  LLLGLKEIMPSNTYLLLKNTIEEIIYTQNGNLLSFSIIFTIWTASAGFRAVVRGLNRAYD 120

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E RS+   ++++    L  +  LV+  F+ V        +            I    R
Sbjct: 121 VKERRSFVKVQIMTIFCTLGMAFVLVMSIFLLVFGKTIGRTLVYKLGFSLEFNRIWNLIR 180

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
               +      L  ++ + P+ + +   +LPG IF  I+W++ ++ F+ Y+  F+ YS +
Sbjct: 181 YIIMIGVTIFILAALYYYTPSKRLRWRDVLPGAIFATIAWIIASMGFSFYVDNFNNYSRL 240

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           Y  + +++  LV+LY+  +  I G E+NA ++    +
Sbjct: 241 YGSIGAVIVFLVWLYLTSIIVITGGEINALLVSSREK 277


>gi|297624536|ref|YP_003705970.1| ribonuclease BN [Truepera radiovictrix DSM 17093]
 gi|297165716|gb|ADI15427.1| ribonuclease BN [Truepera radiovictrix DSM 17093]
          Length = 289

 Score =  155 bits (392), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 62/265 (23%), Positives = 121/265 (45%), Gaps = 1/265 (0%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           F ++  A   F E+D    AS ++   L S+FPFI+F   L GFL   +F   +      
Sbjct: 12  FAVLRRAFGKFGEDDMGTYASALAYQVLFSLFPFIIFLVALLGFLNIPEFFEYLRGQANE 71

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
             P  +A  +   I ++   P  GL ++  L A + +S GV A   +LN AY V E R  
Sbjct: 72  VLPAQVADQVNQIIDEI-EQPRGGLLSLGILVALWTASAGVRATMNALNVAYGVSEGRPV 130

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +    +S  Y +  +  L+  + + +  P  ++++ +        + +    R+   ++ 
Sbjct: 131 WKRMPLSLLYTVGLAAMLIAAAALLIFGPQVMSWLGELVGFANIFVTLWNLLRLPVAVVL 190

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           L + +  V+   P  + + + I PG +   + W++ +  F+ Y+  F+ +S  Y  L ++
Sbjct: 191 LMLVVALVYYAFPDTEQRFVFITPGSVLAVLVWLLASWGFSLYVQNFADFSATYGSLGAV 250

Query: 249 MTCLVFLYMLGVFFILGAELNASMI 273
           +  L + Y+     + GAE+N  + 
Sbjct: 251 VVILFYFYISASVLLFGAEINEVIE 275


>gi|26991244|ref|NP_746669.1| ribonuclease BN, putative [Pseudomonas putida KT2440]
 gi|24986297|gb|AAN70133.1|AE016653_4 ribonuclease BN, putative [Pseudomonas putida KT2440]
          Length = 318

 Score =  155 bits (392), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 61/273 (22%), Positives = 126/273 (46%), Gaps = 1/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +  ++   ++ F++++    AS ++  AL S+FPF++F   L GFL    F   +     
Sbjct: 11  LHRVLVRTVKEFLDDEMSTYASALAYQALFSLFPFLLFLIALIGFLHLPDFFSWLRLQSE 70

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P    + +   I Q+      GL ++  + A + +S GV  +  ++N AY V E R 
Sbjct: 71  LVLPPQALEQVNPVIDQLQQSK-GGLLSVGIVIALWTASAGVRLMMSAMNAAYDVSEGRP 129

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            +    +S  Y +  +  L+  + + V  P  + ++         ++ +    R    ++
Sbjct: 130 VWKRIPLSIFYTVGLAGMLLAAAALMVLGPQVMEWIAAQIGMQEFIVTLWTILRWPVIII 189

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            L + +  ++  +P  K +   I PG +   + W+V ++ F +Y+ TF+ Y+ MY  + +
Sbjct: 190 LLMVAVALIYYVMPDVKQQFRFITPGSVLAVVVWIVASLGFAYYVKTFADYNAMYGSIGA 249

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  L++ Y+     +LGAE+NA +       K
Sbjct: 250 IIVLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|264679388|ref|YP_003279295.1| ribonuclease BN [Comamonas testosteroni CNB-2]
 gi|262209901|gb|ACY33999.1| putative ribonuclease BN [Comamonas testosteroni CNB-2]
          Length = 596

 Score =  155 bits (392), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 48/260 (18%), Positives = 100/260 (38%), Gaps = 9/260 (3%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI--DVVFGAWPE 72
            +  F E+     AS ++ ++LL++ PF      L            V+   ++    PE
Sbjct: 203 LLARFKEDRLGVTASSLTFTSLLALVPFFTVALALFTAFPIFGKAQKVLERWLMDSLIPE 262

Query: 73  VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
            IA+ +   + Q  A  A  L  +        +   +  +  +LN  +RV ++R      
Sbjct: 263 TIARQVLGYLTQF-ASKASQLGLVGFSILMVTAIALILTIDRTLNNIWRVRQLRPLGQRV 321

Query: 133 LISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIG 192
           LI +  + L  + L +   +   +  A   +    P        +         + L  G
Sbjct: 322 LIYWAAITLGPLLLGLSLVLSSYVMSASKGMVNALPGS------LRFVFDSIEFVVLAAG 375

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
           +  ++ ++P    +    L G +F  +   V   +   Y+ +  TYS +Y   A++   L
Sbjct: 376 MAGLYHYVPNTPVRWRHALVGGVFVAVFMEVAKKVLGLYLSSVPTYSVIYGAFATLPILL 435

Query: 253 VFLYMLGVFFILGAELNASM 272
           +++Y+     +LGA + A +
Sbjct: 436 IWMYVAWSIVLLGALVTAYL 455


>gi|196034774|ref|ZP_03102182.1| YihY family protein [Bacillus cereus W]
 gi|218901611|ref|YP_002449445.1| YihY family protein [Bacillus cereus AH820]
 gi|228925661|ref|ZP_04088749.1| YihY [Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228931903|ref|ZP_04094798.1| YihY [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228944214|ref|ZP_04106592.1| YihY [Bacillus thuringiensis serovar monterrey BGSC 4AJ1]
 gi|229120067|ref|ZP_04249321.1| YihY [Bacillus cereus 95/8201]
 gi|195992817|gb|EDX56777.1| YihY family protein [Bacillus cereus W]
 gi|218539779|gb|ACK92177.1| YihY family protein [Bacillus cereus AH820]
 gi|228663386|gb|EEL18972.1| YihY [Bacillus cereus 95/8201]
 gi|228815464|gb|EEM61707.1| YihY [Bacillus thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228827757|gb|EEM73496.1| YihY [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228833997|gb|EEM79546.1| YihY [Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1]
          Length = 286

 Score =  155 bits (392), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 71/270 (26%), Positives = 124/270 (45%), Gaps = 5/270 (1%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
             +    D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V+D++
Sbjct: 12  RTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLDLL 69

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               PE     I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E R
Sbjct: 70  EPYVPEDAMNLIEVNVDKVVNEQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETR 129

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+  TR +S  + L     +V    V V   +  A +                 R+ ++ 
Sbjct: 130 SFIKTRALSIVFTLAIIFMIVFALLVPVFGQVIGAEI---IGLSDTYSYAWSVTRLVSSF 186

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             LF    F++ F P  K K   ++ G +F  I W+V +  F +Y+  F+ Y+  Y GL 
Sbjct: 187 FVLFALFSFLYTFAPDRKLKRREVVSGALFATIGWIVVSYSFAYYVDKFANYANTYGGLG 246

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            I+  +++ Y+ G   +LG E+N  +  Y 
Sbjct: 247 GIIVLMLWFYLTGWVILLGGEINGLLHHYR 276


>gi|120434656|ref|YP_860345.1| ribonuclease BN [Gramella forsetii KT0803]
 gi|117576806|emb|CAL65275.1| ribonuclease BN [Gramella forsetii KT0803]
          Length = 338

 Score =  155 bits (391), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 54/275 (19%), Positives = 110/275 (40%), Gaps = 8/275 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
                DI     +    +    +++ ++    LS+FP IV   ++   +     +   + 
Sbjct: 37  LKGWIDIGKRVYKEMNVDHVQIVSAGVAFYFFLSIFPTIVVAISIYSLVLDPIQIQEQLS 96

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYR 121
            +    PE     ITD +  V+    K +     +S L + + ++ G  AL   +N AY 
Sbjct: 97  RLTLILPEQAYGMITDILNPVINQDRKEIGWGLLVSILVSIWSANKGTSALFQGVNIAYD 156

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             + R      L++  + L   V  +I   + +  PL +  +         L  ++   R
Sbjct: 157 ETDNRGLIKKNLLTLLFTLAGVVIGLISLLIVIFFPLLVKNI----GLTPGLEDMLTWLR 212

Query: 182 IYATMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                + L   L  V+   P   + K   +  G I   I W+ G++ F+ Y+  F +Y  
Sbjct: 213 WVFLGIILISTLSMVYKIAPNRSRPKFRWVSWGAILGTIFWLAGSMGFSWYVGNFGSYDD 272

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           +Y   A++   +++L++     ++GAE+N+ M   
Sbjct: 273 LYGSFAAVAILMLWLFLTAFIVLMGAEINSEMEHQ 307


>gi|299530470|ref|ZP_07043890.1| putative ribonuclease BN [Comamonas testosteroni S44]
 gi|298721446|gb|EFI62383.1| putative ribonuclease BN [Comamonas testosteroni S44]
          Length = 599

 Score =  155 bits (391), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 48/260 (18%), Positives = 100/260 (38%), Gaps = 9/260 (3%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI--DVVFGAWPE 72
            +  F E+     AS ++ ++LL++ PF      L            V+   ++    PE
Sbjct: 206 LLARFKEDRLGVTASSLTFTSLLALVPFFTVALALFTAFPIFGKAQKVLERWLMDSLIPE 265

Query: 73  VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
            IA+ +   + Q  A  A  L  +        +   +  +  +LN  +RV ++R      
Sbjct: 266 TIARQVLGYLTQF-ASKASQLGLVGFSILMVTAIALILTIDRTLNNIWRVRQLRPLGQRV 324

Query: 133 LISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIG 192
           LI +  + L  + L +   +   +  A   +    P        +         + L  G
Sbjct: 325 LIYWAAITLGPLLLGLSLVLSSYVMSASKGMVNALPGS------LRFVFDSIEFVVLAAG 378

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
           +  ++ ++P    +    L G +F  +   V   +   Y+ +  TYS +Y   A++   L
Sbjct: 379 MAGLYHYVPNTPVRWRHALVGGVFVAVFMEVAKKVLGLYLSSVPTYSVIYGAFATLPILL 438

Query: 253 VFLYMLGVFFILGAELNASM 272
           +++Y+     +LGA + A +
Sbjct: 439 IWMYVAWSIVLLGALVTAYL 458


>gi|50953981|ref|YP_061269.1| membrane protein [Leifsonia xyli subsp. xyli str. CTCB07]
 gi|50950463|gb|AAT88164.1| membrane protein [Leifsonia xyli subsp. xyli str. CTCB07]
          Length = 348

 Score =  155 bits (391), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 53/270 (19%), Positives = 106/270 (39%), Gaps = 2/270 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            I+   +  F  +    +A+ ++   +L++FP ++   ++ G +G  +     +  +   
Sbjct: 19  HILKRTLRSFGRDACTDLAAGLTYFGVLALFPALIALVSVLGLVGQSKTGIDALFGMADQ 78

Query: 70  WPEVIAKPITDEILQVLAVPAKGLF-TISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
               +       I  +   PA G    I  + A + +S  V     +LNR Y V E RS 
Sbjct: 79  LAPGMLDVAHGPIEALSTSPATGWGLVIGIVGALWSASGYVGGFGRALNRVYGVEEGRSA 138

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           ++ R +  G  + A   + I++ V V        +                 R  A  +A
Sbjct: 139 FVLRPVQLGVTVAAVALVAIVAVVLVVSGPIARTIGGAIGLGDAAQTAWEILRWPAVAVA 198

Query: 189 LFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           L + +  ++   P  K      +  G     +   V +VLF  Y+    +Y   Y  LA 
Sbjct: 199 LVVLVALLYSATPNVKRPGFRWLTAGSFTAIVLLGVASVLFAFYVANVGSYDKTYGALAG 258

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           ++  L+++++  V  +LGAEL++ +     
Sbjct: 259 VIVFLLWIWIANVALLLGAELDSEIERARQ 288


>gi|228476335|ref|ZP_04061036.1| transporter [Staphylococcus hominis SK119]
 gi|228269618|gb|EEK11124.1| transporter [Staphylococcus hominis SK119]
          Length = 402

 Score =  155 bits (391), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 63/270 (23%), Positives = 124/270 (45%), Gaps = 2/270 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L++FP ++F   L            + D+V   
Sbjct: 66  NFLSYLIYRIGKDDASGLAAQMTYHFVLALFPMLIFLLTLLPLFQIDP--QQIKDLVSQN 123

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   A  +T     + +  +  L ++  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 124 APAETADVVTKIFKDITSNSSGSLLSVGLILAIWSASNGMTAIMNSFNVAYDVEDARNPI 183

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++ ++ L I   +         ++         +  I    RI   ++ +
Sbjct: 184 VLKLLSILFTIVMAIVLAIALTLPTFGNFIKDHLFGPLGLDQQVAWIFDLVRILLPLIVI 243

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            I  + ++   P  K+K  S+ PG IFT I W++G+  F  Y+  F  YS  Y  LA I+
Sbjct: 244 IILFLTLYSVAPNVKTKFKSVYPGAIFTSIVWLLGSFAFGWYLSNFGNYSKTYGSLAGII 303

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L+++Y+     I+GAE+NA +   +  K
Sbjct: 304 ILLLWIYITCFIIIIGAEINAIIHQRHVIK 333


>gi|229592220|ref|YP_002874339.1| putative ribonuclease [Pseudomonas fluorescens SBW25]
 gi|229364086|emb|CAY51687.1| putative ribonuclease [Pseudomonas fluorescens SBW25]
          Length = 316

 Score =  155 bits (391), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 62/275 (22%), Positives = 125/275 (45%), Gaps = 1/275 (0%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
             +  ++   ++ FV+++    AS ++   L S+FPF++F   L GFL    F   +   
Sbjct: 9   LKLHKVLVRTVKEFVDDEMPTYASALAYQMLFSLFPFLLFLIALIGFLHLPDFFTWLRLQ 68

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
                P    + +   I Q+      GL ++  + A + +S GV  +  ++N AY VVE 
Sbjct: 69  SELVLPPQALEQVNPVIDQLQQSK-GGLLSVGIVIALWTASAGVRLMMSAMNAAYDVVEG 127

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R  +    +S  Y +  +  L+  + + V  P  + ++         ++ +    R    
Sbjct: 128 RPIWKRFPLSIFYTVGIAGMLLAAAALMVLGPQVMEWLAGQIGMQEFVVTLWTIVRWPLI 187

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           ++ L   +  ++  +P  + K   I PG +   + W+V ++ F +Y+ TF+ Y+ MY  +
Sbjct: 188 VILLMFAVALMYYVMPDVEQKFRFITPGSVLAVVVWIVASLGFGYYVKTFADYNAMYGSI 247

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            +I+  L++ Y+     +LGAE+NA +       K
Sbjct: 248 GAIIVLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|332531931|ref|ZP_08407815.1| ribonuclease BN [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038558|gb|EGI75001.1| ribonuclease BN [Pseudoalteromonas haloplanktis ANT/505]
          Length = 317

 Score =  155 bits (391), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 56/278 (20%), Positives = 120/278 (43%), Gaps = 8/278 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
           F   +DI+    +   E++   +A+ ++  ALL++FP I    ++  +  +   +   + 
Sbjct: 18  FIGWWDIVKRIFKQMSEDNLSIVAAGVAFYALLAIFPAIAAMVSVYAYFSSPADISDHLS 77

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYR 121
            +    P   ++ I  ++  +    +  L      + +   + SS G +AL  + N +YR
Sbjct: 78  KIVTLLPPSTSELILSQVSSLAKTSSASLSLSAIGTLILTIWSSSKGSQALITACNISYR 137

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             E RS++  +L+ F + + A V  +    +   +P+ L  V        ++ L+I    
Sbjct: 138 EYEKRSFFQAQLVRFLFSVGAIVVAIFALLIIGILPIVLNLV----GLKESIDLLIKLIS 193

Query: 182 IYATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                      L+ ++ + P  K  K   I  G     + W++ ++ F+ Y+  FS+Y+ 
Sbjct: 194 WPLLAFTFNFALVLLYRYAPHRKPAKWRWITMGSSIATVLWILASIGFSFYVSRFSSYNE 253

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            Y  L  ++  L++LY+      LGA +NA+      +
Sbjct: 254 TYGSLGGVVIMLMWLYISAYIITLGAVINAATEQQTGK 291


>gi|146277245|ref|YP_001167404.1| putative ribonuclease BN [Rhodobacter sphaeroides ATCC 17025]
 gi|145555486|gb|ABP70099.1| putative ribonuclease BN [Rhodobacter sphaeroides ATCC 17025]
          Length = 322

 Score =  155 bits (391), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 58/273 (21%), Positives = 123/273 (45%), Gaps = 8/273 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI         E+    +A+ ++   LL++FP +    +L G       +   ++ + G 
Sbjct: 28  DIALRVWRSIDEDRVMLVAAGVTFYLLLALFPTLAAFVSLYGLFADPAVIADQVESLRGV 87

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P    + +T ++  +    +  L     IS L A + +++G++AL  ++N A+   E R
Sbjct: 88  LPAEGIELVTAQLRTLAGGQSASLTVGFAISFLIAFWSANSGMKALIEAMNIAHDEREKR 147

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+    L+SF   L A    + +S + +     +  V   F       +++W  R    +
Sbjct: 148 SFLKLTLLSFALTLGA----MTLSILMITAVAVVPAVLAIFDLGSGASVLVWLVRWPLLL 203

Query: 187 LALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           L +   +  ++ + P+ K+     +  G     + W+V ++ FT Y+  F+ YS  Y  L
Sbjct: 204 LVVAGAMAALYRWAPSRKAPEWRWVTWGSGIATVVWLVASIAFTIYLENFANYSATYGSL 263

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            +++  L+++++  +  I+GAE+N+ M     R
Sbjct: 264 GALVGLLLWIWIAVMILIIGAEINSEMEHQTAR 296


>gi|115525638|ref|YP_782549.1| putative ribonuclease BN [Rhodopseudomonas palustris BisA53]
 gi|115519585|gb|ABJ07569.1| putative ribonuclease BN [Rhodopseudomonas palustris BisA53]
          Length = 370

 Score =  155 bits (391), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 61/275 (22%), Positives = 121/275 (44%), Gaps = 8/275 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
             DII+   E   ++   A+A+ +    LL++FP I    +    +   Q +   +  + 
Sbjct: 74  WRDIIWRTYEQINDDRLLAVAAGVVFYGLLALFPAITALVSSYALVADPQTIRDHLSFLA 133

Query: 68  GAWPEVIAKPITDEILQVLAVPA---KGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
           G  P      + D+I +VLA         F  S   A + ++ G++A+  +LN  Y   E
Sbjct: 134 GVLPAGTFSVVEDQIARVLAKGEVKLGAAFLFSFALALWSANGGMKAIIDALNVVYDEEE 193

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R +     +S  + L   + ++    + VA P+ L+ V           L++  GR  A
Sbjct: 194 KRGFIKLNAVSLAFTLGGLLAVLAAIGLVVAAPILLSMV----GLGTIGDLLLRFGRWPA 249

Query: 185 TMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
             + +  GL  ++ F P+ +S     I  G +   + W+VG+   ++Y+  +  Y   Y 
Sbjct: 250 LAVMILAGLAVLYRFAPSRRSPQWKWISVGSVSATVIWLVGSAALSYYLANYGAYDATYG 309

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            L + +  +++++M  +  +LGAELN+ +     +
Sbjct: 310 SLGAAIGLMIWMWMSTIVVLLGAELNSEIEHQTVK 344


>gi|313497651|gb|ADR59017.1| Putative ribonuclease BN [Pseudomonas putida BIRD-1]
          Length = 318

 Score =  155 bits (391), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 60/273 (21%), Positives = 126/273 (46%), Gaps = 1/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +  ++   ++ F++++    AS ++  AL S+FPF++F   L GFL    F   +     
Sbjct: 11  LHRVLVRTVKEFLDDEMSTYASALAYQALFSLFPFLLFLIALIGFLHLPDFFSWLRLQSE 70

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P    + +   I Q+      GL ++  + A + +S GV  +  ++N AY V E R 
Sbjct: 71  LVLPPQALEQVNPVIDQLQQSK-GGLLSVGIVIALWTASAGVRLMMSAMNAAYDVPEGRP 129

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            +    +S  Y +  +  L+  + + V  P  + ++         ++ +    R    ++
Sbjct: 130 VWKRIPLSIFYTVGLAGMLLAAAALMVLGPQVMEWIAAQIGMQEFIVTLWTILRWPVIII 189

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            L + +  ++  +P  + +   I PG +   + W+V ++ F +Y+ TF+ Y+ MY  + +
Sbjct: 190 LLMVAVALIYYVMPDVEQQFRFITPGSVLAVVVWIVASLGFAYYVKTFADYNAMYGSIGA 249

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  L++ Y+     +LGAE+NA +       K
Sbjct: 250 IIVLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|288559254|sp|A4VNB9|Y2825_PSEU5 RecName: Full=UPF0761 membrane protein PST_2825
 gi|327481526|gb|AEA84836.1| membrane protein [Pseudomonas stutzeri DSM 4166]
          Length = 410

 Score =  154 bits (390), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 43/283 (15%), Positives = 101/283 (35%), Gaps = 9/283 (3%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV- 59
           M +     F+     +  F+ + G   A+ ++ + L +V P +     +   + A + V 
Sbjct: 1   MHQRIDNTFEFGRFLVRRFMADQGPQSAAALTYTTLFAVVPMMTVTFAMLSAIPAFKGVG 60

Query: 60  PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +   +F  +       I + +L   +   + L           +   +  +  + N  
Sbjct: 61  EQIQFYIFNNFIPSTGATIQEYLLAFTSQARQ-LTWFGVGFLMATALMMLLTIEKAFNTI 119

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +RV + R    + L+ +  + L  + L         I         +          +  
Sbjct: 120 WRVRQPRRGVSSFLLYWAILSLGPLLLGAGFATSTYIASLSLISGPYALIG------VGT 173

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                 +L        ++  +P  +  +   L G +FT + +     +F  Y+  F +Y 
Sbjct: 174 LIKVMPLLLSVAAFTLIYAAVPNTRVPLRHALVGGVFTAVLFEAAKQMFGVYVSYFPSYQ 233

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASM-IIYYWRKKP 281
            +Y   A++   L+++Y+  +  + GAEL   +     WR++P
Sbjct: 234 LIYGAFAAVPLFLLWIYLSWMIVLFGAELVCGLSSSQQWRRRP 276


>gi|167622301|ref|YP_001672595.1| ribonuclease BN [Shewanella halifaxensis HAW-EB4]
 gi|167352323|gb|ABZ74936.1| putative ribonuclease BN [Shewanella halifaxensis HAW-EB4]
          Length = 326

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 49/275 (17%), Positives = 106/275 (38%), Gaps = 8/275 (2%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R +   ++      +  F E+     A H++   LLS+ P +    ++         +  
Sbjct: 6   RSFLLSIWAFFLHLLSRFKEDQVNIKAGHLAYVTLLSLVPIVAVMFSMLSAFPVFSGIRE 65

Query: 62  -VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            +   V+  +       +   I + +A  +KG  ++   A    +   + A+  +LN  +
Sbjct: 66  KLEAFVYNNFLPAAGDTVQIYINEFVANASKG-TSVGIAALVVVALMLISAIDKALNSIW 124

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           R  E R   ++  + +  + L  V +         I     +          L  ++   
Sbjct: 125 RTKEKRQAAVSFSMYWMVLTLGPVLVGASLVATSYIVSLKVFNTS------ELSGVVPIL 178

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                ML      + +++ +P  K K +  L G +   + + +G   F +Y+  F +Y  
Sbjct: 179 IERLPMLFSVAAFLLLYMVVPIKKVKFLHALLGALVAAMLFELGKKGFAYYVTQFPSYEA 238

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           +Y  LA+I    V++Y+  V  ++GAE+ A +  Y
Sbjct: 239 IYGALATIPILFVWVYVSWVIVLVGAEITAGLPEY 273


>gi|170781551|ref|YP_001709883.1| putative integral membrane protein [Clavibacter michiganensis
           subsp. sepedonicus]
 gi|169156119|emb|CAQ01258.1| putative integral membrane protein [Clavibacter michiganensis
           subsp. sepedonicus]
          Length = 394

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 57/268 (21%), Positives = 113/268 (42%), Gaps = 3/268 (1%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH-QFVPTVIDVVFGAWP 71
             A+  F++  G  M + ++  + LS+ P  V   +L G +G     V  V+ V+     
Sbjct: 40  RRAVYGFMKHRGIDMTASLTFYSTLSLVPAAVAVLSLIGVVGDTRAGVEGVLAVLTSVLG 99

Query: 72  EVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           +     I D + Q+   P  G+ FT+S L A + S+  V A   ++NR     E R    
Sbjct: 100 DSAVDVIRDPVEQLADGPRSGVAFTVSFLGALWTSAAYVTAFGRAMNRVQETEEGRPLVK 159

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            R +  G  +   V  V+M  + +        + +        L++    +    +  L 
Sbjct: 160 YRALMLGVTIALLVVSVVMVGMLLLTDEGARALGQQLGLGDTTLVVWAVVKWPLLVALLT 219

Query: 191 IGLIFVHLFLPAAKSKIMSIL-PGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
             +  ++   P  + + + +L  G +   ++W +G   F  Y+   +TY + Y  L +++
Sbjct: 220 GIIGVLYAATPNLRRRRVDLLTWGSLVAIVAWGLGTAGFVAYVTHVATYESTYGVLGAVI 279

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYW 277
             L++LY+  +  +LG EL+  +I    
Sbjct: 280 VLLLWLYIGNLSLVLGGELDVEIIRARQ 307


>gi|298293294|ref|YP_003695233.1| ribonuclease BN [Starkeya novella DSM 506]
 gi|296929805|gb|ADH90614.1| ribonuclease BN [Starkeya novella DSM 506]
          Length = 375

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 59/275 (21%), Positives = 119/275 (43%), Gaps = 8/275 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
           +    DI+      F  +   ++++ ++   LL++FP +    +L G       + + ++
Sbjct: 77  YRGWRDILIRTFNEFFADRVLSLSAGVTFYTLLAIFPALAAFISLYGLFLDPASIQSQLE 136

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLNRAYR 121
                 P    + + D+I ++LA     L   S      A + ++ G +A+  +LN AY 
Sbjct: 137 AASWFLPAGAVEVMRDQIARLLANGPSSLGLRSFFSLALALWSANAGTKAVIEALNIAYE 196

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             E RS+    L + G+ L A +  V+     VA+PL L  +            +I   R
Sbjct: 197 EEERRSFVRLTLTTLGFTLAAILFAVVALAAVVALPLVLKVLY----LPSGTEWLISLLR 252

Query: 182 IYATMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
             A  + +   +  V+ F P   + +   +  G     + W+  +V F+ Y+  F++Y  
Sbjct: 253 WPALAVVVAFVITVVYRFGPCRQRPQWRWVSMGSAVAAVLWLATSVGFSWYVSRFASYEQ 312

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            Y  L +++  +V++++     +LGAELNA +   
Sbjct: 313 TYGSLGAVVGFMVWIWLSVTVVLLGAELNAEIEHQ 347


>gi|292493155|ref|YP_003528594.1| ribonuclease BN [Nitrosococcus halophilus Nc4]
 gi|291581750|gb|ADE16207.1| ribonuclease BN [Nitrosococcus halophilus Nc4]
          Length = 456

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 45/267 (16%), Positives = 98/267 (36%), Gaps = 2/267 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           + +      + Y     F E +    A+ +  + LLS+ P +    ++    G H  +  
Sbjct: 28  QAFLRPKLKLTYVVSREFFEGELTLRATSLVYTTLLSLAPLLAVSFSVLKAFGVHNQMEP 87

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           V+            +  T  I  V  +    L +I      Y   + ++ +  + N  +R
Sbjct: 88  VLHHFLLPLGPRAEEITTRIIQYVENLKVGALGSIGLGLLFYTVVSLIQKIESAFNHVWR 147

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           +   R +          +L+  V +        ++        +       L   +    
Sbjct: 148 IKRERPFLRRFSDYLSVLLIGPVLVFSAVGATASVMQTS--FIQTLLEFEVLGKALVAMS 205

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                L +  G  F++ FLP  K +  + L G     + W    +LF  +I T + Y  +
Sbjct: 206 KLLPYLLVIGGFTFIYAFLPNTKVRFGNALVGGAVAGVLWETIGLLFAFFITTSTKYDAI 265

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAEL 268
           Y+ LA ++  +++LY+  +  ++GA++
Sbjct: 266 YSSLAILILFMIWLYISWLILLVGAQV 292


>gi|221066065|ref|ZP_03542170.1| ribonuclease BN [Comamonas testosteroni KF-1]
 gi|220711088|gb|EED66456.1| ribonuclease BN [Comamonas testosteroni KF-1]
          Length = 590

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 48/260 (18%), Positives = 100/260 (38%), Gaps = 9/260 (3%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI--DVVFGAWPE 72
            +  F E+     AS ++ ++LL++ PF      L            V+   ++    PE
Sbjct: 197 LLARFKEDRLGVTASSLTFTSLLALVPFFTVALALFTAFPIFGKAQKVLERWLMDSLIPE 256

Query: 73  VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
            IA+ +   + Q  A  A  L  +        +   +  +  +LN  +RV ++R      
Sbjct: 257 TIARQVLGYLTQF-ASKASQLGLVGFSILMVTAIALILTIDRTLNNIWRVRQLRPLGQRV 315

Query: 133 LISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIG 192
           LI +  + L  + L +   +   +  A   +    P        +         + L  G
Sbjct: 316 LIYWAAITLGPLLLGLSLVLSSYVMSASKGLVNALPGS------LRFVFDSIEFVVLAAG 369

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
           +  ++ ++P    +    L G +F  +   V   +   Y+ +  TYS +Y   A++   L
Sbjct: 370 MAGLYHYVPNTPVRWRHALVGGVFVAVFMEVAKKVLGLYLSSVPTYSVIYGAFATLPILL 429

Query: 253 VFLYMLGVFFILGAELNASM 272
           +++Y+     +LGA + A +
Sbjct: 430 IWMYVAWSIVLLGALVTAYL 449


>gi|238063813|ref|ZP_04608522.1| ribonuclease BN [Micromonospora sp. ATCC 39149]
 gi|237885624|gb|EEP74452.1| ribonuclease BN [Micromonospora sp. ATCC 39149]
          Length = 340

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 47/282 (16%), Positives = 105/282 (37%), Gaps = 7/282 (2%)

Query: 2   REYFCIVFD-IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           R+     +  ++  +  +FV+++    A+ ++   +L++FP  +    L G +   +   
Sbjct: 37  RQLSWPTWRGVLLRSGRNFVKDNCADWAAALTYYGVLALFPSAIVVVALVGLVSDGERTV 96

Query: 61  TVIDVVFGAWPEVIA---KPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRIS 115
             +  +                  +  V+   +    L +   L A + +S  + A   +
Sbjct: 97  DTVIDLAREVGAGSVVGNDGFVSAVRGVVDQQSGTKALLSFGLLGALWSASGFIGAFTRA 156

Query: 116 LNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLL 175
            N  Y V E R  +  R +  G   +  V L +++   +        V +   A G    
Sbjct: 157 SNAIYGVQEGRPVWKLRPLQIGLAAVTLVLLAVVATGLIVSGPVTDAVGELVGAGGLART 216

Query: 176 IIWNGRIYATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVT 234
           +    +     + + + L  +    P  +      + PG     +SW + +  F  Y+  
Sbjct: 217 VWGVAKWPVLAMVMMVLLSLLFWIAPNVRQPRFRWLTPGGAVALVSWALASFGFGLYVAN 276

Query: 235 FSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           F +Y   Y  L +++  LV+LY+     +LG ++NA +    
Sbjct: 277 FGSYDVTYGSLGAVIAFLVWLYLSNSALMLGVQINAELQRGR 318


>gi|187478768|ref|YP_786792.1| membrane-associated ribonuclease [Bordetella avium 197N]
 gi|115423354|emb|CAJ49888.1| putative membrane-associated ribonuclease [Bordetella avium 197N]
          Length = 438

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 47/280 (16%), Positives = 101/280 (36%), Gaps = 9/280 (3%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R +   +      A+    +E    +AS ++ + +L++ P +  G +L       Q    
Sbjct: 17  RSWLERLARAFRFALSRADKERLLEVASSLTFTTVLAIVPMLAVGLSLFTAFPVFQDFRL 76

Query: 62  VIDVVF--GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
            ++        P  ++  I D + Q  A  A  L  I        S   +  +  + N  
Sbjct: 77  ALEDFLANNLMPPEVSDNIMDYLNQF-ARQASRLTAIGGAFLVVTSLLLIMTIDKTFNDI 135

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           + V   R W    L+ +  + L  V      +    +       R+    + ++  I+  
Sbjct: 136 WHVGRQRPWPQRALVYWAVLTLGPVATGASLWATSFV------ARESMGLISDVPEIVSL 189

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
           G     +L   +G   + + +P  +      L G   T  +       F  Y+  F  Y+
Sbjct: 190 GISLVPLLLTGLGFSALFVVVPNCRVYWRDALTGGFCTAFALEAMKAGFALYLNRFPAYT 249

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            +Y   A++   L+++Y+  +  +LGA + A++      +
Sbjct: 250 VIYGAFATLPIFLLWIYLSWLAVLLGASIAANVPRVRLGR 289


>gi|298528711|ref|ZP_07016115.1| ribonuclease BN [Desulfonatronospira thiodismutans ASO3-1]
 gi|298512363|gb|EFI36265.1| ribonuclease BN [Desulfonatronospira thiodismutans ASO3-1]
          Length = 443

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 44/276 (15%), Positives = 106/276 (38%), Gaps = 1/276 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           + +      +   A++ F   D    AS ++   LLS+ P +     +A   G    + +
Sbjct: 25  KAFMTHHLRVFLAALQGFSRNDCSMRASSLTYYTLLSIVPVMALAFGIAKGFGLDDMLQS 84

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
            ++   GA  E+  + +      +       +  +  L   +     ++ + +S N  + 
Sbjct: 85  QLEQYLGAHEEIFDEVVQFSYSMLEVTRGGVIAGVGFLFLLWAVIKVLDHIELSFNAVWG 144

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E RSW          ++LA V +++   + V +   +         L  +  +   G 
Sbjct: 145 VQEGRSWVRKFTEYLSVMVLAPVLVILSGSLTVFLTTEIYKYLAE-GWLALVADLFQWGA 203

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
            +   + +++   F+ + +P  +    + L   I +   + +    + ++ V    Y+ +
Sbjct: 204 QFTPYVIIWLLFTFLFMAMPNTRVNFKAALIAGIISGTMFQLLQWGYVNFQVGVVRYNAI 263

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           Y   A++   LV+L +  +  +LGAEL+ +      
Sbjct: 264 YGSFAALPLFLVWLQLSWMIVLLGAELSYAYQNVRR 299


>gi|78223975|ref|YP_385722.1| ribonuclease BN [Geobacter metallireducens GS-15]
 gi|78195230|gb|ABB32997.1| tRNA-processing RNAse BN [Geobacter metallireducens GS-15]
          Length = 453

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/279 (17%), Positives = 96/279 (34%), Gaps = 5/279 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +        I    ++ F+++     AS ++ S LLS+ PF      +    G    +  
Sbjct: 31  KGRLLRCLQIGALVVKDFLDDQCLIRASALAFSTLLSIVPFFALAFAVLKGFGVQNTLE- 89

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
               +         + +   +  +       L  I   A        +  +  + N  + 
Sbjct: 90  --PFILDQVAAGSHEIVDKIVAYINNTKVGSLGAIGLAALFVTVVTLLGNVEEAFNAIWG 147

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E RS Y         ++   + L         I        ++      L   +    
Sbjct: 148 VRETRSLYRKFSDYLSVLVSGPILLFAAVSTTTTIE--SQAFVQWIMGYTYLGDALLALF 205

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                L+++I L+F+++F+P  K +  S L G I     W      + H+ V  + Y+ +
Sbjct: 206 RLVPYLSIWIALVFLYMFIPNTKVRFRSALVGGIIAGTIWQGAQWGYIHFQVGVAKYNAI 265

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           Y  LA +   +V+LY   V  +LG E+  +       ++
Sbjct: 266 YGTLAVLPVFMVWLYASWVIVLLGGEVVYAHQHLRTFRR 304


>gi|330957628|gb|EGH57888.1| ribonuclease BN [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 323

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 65/271 (23%), Positives = 123/271 (45%), Gaps = 1/271 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            ++   +  F++++    AS ++   L S+FPF++F   L GFL    F   +       
Sbjct: 13  KVLVRTVNEFLDDEMSTYASALAYQMLFSLFPFLLFLIALIGFLHLPDFFSWLRLQSEFL 72

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P    + +   I Q+      GL +I  + A + +S GV  +  ++N AY VVE R  +
Sbjct: 73  LPPQALEQVNPVIDQLQQSK-GGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIW 131

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
               +S  Y +  +  L+  +   V  P  + ++         ++ +    R  A +L L
Sbjct: 132 KRFPLSILYTIGIAGMLLAAAAFMVLGPQVMNWIAAQVGMEEFIVTLWTILRWPAIILLL 191

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            I +  ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+
Sbjct: 192 MIAVALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAII 251

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             L++ Y+     +LGAE+NA +       K
Sbjct: 252 VLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|298506496|gb|ADI85219.1| membrane-bound transcriptional regulator, ribonuclease BN-related
           [Geobacter sulfurreducens KN400]
          Length = 438

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 41/279 (14%), Positives = 97/279 (34%), Gaps = 5/279 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R            A+ +F+++     AS ++ S LLS+ PF      +   LG    +  
Sbjct: 28  RGRLVAALQATVTAVGNFMDDQCLLHASALTYSTLLSIVPFFALAFAVLKGLGVQNTLE- 86

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
               +         + +   +  +       L  +  +     +   +  +  + N  + 
Sbjct: 87  --PFILDQVAAGSHEIVDRIVTYINNTKVGSLGAVGLVTLVVSTVTLLGNIEETFNSIWG 144

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E RS Y         V+   + +     V   +        ++      L  ++    
Sbjct: 145 VRETRSLYRRFSDYLSVVVFGPILIFAAISVTTTLES--QKAVQWLIGTAYLGDVLVAAF 202

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                +++++ L+F+++ +P  K +  S L G +     W      + H+ V  + Y+ +
Sbjct: 203 RLVPYISIWLALVFLYMLIPNTKVRFRSALVGGVIAGTLWQAAQWGYIHFQVGVAKYNAI 262

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           Y  LA +   +++LY      + G E+  +       ++
Sbjct: 263 YGTLAVLPVFMIWLYASWSIVLFGVEVVYAHQHRRTFRR 301


>gi|330967398|gb|EGH67658.1| ribonuclease BN [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 323

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 64/275 (23%), Positives = 124/275 (45%), Gaps = 1/275 (0%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
             +  ++   +  F++++    AS ++   L S+FPF++F   L GFL    F   +   
Sbjct: 9   LRIGKVLVRTVNEFLDDEMSTYASALAYQMLFSLFPFLLFLIALIGFLHLPDFFSWLRLQ 68

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
                P    + +   I Q+      GL +I  + A + +S GV  +  ++N AY VVE 
Sbjct: 69  SELVLPPQALEQVNPVIDQLQQSK-GGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEG 127

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R  +    +S  Y +  +  L+  +   V  P  + ++         ++ +    R  A 
Sbjct: 128 RPIWKRFPLSILYTVGIAGMLLAAAAFMVLGPQVMNWIAAQIGMEDFIVTLWTILRWPAI 187

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +L L + +  ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  +
Sbjct: 188 ILLLMVAVALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSI 247

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            +I+  L++ Y+     +LGAE+NA +       K
Sbjct: 248 GAIIVLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|291613211|ref|YP_003523368.1| ribonuclease BN [Sideroxydans lithotrophicus ES-1]
 gi|291583323|gb|ADE10981.1| ribonuclease BN [Sideroxydans lithotrophicus ES-1]
          Length = 415

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 44/269 (16%), Positives = 93/269 (34%), Gaps = 7/269 (2%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH-QFVPTVIDVVF 67
           F  +        E+    MA+ ++ + LLSV P I     L     +  ++   + + + 
Sbjct: 22  FRFLRYVTVRLQEDRCTQMAASLTFTTLLSVVPLITIALILFSAFPSFSEYSTPIKEFIL 81

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
                     I    +Q     A  L     +  A  +   +  +  + N  +RV   RS
Sbjct: 82  KNMVPETGGRIITSYMQQFTESASRLTAAGLVFLAVTAMLLMLTIDNAFNMIWRVSRPRS 141

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
                L+ +  + LA + +     +   +    A   +  P++G              ++
Sbjct: 142 LLQRVLVYWAVLTLAPLLVGGSLSLTSWLVGFSAEYARQVPSIGMD------VLKLLPVV 195

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
                   +   +P     +   L G +   +++      F  YI  F+ Y  +Y   AS
Sbjct: 196 MTTAAFTLLFRVVPNRYVPMPHALIGGLIAAVAFESMNRAFAFYISHFANYKLVYGAFAS 255

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYY 276
           +   L+++Y   +  + GA + AS+  + 
Sbjct: 256 VPIFLMWVYFSWITVLFGAIITASLSHWR 284


>gi|28868803|ref|NP_791422.1| ribonuclease BN [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213969591|ref|ZP_03397727.1| ribonuclease BN [Pseudomonas syringae pv. tomato T1]
 gi|302058803|ref|ZP_07250344.1| ribonuclease BN, putative [Pseudomonas syringae pv. tomato K40]
 gi|302134492|ref|ZP_07260482.1| ribonuclease BN, putative [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|28852042|gb|AAO55117.1| ribonuclease BN, putative [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213925687|gb|EEB59246.1| ribonuclease BN [Pseudomonas syringae pv. tomato T1]
 gi|331017340|gb|EGH97396.1| ribonuclease BN, putative [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 323

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 64/271 (23%), Positives = 123/271 (45%), Gaps = 1/271 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            ++   +  F++++    AS ++   L S+FPF++F   L GFL    F   +       
Sbjct: 13  KVLLRTVNEFLDDEMSTYASALAYQMLFSLFPFLLFLIALIGFLHLPDFFSWLRLQSELV 72

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P    + +   I Q+      GL +I  + A + +S GV  +  ++N AY VVE R  +
Sbjct: 73  LPPQALEQVNPVIDQLQQSK-GGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIW 131

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
               +S  Y +  +  L+  +   V  P  + ++         ++ +    R  A +L L
Sbjct: 132 KRFPLSILYTVGIAGMLLAAAAFMVLGPQVMNWIAAQIGMEDFIVTLWTILRWPAIILLL 191

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + +  ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+
Sbjct: 192 MVAVALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAII 251

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             L++ Y+     +LGAE+NA +       K
Sbjct: 252 VLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|237798880|ref|ZP_04587341.1| ribonuclease BN [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331021734|gb|EGI01791.1| ribonuclease BN [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 323

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 63/271 (23%), Positives = 123/271 (45%), Gaps = 1/271 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            ++   +  F++++    AS ++   L S+FPF++F   L GFL    F   +       
Sbjct: 13  KVLVRTVNEFLDDEMSTYASALAYQMLFSLFPFLLFLIALIGFLHLPDFFSWLRLQSEFL 72

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P    + +   I Q+      GL +I  + A + +S GV  +  ++N AY VVE R  +
Sbjct: 73  LPPQALEQVNPVIDQLQQSK-GGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIW 131

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
               +S  Y +  +  L+  +   V  P  + ++         ++ +    R  A ++ L
Sbjct: 132 KRFPLSILYTVGIAGMLLAAAAFMVLGPQVMNWIAAQVGMEEIIVTLWTILRWPAIIILL 191

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + +  ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+
Sbjct: 192 MVAVALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAII 251

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             L++ Y+     +LGAE+NA +       K
Sbjct: 252 VLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|319943764|ref|ZP_08018045.1| YihY family protein [Lautropia mirabilis ATCC 51599]
 gi|319742997|gb|EFV95403.1| YihY family protein [Lautropia mirabilis ATCC 51599]
          Length = 653

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 37/264 (14%), Positives = 101/264 (38%), Gaps = 2/264 (0%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
           F     +    +           A+ +  + LLS+ P +    +++   G H  +   + 
Sbjct: 29  FLKALAVFLAVVRDLAFGQLMLRATSLVYTTLLSIVPVLALTFSVSKAFGVHGQIEPALQ 88

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
                     A+  T+ +  +  +    L ++      + + + +  +  S+N  + V  
Sbjct: 89  RFMEPLGPKGAEITTNIMSFIDNMHVGVLGSVGLGMLLFTAVSTILKIESSINTIWHVKT 148

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
           MR            +LL  + +V    +     LA +++ +   ++     +        
Sbjct: 149 MRPLSQRISYYLCVMLLGPILVVSALGL--NATLASSHLVQMIISVEPFGHLAVLAGRLL 206

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
             + +    +F++LF+P  + +++  L   +   I W      F  ++   + Y+ +Y+ 
Sbjct: 207 PYVLVIGLFLFLYLFMPNTRVRLLPALTSALVAGICWQSAGWAFARFVAGSTQYAAIYSS 266

Query: 245 LASIMTCLVFLYMLGVFFILGAEL 268
           LA ++  +++LY+  +  ++GA +
Sbjct: 267 LAILIIFMIWLYVSWIVVLVGASV 290


>gi|229494654|ref|ZP_04388414.1| tRNA processing ribonuclease BN [Rhodococcus erythropolis SK121]
 gi|229318447|gb|EEN84308.1| tRNA processing ribonuclease BN [Rhodococcus erythropolis SK121]
          Length = 321

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 49/253 (19%), Positives = 103/253 (40%), Gaps = 3/253 (1%)

Query: 31  ISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVP 89
           ++  ++LS+FP ++   +L G  G     V  V+ +V    P    + + + + Q +  P
Sbjct: 1   MTYYSVLSLFPAVLAVVSLLGVFGQGQSTVDAVLQIVSDLGPSSAVETLKEPVQQHVEAP 60

Query: 90  AKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVI 148
           A G         A + +S  + A   +LNR Y V E R  +  R       + A   +  
Sbjct: 61  AAGFALIAGIAGALWSASGYLVAFGRALNRMYEVEEGRPVWKLRPTMLLVTVTALALIGC 120

Query: 149 MSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSK-I 207
            + +          +     A    L +    R    ++ + + +  ++   P  +    
Sbjct: 121 AAVMLAVSGPVARAIGDASGAGDTALTVWNIARWPVVLVFVVLAVAILYYAPPNIQQPKF 180

Query: 208 MSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAE 267
             I  G     + W++ +V+F  Y+  FS+Y+  Y  LA  +  L++L++  +  + GAE
Sbjct: 181 RWISGGAALAIVVWILASVIFGFYVANFSSYNKTYGSLAGAIVFLLWLWITNLALLFGAE 240

Query: 268 LNASMIIYYWRKK 280
           L++ +      ++
Sbjct: 241 LDSELERGRELRQ 253


>gi|108803594|ref|YP_643531.1| ribonuclease BN [Rubrobacter xylanophilus DSM 9941]
 gi|108764837|gb|ABG03719.1| ribonuclease BN, putative [Rubrobacter xylanophilus DSM 9941]
          Length = 328

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 61/272 (22%), Positives = 113/272 (41%), Gaps = 2/272 (0%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
              +   +E    +D   MA+ ++   +L++FPF++   +L G   + +    V+     
Sbjct: 38  LRALRATVEKLQRDDAAGMAAQLAYYLILALFPFMLVLVSLMGTFSSPELAEEVLAYFRQ 97

Query: 69  AWPEVIAKPITDEILQVL--AVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
             P+ +   I      V+    PA GL +   L   + +S    AL  +LN AY V E R
Sbjct: 98  VLPQQVYALIATYTGDVIRGEHPAPGLLSFGILLTLWSASGAFNALIKALNAAYEVQETR 157

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            ++  R ++ G  L  S  + +   + V  P     + +FF             R    +
Sbjct: 158 PFWKVRALAVGMTLGLSGLIFLGVLLMVFGPPIGEAIARFFGLGTVFEAAWNVARWPVAL 217

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           L L + +  ++   PA       I PG +   + WVV +  F+ Y+  F +Y+  Y  + 
Sbjct: 218 LFLVVTVALIYYLAPAVDQPFRWITPGGLVAVLLWVVASAAFSFYVNNFGSYNKTYGSIG 277

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
             +  L++LY+  +  + GA LNA++      
Sbjct: 278 VAIVLLLYLYISSLTILFGAALNATLARAKEE 309


>gi|301058912|ref|ZP_07199883.1| YihY family protein [delta proteobacterium NaphS2]
 gi|300446986|gb|EFK10780.1| YihY family protein [delta proteobacterium NaphS2]
          Length = 448

 Score =  152 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 48/278 (17%), Positives = 104/278 (37%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           + +       +  A+  F E+     AS ++  +LLS+ P +     +A   G  + +  
Sbjct: 34  KAFHIRTLRTVLLAVRAFNEDQCMFRASALTFYSLLSIVPVLAMAFGIAKGFGFQKALEH 93

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
            +   F    EVI          +       +  +  L   +     +  +  + N+   
Sbjct: 94  QLQETFYGHEEVIQNITVFANSMLETTKGGLIAGVGVLILFWTVIRVLGNVEGAFNQILN 153

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             E RS           +++ +  L++ S + V I   +    + F  LG +   I+   
Sbjct: 154 FPESRSLARKVSDYMSTMVICTFLLILSSTLTVVIKSQVTSAVESFSILGTVSPAIFFLL 213

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                  +++   F+++FLP  K     +LP  + T   + +    +  + +  + Y+ +
Sbjct: 214 KLLPYCVIWLLFTFLYMFLPNGKISWKFVLPAAVATGTLFQLFQWGYVSFQIGVTRYNAI 273

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           Y   A++   LV+L +  +  + GAEL  S+      K
Sbjct: 274 YGSFAALPLFLVWLQISWLIVLFGAELLFSIQNQKDYK 311


>gi|227819758|ref|YP_002823729.1| ribonuclease [Sinorhizobium fredii NGR234]
 gi|227338757|gb|ACP22976.1| putative ribonuclease protein [Sinorhizobium fredii NGR234]
          Length = 330

 Score =  152 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 56/272 (20%), Positives = 126/272 (46%), Gaps = 8/272 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           + D+ +  +    EE  + +A+ +S   LL++FP +    +L GF+     + + + V+ 
Sbjct: 34  IRDVFWRVVSEISEERVFLIAAGVSFYLLLALFPALGALVSLYGFVANPSDIGSHMAVLD 93

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRVVE 124
              P      I D++  +    A  L        L + + ++NG+ AL  ++N AY   E
Sbjct: 94  ELLPPGSFDLIADQLKSLTTQKASTLSLGFIGGLLVSLWSAANGIAALFDAMNVAYGEKE 153

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R      L+   +   A +  VI+      +P  LAY+         + ++    R  A
Sbjct: 154 KRGIVSRTLLCLAFTFAALLFAVILIVAIGVLPAMLAYL----WLDRWVEILTRVARWPA 209

Query: 185 TMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            ++   +G + ++ + P+  ++K+  +  G +F+ + W+  + ++++Y+  F+ Y+  Y 
Sbjct: 210 ILILATLGTVLIYRYGPSRERAKLRWLNWGAVFSTLLWLAASWIYSYYLENFANYNATYG 269

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            L +++  ++++++  V  I GA LNA +   
Sbjct: 270 ALGALIGFMMWVWISMVILITGALLNAELEHQ 301


>gi|319779629|ref|YP_004130542.1| Ribonuclease BN [Taylorella equigenitalis MCE9]
 gi|317109653|gb|ADU92399.1| Ribonuclease BN [Taylorella equigenitalis MCE9]
          Length = 445

 Score =  152 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 41/268 (15%), Positives = 103/268 (38%), Gaps = 9/268 (3%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI--DVVFGA 69
           +       ++E+   +A  ++ + +L++ P +    +L         +   +   +    
Sbjct: 39  LLYIYNRVLKENITQVAGTLTYTTVLAIVPLLAVILSLFTAFPMFNTMQGDLQNYMTSNL 98

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            PE I+  I + + Q       G+  + ++     S   ++ +   LN+ +RV + R  +
Sbjct: 99  MPESISDQIMNYLNQFAESAR-GMTVVGSVFLVITSIMLMKTVDEVLNKMFRVSKQRPLW 157

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           +  LI +  + +         +    +  A   +      + NL+  I+        +  
Sbjct: 158 VRILIYWAILSVGPFVFATSIWASSYVTRAKLGMGVDLSFVQNLVGTIF------PFILS 211

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI    ++  +P  +      L G     + +    + F +YI  F +Y+ +Y   A+I 
Sbjct: 212 FISFSLIYKIVPNRQVHWKDALIGGATAALLFEGLKLGFAYYISRFPSYTLIYGTFATIP 271

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYW 277
             L+++Y+  +  + GA L + +    +
Sbjct: 272 LFLLWIYISWIIVLAGALLVSMLPQLRY 299


>gi|289676936|ref|ZP_06497826.1| ribonuclease BN [Pseudomonas syringae pv. syringae FF5]
 gi|330896887|gb|EGH28477.1| ribonuclease BN [Pseudomonas syringae pv. japonica str. M301072PT]
 gi|330942464|gb|EGH45061.1| ribonuclease BN [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 321

 Score =  152 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 63/271 (23%), Positives = 123/271 (45%), Gaps = 1/271 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            ++   +  F++++    AS ++   L S+FPF++F   L GFL    F   +       
Sbjct: 13  KVLVRTVNEFLDDEMSTYASALAYQMLFSLFPFLLFLIALIGFLHLPDFFSWLRLQSEFL 72

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P    + +   I Q+      GL +I  + A + +S GV  +  ++N AY VVE R  +
Sbjct: 73  LPPQALEQVNPVIDQLQQSK-GGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIW 131

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
               +S  Y +  +  L+  +   V  P  + ++         ++ +    R  A ++ L
Sbjct: 132 KRLPLSILYTVGIAGMLLAAAAFMVLGPQVMNWIAAQIGMEDFIVTLWTILRWPAIIILL 191

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + +  ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+
Sbjct: 192 MVAVALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAII 251

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             L++ Y+     +LGAE+NA +       K
Sbjct: 252 VLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|325277884|ref|ZP_08143430.1| ribonuclease BN [Pseudomonas sp. TJI-51]
 gi|324096987|gb|EGB95287.1| ribonuclease BN [Pseudomonas sp. TJI-51]
          Length = 319

 Score =  152 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 61/273 (22%), Positives = 125/273 (45%), Gaps = 1/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +  ++   ++ F++++    AS ++  AL S+FPF++F   L GFL    F   +     
Sbjct: 11  LHRVLARTVKEFLDDEMSTYASALAYQALFSLFPFLLFLIALIGFLHLPDFFSWLRLQSE 70

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P    + +   I Q+      GL ++  + A + +S GV  +  ++N AY V E R 
Sbjct: 71  LVLPPQALEQVNPVIDQLQQSK-GGLLSVGIVIALWTASAGVRLMMSAMNAAYDVPEGRP 129

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            +    +S  Y +  +  L+  + + V  P  + ++         ++ +    R    + 
Sbjct: 130 VWKRIPLSIFYTVGLAGMLLAAAALMVLGPQVMEWIAAQIGMQEFIVTLWTVLRWPVIVF 189

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            L + +  ++  +P  K K   I PG +   + W++ ++ F +Y+ TF+ Y+ MY  + +
Sbjct: 190 LLMVAVALIYYVMPDVKQKFRFITPGSVLAVVVWIIASLGFAYYVKTFADYNAMYGSIGA 249

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           I+  L++ Y+     +LGAE+NA +       K
Sbjct: 250 IIVLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|302866698|ref|YP_003835335.1| ribonuclease BN [Micromonospora aurantiaca ATCC 27029]
 gi|302569557|gb|ADL45759.1| ribonuclease BN [Micromonospora aurantiaca ATCC 27029]
          Length = 340

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 47/283 (16%), Positives = 99/283 (34%), Gaps = 7/283 (2%)

Query: 1   MREYFCIVFD-IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV 59
           +R+     +  ++  + + FV ++    A+ ++   +L++FP  +    L G +      
Sbjct: 21  IRQLNWRTWRGVLVRSGKGFVTDNCADWAAALTYYGVLALFPSTIVVVALVGLVSDGPRT 80

Query: 60  PTVIDVVFGAWPEVIA---KPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRI 114
              +  +                  +  V+        L +   L A + +S  + A   
Sbjct: 81  VDTVIDLAREIGAGSVVGNDAFVGVVRNVVEQQGSAKVLLSFGLLGALWSASGFIGAFTR 140

Query: 115 SLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL 174
           + N  Y V E R +Y  R +  G   +  V L +++   +        V     A     
Sbjct: 141 ASNAIYGVREGRPFYRLRPLQIGMAAVTIVLLAVVATGLIVSGPVTDAVGDLLHAGAVAR 200

Query: 175 LIIWNGRIYATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIV 233
                 +     +     L  +    P  +      + PG      +WV+ +  F  Y+ 
Sbjct: 201 TTWSVAKWPLLAVVAMTLLSLLFWIAPNVRQPRFRWLTPGGALALAAWVLASFGFGLYVA 260

Query: 234 TFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            F +Y   Y  L +++  LV+LY+     +LG ++NA +    
Sbjct: 261 NFGSYDVTYGSLGAVIAFLVWLYLSNCALMLGVQVNAELQRGR 303


>gi|262052870|ref|ZP_06025054.1| hypothetical protein SA930_0032 [Staphylococcus aureus 930918-3]
 gi|259159224|gb|EEW44284.1| hypothetical protein SA930_0032 [Staphylococcus aureus 930918-3]
          Length = 405

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 119/270 (44%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L+          L   L       + I  +   
Sbjct: 72  NFLSYLIYRIGKDDASGLAAQMTYHFVLA---MFPMLLFLLTLLPFFNIKQSQITNMLSN 128

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 129 APAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGI 188

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V  V+   +     +   ++         +  I    RI   ++ +
Sbjct: 189 VLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIII 248

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI  I ++   P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+
Sbjct: 249 FIIFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGII 308

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +      K
Sbjct: 309 ILLLWLYITSFIIIVGAEINAIIHQRSVIK 338


>gi|163746838|ref|ZP_02154195.1| ribonuclease BN, putative [Oceanibulbus indolifex HEL-45]
 gi|161379952|gb|EDQ04364.1| ribonuclease BN, putative [Oceanibulbus indolifex HEL-45]
          Length = 315

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 60/273 (21%), Positives = 117/273 (42%), Gaps = 8/273 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI++   +    +    +A+ ++  ALL++FP +     LAG +     V   ++ +   
Sbjct: 20  DILFRVKDEIAADHVSLVAAGVAFYALLAIFPAVTALMALAGLVMEPAQVTEQLEAITRL 79

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            PE  A  I D+ + V      GL     I    A Y +S GV +L   LN AY   E R
Sbjct: 80  IPEEAATIILDQAIAVTGSEETGLGWAFLIGVGLALYSASKGVGSLMEGLNVAYDEDETR 139

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            +    + + G  L+    L++     +A+P  + ++            ++  G      
Sbjct: 140 GFVTKLIWTLGLTLMLVGVLLLGLGATLAVPAVVNFLA----LPDWFETLLTYGSWVLLA 195

Query: 187 LALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
               + L  ++ + PA   ++   + PG +   + W+V +V F+ Y+  F +Y+  +  +
Sbjct: 196 ALTVLALAVLYRYGPARDNAEWKWLTPGSVIACVLWIVASVGFSIYVSNFGSYNESFGSM 255

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           A  +  L++L++     +LGAE N+ M     +
Sbjct: 256 AGAIILLMWLWISAFIVLLGAEFNSEMEAQTRK 288


>gi|301383365|ref|ZP_07231783.1| ribonuclease BN, putative [Pseudomonas syringae pv. tomato Max13]
          Length = 323

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 63/271 (23%), Positives = 122/271 (45%), Gaps = 1/271 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            ++   +  F++++    AS ++   L S+FPF++F   L GFL    F   +       
Sbjct: 13  KVLLRTVNEFLDDEMSTYASALAYQMLFSLFPFLLFLIALIGFLHLPDFFSWLRLQSELV 72

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P    + +   I Q+      GL +I  + A + +S GV  +  ++N AY VVE R  +
Sbjct: 73  LPPQALEQVNPVIDQLQQSK-GGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIW 131

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
               +S  Y +  +  L+  +   V  P  + ++         ++ +    R  A +L L
Sbjct: 132 KRFPLSILYTVGIAGMLLAAAAFMVLGPQVMNWIAAQIGMEDFIVTLWTILRWPAIILLL 191

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + +  ++  +P  K +   I PG +   + W+  ++ F  Y+ TF+ Y+ MY  + +I+
Sbjct: 192 MVAVALIYYVMPDVKQEFRFITPGSVLAVVVWIFASLAFGFYVKTFADYNAMYGSIGAII 251

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             L++ Y+     +LGAE+NA +       K
Sbjct: 252 VLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|302187707|ref|ZP_07264380.1| ribonuclease BN [Pseudomonas syringae pv. syringae 642]
          Length = 321

 Score =  152 bits (383), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 63/271 (23%), Positives = 123/271 (45%), Gaps = 1/271 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            ++   +  F++++    AS ++   L S+FPF++F   L GFL    F   +       
Sbjct: 13  KVLVRTVNEFLDDEMSTYASALAYQMLFSLFPFLLFLIALIGFLHLPDFFSWLRLQSEFL 72

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P    + +   I Q+      GL +I  + A + +S GV  +  ++N AY VVE R  +
Sbjct: 73  LPPQALEQVNPVIDQLQQSK-GGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIW 131

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
               +S  Y +  +  L+  +   V  P  + ++         ++ +    R  A ++ L
Sbjct: 132 KRLPLSILYTVGIAGMLLAAAAFMVLGPQVMNWIAAQIGMEDFIVTLWTILRWPAIIILL 191

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + +  ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+
Sbjct: 192 MVAVALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAII 251

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             L++ Y+     +LGAE+NA +       K
Sbjct: 252 VLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|326562450|gb|EGE12769.1| putative ribonuclease BN [Moraxella catarrhalis 7169]
 gi|326563224|gb|EGE13492.1| putative ribonuclease BN [Moraxella catarrhalis 12P80B1]
 gi|326569158|gb|EGE19220.1| putative ribonuclease BN [Moraxella catarrhalis BC1]
          Length = 500

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 44/275 (16%), Positives = 105/275 (38%), Gaps = 6/275 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVV 66
            F  +   + HF+++D    A+ ++ + LL++ P +     +   + A       V   +
Sbjct: 15  WFMYLRLLVRHFIDDDTQQKAASLTYTTLLALVPILTVVLVIFSSVPALEGLREQVQQTI 74

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
                   ++ +   I    A  +  L  +        +   +  +  + N+ +RV E  
Sbjct: 75  SANLFPTASEQVAGYIRSF-AEKSSNLGLVGVAGLFVTAIMTLNTIEYAFNKIWRVQERS 133

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
               + +  +  + L  V L +      AI       R+      +            ++
Sbjct: 134 GGAASIIRYWTIITLGPVILGVAFGASSAIQSMDFLNRQIAGYGID----WGIWAYLVSL 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             +  G I ++ F+P A+  I +     I T I +     +F   +  F++Y  +Y   A
Sbjct: 190 ALMTCGFILLYWFIPKAQVPIKNAAIAGIVTAILFESIKQVFGTVMTNFTSYEAIYGAFA 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
           ++   L++LY+     +LG +++ ++ I+  ++ P
Sbjct: 250 ALPIFLLWLYISWNLILLGVQISYTLTIFDTKEVP 284


>gi|114049195|ref|YP_739745.1| ribonuclease BN [Shewanella sp. MR-7]
 gi|122944315|sp|Q0HQB7|Y3708_SHESR RecName: Full=UPF0761 membrane protein Shewmr7_3708
 gi|113890637|gb|ABI44688.1| tRNA-processing RNAse BN [Shewanella sp. MR-7]
          Length = 337

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 50/276 (18%), Positives = 105/276 (38%), Gaps = 8/276 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           ++  F  ++  +    +  VE+     A H++   LLS+ P +    ++       + + 
Sbjct: 10  IQVLFLGIWRFLLHLRQRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFKGIR 69

Query: 61  -TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +   V+  +       +   I + +   +KG   +   A    +   + A+  SLN  
Sbjct: 70  GQIEAFVYENFLPAAGDTVQVYINEFVGNASKG-TAVGIAALVVVAIMLISAIDKSLNNI 128

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +R  E RS  +   + +  + L  V +         +     +       +  L      
Sbjct: 129 WRTKEKRSVVVAFSMYWMVITLGPVLVGASLVATSYVVSLKLFEGDALSGVMPL------ 182

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                 ML      + +++ +P  K K    L G +   + + +G   F  Y+  F +Y 
Sbjct: 183 FIERLPMLFSVAAFLLLYMVVPNQKVKFWHALLGAVVAALLFELGKKGFALYVTKFPSYE 242

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            +Y  LA+I    V++Y+  +  +LGAE+ A+M  Y
Sbjct: 243 AIYGALATIPILFVWVYLSWMIVLLGAEITAAMPEY 278


>gi|117918768|ref|YP_867960.1| ribonuclease BN [Shewanella sp. ANA-3]
 gi|166199586|sp|A0KRY5|Y311_SHESA RecName: Full=UPF0761 membrane protein Shewana3_0311
 gi|117611100|gb|ABK46554.1| tRNA-processing RNAse BN [Shewanella sp. ANA-3]
          Length = 337

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 50/276 (18%), Positives = 105/276 (38%), Gaps = 8/276 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           ++  F  ++  +    +  VE+     A H++   LLS+ P +    ++       + + 
Sbjct: 10  IQVLFLGIWRFLLHLRQRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFKGIR 69

Query: 61  -TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +   V+  +       +   I + +   +KG   +   A    +   + A+  SLN  
Sbjct: 70  GQIEAFVYENFLPAAGDTVQVYINEFVGNASKG-TAVGIAALVVVAIMLISAIDKSLNNI 128

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +R  E RS  +   + +  + L  V +         +     +       +  L      
Sbjct: 129 WRTKEKRSVVVAFSMYWMVITLGPVLVGASLVATSYVVSLKLFEGDALSGVMPL------ 182

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                 ML      + +++ +P  K K    L G +   + + +G   F  Y+  F +Y 
Sbjct: 183 FIERLPMLFSVAAFLLLYMVVPNQKVKFWHALLGAVVAALLFELGKKGFALYVTKFPSYE 242

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            +Y  LA+I    V++Y+  +  +LGAE+ A+M  Y
Sbjct: 243 AIYGALATIPILFVWVYLSWMIVLLGAEITAAMPEY 278


>gi|257486817|ref|ZP_05640858.1| ribonuclease BN, putative [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289625973|ref|ZP_06458927.1| ribonuclease BN, putative [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289647974|ref|ZP_06479317.1| ribonuclease BN, putative [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|298488187|ref|ZP_07006224.1| Ribonuclease BN [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298157466|gb|EFH98549.1| Ribonuclease BN [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|330869370|gb|EGH04079.1| ribonuclease BN [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330988666|gb|EGH86769.1| ribonuclease BN [Pseudomonas syringae pv. lachrymans str. M301315]
          Length = 322

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 63/271 (23%), Positives = 123/271 (45%), Gaps = 1/271 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            ++   +  F++++    AS ++   L S+FPF++F   L GFL    F   +       
Sbjct: 13  KVLVRTVNEFLDDEMSTYASALAYQMLFSLFPFLLFLIALIGFLHLPDFFSWLRLQSEFL 72

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P    + +   I Q+      GL +I  + A + +S GV  +  ++N AY VVE R  +
Sbjct: 73  LPPQALEQVNPVIDQLQQSK-GGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIW 131

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
               +S  Y +  +  L+  +   V  P  + ++         ++ +    R  A ++ L
Sbjct: 132 KRLPLSILYTVGIAGMLLAAAAFMVLGPQVMNWIAAQIGMEDFIVTLWTILRWPAIIILL 191

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + +  ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+
Sbjct: 192 MVAVALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAII 251

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             L++ Y+     +LGAE+NA +       K
Sbjct: 252 VLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|39934322|ref|NP_946598.1| ribonuclease BN [Rhodopseudomonas palustris CGA009]
 gi|39648170|emb|CAE26690.1| Ribonuclease BN [Rhodopseudomonas palustris CGA009]
          Length = 360

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 54/268 (20%), Positives = 110/268 (41%), Gaps = 8/268 (2%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVI 74
             E   ++  + +A+ +    LL++FP I    +          +   +  +    P   
Sbjct: 89  TYERIGDDRLFLVAAGVVFYWLLALFPAITALVSSYALFADAATIGDHLAQLSSIVPAGT 148

Query: 75  AKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
              + +++ +VLA     L     +    A + ++ GV+A+  +LN  Y V E R ++  
Sbjct: 149 YSVVEEQVGRVLANGQTKLGFAFLISLSLALWSANGGVKAIIDALNAVYDVEEQRGFFKL 208

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
              S    L A   ++    + +A P+ LA +         + + I  GR     L  F 
Sbjct: 209 NGFSLLLTLGALGAVLAAIGLVIAAPIVLARI----GLGNLVAVAIDYGRWPVLALMTFG 264

Query: 192 GLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           GL  ++   P         + PG I   +SW+ G+   ++Y+  F+ Y+  Y  L + + 
Sbjct: 265 GLSLLYRTAPNRPSPPWRWVAPGSIVATLSWLAGSAALSYYLANFADYNATYGSLGAAIG 324

Query: 251 CLVFLYMLGVFFILGAELNASMIIYYWR 278
            +++++M  +  + G E+NA +     R
Sbjct: 325 LMIWMWMTAIVVLAGGEVNAEIEARAGR 352


>gi|256394381|ref|YP_003115945.1| ribonuclease BN [Catenulispora acidiphila DSM 44928]
 gi|256360607|gb|ACU74104.1| ribonuclease BN [Catenulispora acidiphila DSM 44928]
          Length = 331

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 55/275 (20%), Positives = 107/275 (38%), Gaps = 5/275 (1%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
                ++  +      ++    A+ ++    L+VFP ++   ++ G LG    V TV+D 
Sbjct: 50  RNWLSVLKRSAVAAHTDELVDRAAALTYYGFLAVFPTLLLAISVLGLLGT-STVNTVLDN 108

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVV 123
           V    P  +   +   I QV A    G  L     L A + +S  V A   + N  Y V 
Sbjct: 109 VQKLAPGSVHDVLRTAITQVRASGGTGGTLAIAGVLGALWSASGYVGAFIRASNVVYGVR 168

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R  + T  +  G  +L  VT ++   + V          +          I    +  
Sbjct: 169 ENRPMWKTTPLRIGLTMLMMVTSMVSIVIVVFTGPLADRTSQILGLGHTAFTIWSIVKWP 228

Query: 184 ATMLALFIGLIFVHLFLPAAK--SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
             +  +   ++ +    P      +   I PG +   + W+V +  F  YI  F++Y+  
Sbjct: 229 VLVFLVAAMIVLLFWAAPKTHGVRRFRWISPGSLLAVVLWLVLSTGFATYIANFASYNKT 288

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           Y  +A ++  L++L++  +  +LG E +  +   +
Sbjct: 289 YGTVAGVIVFLLWLWLSNLAILLGLEFDVELTAEH 323


>gi|222087339|ref|YP_002545876.1| ribonuclease protein [Agrobacterium radiobacter K84]
 gi|221724787|gb|ACM27943.1| ribonuclease protein [Agrobacterium radiobacter K84]
          Length = 310

 Score =  151 bits (382), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 145/279 (51%), Positives = 206/279 (73%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M  +   ++ ++YDA+ HFVE+DG+AMASH++LS LL+VFPF++FG  LA FLGA QF  
Sbjct: 1   MPTFVRALYKVVYDAVFHFVEDDGFAMASHVALSTLLAVFPFLIFGTALASFLGASQFSS 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T + ++F  WPE IAKP+ D+++QVL +P  GL TIS LAAAYF+SNGVEALRISLNRAY
Sbjct: 61  TAVHLIFDTWPEAIAKPVADQVVQVLTIPRGGLLTISVLAAAYFASNGVEALRISLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R WY  RL S GYVL+A +   ++S + VA+PLAL Y R++ P L ++L ++++ 
Sbjct: 121 RVPETRPWYFNRLASLGYVLIAVLIFALLSILLVAVPLALNYTRQWLPGLADILDVVFSW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           RIY T+  L  GL+ +HL+L A + ++  ++PGV  T + W +GA+LF +Y+ TF+ Y+ 
Sbjct: 181 RIYGTIFLLVAGLLILHLWLAAGRRRLFDVIPGVFLTLVFWSIGALLFAYYLSTFANYTA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            YAGLAS+M  L+FLYML V FI+GAE+NA+++ +  R+
Sbjct: 241 TYAGLASVMIVLIFLYMLAVIFIMGAEINAALMKFKVRR 279


>gi|119469197|ref|ZP_01612181.1| putative ribonuclease protein [Alteromonadales bacterium TW-7]
 gi|119447449|gb|EAW28717.1| putative ribonuclease protein [Alteromonadales bacterium TW-7]
          Length = 317

 Score =  151 bits (382), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 51/268 (19%), Positives = 111/268 (41%), Gaps = 8/268 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
            +DI         +++   +++ ++  ALL++FP I    ++  +  +   +   +    
Sbjct: 21  WWDIAKRIFARMSKDNLSLVSAGVAFYALLAIFPAIAALVSIYAYFASPAEISEHLRQFT 80

Query: 68  GAWPEVIAKPITDEILQVLAVPAK---GLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
              P    + I  +I ++              + L   + SS G +AL  + N +Y   E
Sbjct: 81  TLIPNSSRELILSQISELTQSSQARLTLGALGTLLLTIWSSSKGSQALITACNISYHEYE 140

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            RS+   + + F + + A +  +    +   +P+ L  V        ++ L+I       
Sbjct: 141 KRSFLRAQFVRFMFSVGAILVAIFALLIIGILPIVLNLV----GLKDSIDLLIKVVSWPI 196

Query: 185 TMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
             L     L+ ++ + P  K+ K   I  G     + W++ ++ F+ Y+  FS+Y+  Y 
Sbjct: 197 LALKFNFALVLLYRYAPHRKAAKWRWITLGSAIATVFWIIASIGFSFYVSRFSSYNETYG 256

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNAS 271
            L  ++  L++LY+      +GA +NA 
Sbjct: 257 SLGGVVIMLMWLYISAYIVTMGAVINAE 284


>gi|326571351|gb|EGE21368.1| putative ribonuclease BN [Moraxella catarrhalis BC8]
          Length = 500

 Score =  151 bits (382), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 44/275 (16%), Positives = 105/275 (38%), Gaps = 6/275 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVV 66
            F  +   + HF+++D    A+ ++ + LL++ P +     +   + A       V   +
Sbjct: 15  WFMYLRLLVRHFIDDDTQQKAASLTYTTLLALVPILTVVLVIFSSVPALEGLREQVQQTI 74

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
                   ++ +   I    A  +  L  +        +   +  +  + N+ +RV E  
Sbjct: 75  SANLFPTASEQVAGYIRSF-AEKSSNLGLVGVAGLFVTAIMTLNTIEYAFNKIWRVQERS 133

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
               + +  +  + L  V L +      AI       R+      +            ++
Sbjct: 134 GGAASIIRYWTIITLGPVILGVAFGASSAIQSMDFLNRQIAGYGID----WGIWAYLVSL 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             +  G I ++ F+P A+  I +     I T I +     +F   +  F++Y  +Y   A
Sbjct: 190 ALMTCGFILLYWFIPKAQVPIKNAAIAGIVTAILFESIKQVFGTVMTNFTSYEAIYGAFA 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
           ++   L++LY+     +LG +++ ++ I+  ++ P
Sbjct: 250 ALPIFLLWLYISWNLILLGVQISYTLTIFDTKEVP 284


>gi|71737082|ref|YP_273727.1| ribonuclease BN [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71557635|gb|AAZ36846.1| ribonuclease BN, putative [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|320325401|gb|EFW81466.1| ribonuclease BN, putative [Pseudomonas syringae pv. glycinea str.
           B076]
          Length = 322

 Score =  151 bits (382), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 63/271 (23%), Positives = 123/271 (45%), Gaps = 1/271 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            ++   +  F++++    AS ++   L S+FPF++F   L GFL    F   +       
Sbjct: 13  KVLVRTVNEFLDDEMSTYASALAYQMLFSLFPFLLFLIALIGFLHLPDFFSWLRLQSEFL 72

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P    + +   I Q+      GL +I  + A + +S GV  +  ++N AY VVE R  +
Sbjct: 73  LPPQALEQVNPVIDQLQQSK-GGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIW 131

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
               +S  Y +  +  L+  +   V  P  + ++         ++ +    R  A ++ L
Sbjct: 132 KRLPLSILYTVGIAGMLLAAAAFMVLGPQVMNWIAAQIGMEDFIVTLWTILRWPAIIILL 191

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + +  ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+
Sbjct: 192 MVAVALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAII 251

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             L++ Y+     +LGAE+NA +       K
Sbjct: 252 VLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|310659169|ref|YP_003936890.1| integral inner membrane protein with ribonuclease fold [Clostridium
           sticklandii DSM 519]
 gi|308825947|emb|CBH21985.1| putative integral inner membrane protein with ribonuclease fold
           [Clostridium sticklandii]
          Length = 319

 Score =  151 bits (382), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 67/273 (24%), Positives = 125/273 (45%), Gaps = 2/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           + ++I +  + F  ++       ++   LLSVFPF++F   L GFL     V ++I  + 
Sbjct: 17  LKNLILELPKRFARDNISQTGGQLAYFFLLSVFPFLIFLNALLGFLNIS--VESIIREIS 74

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              PE I   +   +  V+      L +I  LA+ + +S  V++L I+LN AY V   R+
Sbjct: 75  AIAPEEIVVLLRGYLESVVETRNTSLLSIGLLASLFSASKAVDSLIIALNTAYDVENKRN 134

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           +   + +S  + L+    +VI   +          +  FF     ++ +    R      
Sbjct: 135 FITKKAVSIFFTLILGFAIVISLLLPALGKNVAFLIADFFRISNIIVFVWVYIRWVIVFF 194

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            LFI +  ++  +P       + LPG  F   SW++ +  F  Y+  F+ YS +Y  + +
Sbjct: 195 ILFITIALLYHIVPYVNQPFKNSLPGTFFAVTSWLLVSYGFGIYVNNFANYSAVYGSIGA 254

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           ++  + +LY+ G+  +LG E+N  +  YY   K
Sbjct: 255 VIALMFWLYLTGIILVLGGEINDILYRYYEATK 287


>gi|126453311|ref|YP_001065978.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei 1106a]
 gi|167846011|ref|ZP_02471519.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei B7210]
 gi|242317688|ref|ZP_04816704.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei 1106b]
 gi|126226953|gb|ABN90493.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei 1106a]
 gi|242140927|gb|EES27329.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei 1106b]
          Length = 437

 Score =  151 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 36/273 (13%), Positives = 95/273 (34%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A +   E+    +A  ++ + +L++ P +     L         F  ++ 
Sbjct: 8   LDTIKRLARFAAKRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQNSLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +   + +   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNSQIFKYLNQFASKAKGLTTAGLIVLVFTAVMMMMTIESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +                   ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSMSSYLFTKSLAFAGSTSTPPVFEWLLAAASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +   +++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVVGGVCAALAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L++LY+     + GA + +++    
Sbjct: 244 AFATVPMFLLWLYLSWFVTLAGAMIASALPAIR 276


>gi|209546746|ref|YP_002278664.1| ribonuclease BN [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209537990|gb|ACI57924.1| ribonuclease BN [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 359

 Score =  151 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 55/277 (19%), Positives = 118/277 (42%), Gaps = 6/277 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
              + D+ +      + +    +A+ ++   LL++FP +    +L G +     +   + 
Sbjct: 60  LSGLRDVFWRVYHEVLNDRVTLIAAGVTFYLLLALFPAMAALVSLYGLVADPVTISEHLR 119

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTI---SALAAAYFSSNGVEALRISLNRAYR 121
            + G  P      + D+I ++++     L          A + + +G  A+  ++N AY 
Sbjct: 120 ELAGLLPPGAFDLLADQIKELVSKRESALGITFFVGLGIALWSTHSGTLAIFDAMNVAYE 179

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             E R      L+   + L A +  V+M  +   +P+ L+Y+          LL+ W   
Sbjct: 180 ENEKRGLIRLNLVGLCFTLSAMLLTVVMVALVGVMPVVLSYLWLDQFKEHMALLLRWPLL 239

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
           +    +A+     F     PA   K+  +  G   T ++W   ++ F+ Y+  F+ Y+  
Sbjct: 240 LLVVAVAVTSVYRFGPSREPA---KLRWMTWGAALTTVAWAAMSLGFSFYLDHFANYNAT 296

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           Y  L +++  L+++++  V  ++GAELNA +     R
Sbjct: 297 YGTLGALIGFLIWIWLSVVILVIGAELNAELEHQTAR 333


>gi|330949876|gb|EGH50136.1| ribonuclease BN [Pseudomonas syringae Cit 7]
          Length = 322

 Score =  151 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 63/271 (23%), Positives = 123/271 (45%), Gaps = 1/271 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            ++   +  F++++    AS ++   L S+FPF++F   L GFL    F   +       
Sbjct: 13  KVLVRTVNEFLDDEMSTYASALAYQMLFSLFPFLLFLIALIGFLHLPDFFSWLRLQSEFL 72

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P    + +   I Q+      GL +I  + A + +S GV  +  ++N AY VVE R  +
Sbjct: 73  LPPQALEQVNPVIDQLQQSK-GGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIW 131

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
               +S  Y +  +  L+  +   V  P  + ++         ++ +    R  A ++ L
Sbjct: 132 KRLPLSILYTVGIAGMLLAAAAFMVLGPQVMNWIAAQIGMEDFIVTLWTILRWPAIIILL 191

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + +  ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+
Sbjct: 192 MVAVALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAII 251

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             L++ Y+     +LGAE+NA +       K
Sbjct: 252 VLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|296113710|ref|YP_003627648.1| putative ribonuclease BN [Moraxella catarrhalis RH4]
 gi|295921404|gb|ADG61755.1| putative ribonuclease BN [Moraxella catarrhalis RH4]
 gi|326562819|gb|EGE13114.1| putative ribonuclease BN [Moraxella catarrhalis 46P47B1]
 gi|326563460|gb|EGE13723.1| putative ribonuclease BN [Moraxella catarrhalis 103P14B1]
 gi|326570644|gb|EGE20680.1| putative ribonuclease BN [Moraxella catarrhalis BC7]
 gi|326572954|gb|EGE22933.1| putative ribonuclease BN [Moraxella catarrhalis CO72]
 gi|326573770|gb|EGE23727.1| putative ribonuclease BN [Moraxella catarrhalis 101P30B1]
 gi|326574808|gb|EGE24742.1| putative ribonuclease BN [Moraxella catarrhalis O35E]
          Length = 500

 Score =  151 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 44/275 (16%), Positives = 105/275 (38%), Gaps = 6/275 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVV 66
            F  +   + HF+++D    A+ ++ + LL++ P +     +   + A       V   +
Sbjct: 15  WFMYLRLLVRHFIDDDTQQKAASLTYTTLLALVPILTVVLVIFSSVPALEGLREQVQQTI 74

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
                   ++ +   I    A  +  L  +        +   +  +  + N+ +RV E  
Sbjct: 75  SANLFPTASEQVAGYIRSF-AEKSSNLGLVGVAGLFVTAIMTLNTIEYAFNKIWRVQERS 133

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
               + +  +  + L  V L +      AI       R+      +            ++
Sbjct: 134 GGAASIIRYWTIITLGPVILGVAFGASSAIQSMDFLNRQIAGYGID----WGIWAYLVSL 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             +  G I ++ F+P A+  I +     I T I +     +F   +  F++Y  +Y   A
Sbjct: 190 ALMTCGFILLYWFIPKAQVPIKNAAIAGIVTAILFESIKQVFGTVMTNFTSYEAIYGAFA 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
           ++   L++LY+     +LG +++ ++ I+  ++ P
Sbjct: 250 ALPIFLLWLYISWNLILLGVQISYTLTIFDTKEVP 284


>gi|66047009|ref|YP_236850.1| ribonuclease BN [Pseudomonas syringae pv. syringae B728a]
 gi|63257716|gb|AAY38812.1| Ribonuclease BN [Pseudomonas syringae pv. syringae B728a]
          Length = 321

 Score =  151 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 63/271 (23%), Positives = 123/271 (45%), Gaps = 1/271 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            ++   +  F++++    AS ++   L S+FPF++F   L GFL    F   +       
Sbjct: 13  KVLVRTVNEFLDDEMSTYASALAYQMLFSLFPFLLFLIALIGFLHLPDFFSWLRLQSEFL 72

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P    + +   I Q+      GL +I  + A + +S GV  +  ++N AY VVE R  +
Sbjct: 73  LPPQALEQVNPVIDQLQQSK-GGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIW 131

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
               +S  Y +  +  L+  +   V  P  + ++         ++ +    R  A ++ L
Sbjct: 132 KRLPLSILYTVGIAGMLLAAAAFMVLGPQVMNWIAAQIGMEDFIVTLWTILRWPAIIILL 191

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + +  ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+
Sbjct: 192 MVAVALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAII 251

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             L++ Y+     +LGAE+NA +       K
Sbjct: 252 VLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|330971090|gb|EGH71156.1| ribonuclease BN [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 321

 Score =  151 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 63/271 (23%), Positives = 123/271 (45%), Gaps = 1/271 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            ++   +  F++++    AS ++   L S+FPF++F   L GFL    F   +       
Sbjct: 13  KVLVRTVNEFLDDEMSTYASALAYQMLFSLFPFLLFLIALIGFLHLPDFFSWLRLQSEFL 72

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P    + +   I Q+      GL +I  + A + +S GV  +  ++N AY VVE R  +
Sbjct: 73  LPPQALEQVNPVIDQLQQSK-GGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIW 131

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
               +S  Y +  +  L+  +   V  P  + ++         ++ +    R  A ++ L
Sbjct: 132 KRLPLSILYTVGIAGMLLAAAAFMVLGPQVMNWIAAQIGMEDFIVTLWTILRWPAIIILL 191

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + +  ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+
Sbjct: 192 MVAVALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAII 251

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             L++ Y+     +LGAE+NA +       K
Sbjct: 252 VLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|167719878|ref|ZP_02403114.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei DM98]
          Length = 437

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 36/273 (13%), Positives = 96/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A +   E+    +A  ++ + +L++ P +     L         F  ++ 
Sbjct: 8   LDTIKRLARFAAKRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQNSLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +   + +   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNSQIFKYLNQFASKAKGLTTAGLIVLVFTAVMMMMTIESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +      +            ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSMSSYLFTKSLAIAGSTSTPPVFEWLLAAASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +   +++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVVGGVCAALAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L++LY+     + GA + +++    
Sbjct: 244 AFATVPMFLLWLYLSWFVTLAGAMIASALPAIR 276


>gi|315125588|ref|YP_004067591.1| ribonuclease protein [Pseudoalteromonas sp. SM9913]
 gi|315014101|gb|ADT67439.1| ribonuclease protein [Pseudoalteromonas sp. SM9913]
          Length = 315

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 55/275 (20%), Positives = 116/275 (42%), Gaps = 8/275 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
               +DI    ++    ++   +A+ ++  ALL++FP I    ++  +  +   +   + 
Sbjct: 18  LRGWWDITRRIVKQMSRDNLSLVAAGVAFYALLAIFPAIAALVSVYAYFTSPNDISVYLS 77

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISA---LAAAYFSSNGVEALRISLNRAYR 121
                 P+   + I  ++  +       L   +    L   + SS G +AL  + N +Y 
Sbjct: 78  QFMALLPQSTQEIILSQVSSLAQKSQTSLSLSALGTLLLTIWSSSKGSQALITACNISYH 137

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             E RS+   +L+   + + A V  VI   +   +PLAL  +        ++  +I    
Sbjct: 138 EYEKRSFLKAQLVRLLFSVGAIVVAVIALVIIGILPLALNLL----GIKESIDFLIMLIS 193

Query: 182 IYATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                L     L+ ++ + P  K+ K   +  G     + W+V +  F+ Y+  F++Y+ 
Sbjct: 194 WPLLALTFNFALLILYRYAPHRKAAKWRWVTVGSFTATVLWIVASFGFSFYVSHFASYNE 253

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            Y  L  ++  L++L++     ILGA +NA++   
Sbjct: 254 TYGSLGGVVIMLMWLFISAYIIILGATINAALEQQ 288


>gi|160882656|ref|ZP_02063659.1| hypothetical protein BACOVA_00609 [Bacteroides ovatus ATCC 8483]
 gi|237718430|ref|ZP_04548911.1| ribonuclease BN [Bacteroides sp. 2_2_4]
 gi|260173878|ref|ZP_05760290.1| ribonuclease BN [Bacteroides sp. D2]
 gi|293371424|ref|ZP_06617855.1| YihY family protein [Bacteroides ovatus SD CMC 3f]
 gi|299149076|ref|ZP_07042138.1| YihY family protein [Bacteroides sp. 3_1_23]
 gi|315922141|ref|ZP_07918381.1| ribonuclease BN [Bacteroides sp. D2]
 gi|156111971|gb|EDO13716.1| hypothetical protein BACOVA_00609 [Bacteroides ovatus ATCC 8483]
 gi|229452363|gb|EEO58154.1| ribonuclease BN [Bacteroides sp. 2_2_4]
 gi|292633621|gb|EFF52179.1| YihY family protein [Bacteroides ovatus SD CMC 3f]
 gi|298513837|gb|EFI37724.1| YihY family protein [Bacteroides sp. 3_1_23]
 gi|313696016|gb|EFS32851.1| ribonuclease BN [Bacteroides sp. D2]
          Length = 439

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 46/275 (16%), Positives = 97/275 (35%), Gaps = 4/275 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +     +   +Y  I  F ++     AS ++ S LL++ P +     +A   G    +  
Sbjct: 28  KFSLYNIIKTVYLCINRFTKDRMANKASALTYSTLLAIVPILAILFAVARGFGFDNLMEH 87

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
                FG   E     ++     +          +  +   +   N V  + I+ NR + 
Sbjct: 88  QFRNGFGGNTETTEAILSFVNSYLSQTKGGIFIGVGLVMLLWTVINLVSNIEITFNRIWE 147

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V + RS Y      F   LL  + +V+   + + +   L            L  ++    
Sbjct: 148 VKKARSMYRKITDYFSMFLLMPILIVVSGGLSLFMSTILK----QMDDFVLLAPVMKFMI 203

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                +  ++    +++F+P  K K    L   I    ++     L+ +  +  S Y+ +
Sbjct: 204 RLIPFVLTWLMFTGLYIFMPNTKVKFKHALIAGILAGSAYQAFQFLYINSQLWVSKYNAI 263

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           Y   A++   L++L +     + GAEL  +     
Sbjct: 264 YGSFAALPLFLLWLQISWTICLFGAELTYAGQNIR 298


>gi|116249043|ref|YP_764884.1| ribonuclease domain-containing protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115253693|emb|CAK12086.1| putative transmembrane ribonuclease domain protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 359

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 55/277 (19%), Positives = 119/277 (42%), Gaps = 6/277 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
           F  + D+ +      + +    +A+ ++   LL++FP +    +L G +     +   + 
Sbjct: 60  FSGLRDVFWRVFHEVLADRVTLIAAGVTFYLLLALFPAMAALVSLYGLVADPATISEHLR 119

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTI---SALAAAYFSSNGVEALRISLNRAYR 121
            + G  P      + ++I +++      L          A + + +G  A+  ++N AY 
Sbjct: 120 ELAGLMPSGAFDLLANQIKELVDRRDATLGITFFVGLGIALWSTHSGTLAIFDAMNVAYE 179

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             E R      LI   + L A +  V+M  +   +P+ L+Y+          LL+ W   
Sbjct: 180 EEEKRGLIRLNLIGLCFTLCAMLLTVVMVALVGVMPVVLSYLWLDQFKEHMALLLRWPLL 239

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
           +    +A+     F     PA   K+  +  G + T ++W   ++ F++Y+  F+ Y+  
Sbjct: 240 LLVVAVAVTSVYRFGPSREPA---KLRWMTWGAVLTTVAWTAMSLGFSYYLDHFANYNAT 296

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           Y  L +++  L+++++  V  I+G ELNA +     +
Sbjct: 297 YGTLGALIGFLIWIWLSVVILIVGGELNAELEHQTAK 333


>gi|113968660|ref|YP_732453.1| ribonuclease BN [Shewanella sp. MR-4]
 gi|123325453|sp|Q0HNH1|Y316_SHESM RecName: Full=UPF0761 membrane protein Shewmr4_0316
 gi|113883344|gb|ABI37396.1| tRNA-processing RNAse BN [Shewanella sp. MR-4]
          Length = 337

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 48/276 (17%), Positives = 104/276 (37%), Gaps = 8/276 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           ++  F  ++  +    +  VE+     A H++   LLS+ P +    ++       + + 
Sbjct: 10  IQVLFLGIWRFLLHLRQRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFKGIR 69

Query: 61  -TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +   V+  +       +   I + +   +KG   +   A    +   + A+  SLN  
Sbjct: 70  GQIEAFVYENFLPAAGDTVQVYINEFVGNASKG-TAVGIAALVVVAIMLISAIDKSLNNI 128

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +R  E RS  +   + +  + L  V +         +     +       +  L      
Sbjct: 129 WRTKEKRSVVVAFSMYWMVITLGPVLVGASLVATSYVVSLKLFEGDALSGVMPL------ 182

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                 +       + +++ +P  K K    L G +   + + +G   F  Y+  F +Y 
Sbjct: 183 FIERLPLFFSVAAFLLLYMVVPNQKVKFWHALLGAVVAALLFELGKKGFALYVTKFPSYE 242

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            +Y  LA+I    V++Y+  +  +LGAE+ A+M  Y
Sbjct: 243 AIYGALATIPILFVWVYLSWMIVLLGAEITAAMPEY 278


>gi|167824475|ref|ZP_02455946.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei 9]
 gi|167911227|ref|ZP_02498318.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei 112]
 gi|226192934|ref|ZP_03788546.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei Pakistan
           9]
 gi|254198157|ref|ZP_04904579.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei S13]
 gi|254297859|ref|ZP_04965312.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei 406e]
 gi|157807649|gb|EDO84819.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei 406e]
 gi|169654898|gb|EDS87591.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei S13]
 gi|225935024|gb|EEH30999.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei Pakistan
           9]
          Length = 437

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 36/273 (13%), Positives = 95/273 (34%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A +   E+    +A  ++ + +L++ P +     L         F  ++ 
Sbjct: 8   LDTIKRLARFAAKRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQNSLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +   + +   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNSQIFKYLNQFASKAKGLTTAGLIVLVFTAVMMMMTIESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +                   ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSMSSYLFTKSLAFAGSTSTPPVFEWLLAAASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +   +++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVVGGVCAALAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L++LY+     + GA + +++    
Sbjct: 244 AFATVPMFLLWLYLSWFVTLAGAMIASALPAIR 276


>gi|256376128|ref|YP_003099788.1| ribonuclease BN [Actinosynnema mirum DSM 43827]
 gi|255920431|gb|ACU35942.1| ribonuclease BN [Actinosynnema mirum DSM 43827]
          Length = 306

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 48/273 (17%), Positives = 97/273 (35%), Gaps = 2/273 (0%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
              + ++      F E+     A+ ++  A+LS+FP  V        +       T++D 
Sbjct: 14  RSWWAVLKRTAAEFTEDGLMDRAAALTYYAVLSLFPG-VLLLTGLLGILGPDAKQTLVDS 72

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           +    P      +   +  +    A  +       A + +S  V A   + N  Y V E 
Sbjct: 73  LSALGPGPARDILIQALDSLRPSVAGPVAIFGLATALWSASGYVGAFMRAANAIYEVDEG 132

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R  +    +     L   V L +++           +V          + +    +    
Sbjct: 133 RPLWKVLPLRVLLTLGVVVLLALVAAGTALTGDVAVWVGDLVGLGREAVAVWDLAKWPVL 192

Query: 186 MLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
           +L     +  ++   P  +    + I PG +   + WV+ +  F  Y     +Y   Y  
Sbjct: 193 LLLASAAIGLLYWASPNVRQPGWLWITPGGLLAVLLWVIASFGFGFYATHAGSYDKTYGP 252

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           LA ++  LV+L++  +  +LGAEL+A +     
Sbjct: 253 LAGVVVFLVWLWISNIALLLGAELDAELERGRR 285


>gi|134282352|ref|ZP_01769057.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei 305]
 gi|134246390|gb|EBA46479.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei 305]
          Length = 437

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 36/273 (13%), Positives = 95/273 (34%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A +   E+    +A  ++ + +L++ P +     L         F  ++ 
Sbjct: 8   LDTIKRLARFAAKRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQNSLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +   + +   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNSQIFKYLNQFASKAKGLTTAGLIVLVFTAVMMMMTIESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +                   ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSMSSYLFTKSLAFAGSTSTPPVFEWLLAAASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +   +++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVVGGVCAALAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L++LY+     + GA + +++    
Sbjct: 244 AFATVPMFLLWLYLSWFVTLAGAMIASALPAIR 276


>gi|298484069|ref|ZP_07002237.1| YihY family protein [Bacteroides sp. D22]
 gi|295087661|emb|CBK69184.1| tRNA-processing RNAse BN [Bacteroides xylanisolvens XB1A]
 gi|298269750|gb|EFI11343.1| YihY family protein [Bacteroides sp. D22]
          Length = 439

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 48/275 (17%), Positives = 97/275 (35%), Gaps = 4/275 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +     +   IY  I  F ++     AS ++ S LL++ P +     +A   G    +  
Sbjct: 28  KFSLYNIIKTIYLCINRFTKDRMANKASALTYSTLLAIVPILAILFAVARGFGFDNLMEH 87

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
                FG   E     ++     +          +  +   +   N V  + I+ NR + 
Sbjct: 88  QFRNGFGGNIETTEAILSFVNSYLSQTKGGIFIGVGLVMLLWTVINLVSNIEITFNRIWE 147

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V + RS Y      F   LL  + +V+   + + +   L            L  I+    
Sbjct: 148 VKKARSMYRKITDYFSMFLLMPILIVVSGGLSLFMSTILK----QMDDFVLLAPIMKFMI 203

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                +  ++    +++F+P  K K    L   I    ++     L+ +  +  S Y+ +
Sbjct: 204 RLIPFVLTWLMFTGLYIFMPNTKVKFKHALIAGILAGSAYQAFQFLYINSQLWVSKYNAI 263

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           Y   A++   L++L +     + GAEL  +     
Sbjct: 264 YGSFAALPLFLLWLQISWTICLFGAELTYAGQNIR 298


>gi|190893623|ref|YP_001980165.1| ribonuclease [Rhizobium etli CIAT 652]
 gi|190698902|gb|ACE92987.1| putative ribonuclease protein [Rhizobium etli CIAT 652]
          Length = 307

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 152/279 (54%), Positives = 210/279 (75%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MR+    ++D++YDAI H VE+DG+AMASH++LS+LL+VFPF++FG  LA FLGA QF  
Sbjct: 1   MRKVLRTIYDVVYDAICHMVEDDGFAMASHVALSSLLAVFPFLIFGTALASFLGADQFSS 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T I ++F  WPE IAKP+ D++LQVL +P  GL TIS LAAAYF+SNGVEALRISLNRAY
Sbjct: 61  TAIHLIFDTWPEAIAKPLADQVLQVLTIPRGGLLTISVLAAAYFASNGVEALRISLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R WY TRL S GYVL+A +    +S + VA+PLAL Y R +FP   + L I+++ 
Sbjct: 121 RVQETRPWYFTRLASLGYVLIAVIIFAAISILLVAVPLALDYARNWFPLFADTLDIVFSW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           RIY T++ L +GL+ +HL+LPA K ++  ++PGV+ T + W+ GA++F +Y+ TF+ Y+ 
Sbjct: 181 RIYGTLVVLTVGLLVMHLWLPAGKRRVFDVIPGVLLTLLLWLAGALIFAYYLATFANYTA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            YAGLAS+M  L+FLYM+GV FI+GAE+NA++I +   +
Sbjct: 241 TYAGLASVMIVLIFLYMVGVIFIIGAEINAALIKFRVFR 279


>gi|311067277|ref|YP_003972200.1| YfkH protein [Bacillus atrophaeus 1942]
 gi|310867794|gb|ADP31269.1| YfkH [Bacillus atrophaeus 1942]
          Length = 279

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 74/268 (27%), Positives = 123/268 (45%), Gaps = 2/268 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D I +    F   +G + ++ ++   LLS+FPF++F   LA +L        V+ VV   
Sbjct: 2   DFIKELFGRFTLHEGQSKSAELAYFFLLSLFPFMIFILTLAAYLPLTS--DDVLGVVDQY 59

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P+     I     Q L     GL +   +AA + +SNG+ A+  + N AY V E RS+ 
Sbjct: 60  APDGAMSLIQSITEQTLNNRNGGLLSFGIIAALWSASNGMNAIVRAFNHAYEVEENRSFI 119

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           I RL S    +    T+++   + V          +F  A    L +    R   + L L
Sbjct: 120 IVRLTSIFLTIGMVFTILVALLLPVFGKQIGLLTAEFVGASDMFLAVWAAVRWGISPLIL 179

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            I    ++LF P  K  +  + PG +F  I W+  + LF+ Y+ T++ YS  Y  +  I+
Sbjct: 180 LIVFSALYLFAPNKKLSLRFVFPGALFATIGWIAVSTLFSFYVGTYANYSATYGSIGGII 239

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYW 277
             +++ Y+ G+  ILG E+NA +     
Sbjct: 240 VLMIWFYLSGILIILGGEINALLHKRKK 267


>gi|21283552|ref|NP_646640.1| hypothetical protein MW1823 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49486701|ref|YP_043922.1| hypothetical protein SAS1805 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|297208908|ref|ZP_06925313.1| YihY family protein [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|300913034|ref|ZP_07130472.1| YihY family protein [Staphylococcus aureus subsp. aureus TCH70]
 gi|21204993|dbj|BAB95688.1| MW1823 [Staphylococcus aureus subsp. aureus MW2]
 gi|49245144|emb|CAG43610.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|296886469|gb|EFH25397.1| YihY family protein [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|300885812|gb|EFK81019.1| YihY family protein [Staphylococcus aureus subsp. aureus TCH70]
          Length = 403

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 119/270 (44%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L+          L   L       + I  +   
Sbjct: 70  NFLSYLIYRIGKDDASGLAAQMTYHFVLA---MFPMLLFLLTLLPFFNIKQSQITNMLSN 126

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 127 APAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGI 186

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V  V+   +     +   ++         +  I    RI   ++ +
Sbjct: 187 VLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIII 246

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI  I ++   P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+
Sbjct: 247 FIVFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGII 306

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +      K
Sbjct: 307 ILLLWLYITSFIIIVGAEINAIIHQRSVIK 336


>gi|254252578|ref|ZP_04945896.1| hypothetical protein BDAG_01812 [Burkholderia dolosa AUO158]
 gi|124895187|gb|EAY69067.1| hypothetical protein BDAG_01812 [Burkholderia dolosa AUO158]
          Length = 490

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 38/273 (13%), Positives = 95/273 (34%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVI 63
              +  +   A     E+    +A  ++ + +L++ P +     L            ++ 
Sbjct: 55  LDTIKRLAQFAARRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQISLQ 114

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     S   +  +  + N  +RV 
Sbjct: 115 GFLADHLMPAQFNTQIFKYLNQFAAKAKGLTTAGLIVLVVTSVMTMMTIESAFNLIWRVR 174

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R      L  +  + L  +   +   +   +            +   +  ++    + 
Sbjct: 175 KPRPLAQRVLAYWALITLGPLLFGVSLSISSYLFTQSLAFTGAAQSTSIVEWLLTLASLP 234

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +F  I++ +    F +Y+    TY+ +Y 
Sbjct: 235 LTVL----AFTLLYVYLPNCTVAWRDAVIGGLFAAIAFELAKRGFGYYVRRIPTYTAVYG 290

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     +LGA + +++    
Sbjct: 291 AFAALPVFLLWVYLSWFIALLGAMVASALPAIR 323


>gi|237811990|ref|YP_002896441.1| ribonuclease BN [Burkholderia pseudomallei MSHR346]
 gi|254188565|ref|ZP_04895076.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei Pasteur
           52237]
 gi|157936244|gb|EDO91914.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei Pasteur
           52237]
 gi|237504360|gb|ACQ96678.1| ribonuclease BN [Burkholderia pseudomallei MSHR346]
          Length = 437

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 36/273 (13%), Positives = 95/273 (34%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A +   E+    +A  ++ + +L++ P +     L         F  ++ 
Sbjct: 8   LDTIKRLARFAAKRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQNSLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +   + +   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNSQIFKYLNQFASKAKGLTTAGLIVLVFTAVMMMMTIESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +                   ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSMSSYLFTKSLAFAGSTSTPPVFEWLLAAASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +   +++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVVGGVCAALAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L++LY+     + GA + +++    
Sbjct: 244 AFATVPMFLLWLYLSWFVTLAGAMIASALPAIR 276


>gi|53725418|ref|YP_102669.1| ribonuclease BN [Burkholderia mallei ATCC 23344]
 gi|67642692|ref|ZP_00441445.1| ribonuclease BN [Burkholderia mallei GB8 horse 4]
 gi|76810568|ref|YP_333263.1| ribonuclease BN [Burkholderia pseudomallei 1710b]
 gi|121598821|ref|YP_992806.1| ribonuclease BN [Burkholderia mallei SAVP1]
 gi|126440631|ref|YP_001058726.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei 668]
 gi|167002924|ref|ZP_02268714.1| tRNA-processing ribonuclease BN [Burkholderia mallei PRL-20]
 gi|167738880|ref|ZP_02411654.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei 14]
 gi|167816103|ref|ZP_02447783.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei 91]
 gi|167894585|ref|ZP_02481987.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei 7894]
 gi|167902987|ref|ZP_02490192.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei NCTC
           13177]
 gi|167919248|ref|ZP_02506339.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei BCC215]
 gi|217423574|ref|ZP_03455075.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei 576]
 gi|254178581|ref|ZP_04885236.1| tRNA-processing ribonuclease BN [Burkholderia mallei ATCC 10399]
 gi|254180025|ref|ZP_04886624.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei 1655]
 gi|254199606|ref|ZP_04905972.1| tRNA-processing ribonuclease BN [Burkholderia mallei FMH]
 gi|254205924|ref|ZP_04912276.1| tRNA-processing ribonuclease BN [Burkholderia mallei JHU]
 gi|254258987|ref|ZP_04950041.1| ribonuclease BN [Burkholderia pseudomallei 1710a]
 gi|52428841|gb|AAU49434.1| ribonuclease BN [Burkholderia mallei ATCC 23344]
 gi|76580021|gb|ABA49496.1| ribonuclease BN [Burkholderia pseudomallei 1710b]
 gi|121227631|gb|ABM50149.1| ribonuclease BN [Burkholderia mallei SAVP1]
 gi|126220124|gb|ABN83630.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei 668]
 gi|147749202|gb|EDK56276.1| tRNA-processing ribonuclease BN [Burkholderia mallei FMH]
 gi|147753367|gb|EDK60432.1| tRNA-processing ribonuclease BN [Burkholderia mallei JHU]
 gi|160699620|gb|EDP89590.1| tRNA-processing ribonuclease BN [Burkholderia mallei ATCC 10399]
 gi|184210565|gb|EDU07608.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei 1655]
 gi|217393432|gb|EEC33453.1| tRNA-processing ribonuclease BN [Burkholderia pseudomallei 576]
 gi|238523880|gb|EEP87316.1| ribonuclease BN [Burkholderia mallei GB8 horse 4]
 gi|243061470|gb|EES43656.1| tRNA-processing ribonuclease BN [Burkholderia mallei PRL-20]
 gi|254217676|gb|EET07060.1| ribonuclease BN [Burkholderia pseudomallei 1710a]
          Length = 437

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 36/273 (13%), Positives = 95/273 (34%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A +   E+    +A  ++ + +L++ P +     L         F  ++ 
Sbjct: 8   LDTIKRLARFAAKRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQNSLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +   + +   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNSQIFKYLNQFASKAKGLTTAGLIVLVFTAVMMMMTIESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +                   ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSMSSYLFTKSLAFAGSTSTPPVFEWLLAAASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +   +++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVVGGVCAALAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L++LY+     + GA + +++    
Sbjct: 244 AFATVPMFLLWLYLSWFVTLAGAMIASALPAIR 276


>gi|239983428|ref|ZP_04705952.1| ribonuclease BN family membrane protein [Streptomyces albus J1074]
          Length = 297

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 50/268 (18%), Positives = 101/268 (37%), Gaps = 4/268 (1%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
           +   +  F +++    A+ ++   +L++FP ++   +L G  G       V++ +    P
Sbjct: 2   LRRTVAEFQDDELADRAAALTYYGVLALFPGLLVLVSLLGVAG-ESTTRRVLESIKKMAP 60

Query: 72  EVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
                 +T  +  V      G  L  +  LAA + +S  V A   S N  Y + E R  +
Sbjct: 61  GPARDVVTSAVEGVQGAGGVGSLLAVVGVLAALWSASGYVGAFIRSSNAVYDMPEGRPVW 120

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
               +  G  +   V  V  + + V                   L +    +    +L +
Sbjct: 121 KVLPVRVGTTVALVVMAVGSALIVVFTGDLARRAGSLLGIGDTALTVWSIAKWPVLLLLV 180

Query: 190 FIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
              +  +    P  K      + PG     + W++ +  F  Y+  F +Y+  Y  LA +
Sbjct: 181 IGMIALLFWAAPNTKGPGFRWVTPGSFLALVIWLLASAGFAVYVANFGSYNKTYGALAGV 240

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYY 276
           +  LV+L++  +  +LG E +A +    
Sbjct: 241 VVFLVWLWISNIAILLGLEFDAELARER 268


>gi|311032903|ref|ZP_07710993.1| putative Ribonuclease BN [Bacillus sp. m3-13]
          Length = 286

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 56/270 (20%), Positives = 114/270 (42%), Gaps = 2/270 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
            +   +        ++    +A+  +   +LS+FP +V   ++  +L        VI+ +
Sbjct: 3   RLVKFLKRLGLEMKKDRATGLAAEQAYYYMLSLFPLLVLALSIIPYLNIDP--QKVIEFL 60

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               P        + I + +  P  GL T   L   + +SNG+ A   ++N A+ V E R
Sbjct: 61  QTMMPPETIAVFEENINEFVNKPNGGLLTFGILGTIWSASNGMNAFISAMNEAFNVEESR 120

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            +Y+ RL+S G  +      +I  F+ V   + +  +       G+  +I+   R     
Sbjct: 121 PFYLVRLLSIGLTIGLIFAFLIAFFLPVFGGIIIKQLESVIYIPGSTAIILNILRFIIAF 180

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             +F  +  ++   P        +LPG I   + W + ++ F+ Y+  F  YS  Y  L 
Sbjct: 181 FVIFTIIAVLYRIAPDISKSFKQLLPGAIVATVIWQLVSLGFSFYVSNFGNYSATYGSLG 240

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            ++  +++L++ G+  ++G E+NA      
Sbjct: 241 GVIILMLWLFLTGLALVIGGEINAIFHKNR 270


>gi|227535434|ref|ZP_03965483.1| ribonuclease BN [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
 gi|227186917|gb|EEI66984.1| ribonuclease BN [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
          Length = 349

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 66/269 (24%), Positives = 121/269 (44%), Gaps = 2/269 (0%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
            +  AI    E +    A+ ++   LLS+FP I+F AN   + G       +   +  A 
Sbjct: 56  FVKLAINRITESNIGQSAAALAYYTLLSLFPLILFVANALPYFGL--TYKGLAAYLTQAI 113

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P  +   +   I  +L   + GL  I A+A  + +S GV  L++  N+ Y V   +++ I
Sbjct: 114 PSNVMNWLDPVIANLLDSSSGGLLGIGAVATLWAASLGVNGLKMGFNQIYGVESSQNFII 173

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            RL+S        + +  +  VF      L ++        + L      R   T+ ALF
Sbjct: 174 QRLLSMLMTFTLIIVMGAILIVFAFGRQFLEWLIPLLRLNDDWLRTFNTLRWPVTITALF 233

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           + ++F++ FLP  K ++ ++LPG  FT   W++ A  F+ Y+  F T    Y  + + + 
Sbjct: 234 VIIMFLNYFLPNVKIRMWTVLPGTAFTVAGWLLIAQAFSLYMKYFGTRYLSYGTIGTFIA 293

Query: 251 CLVFLYMLGVFFILGAELNASMIIYYWRK 279
            +++L    +  + GA +NA    Y+  +
Sbjct: 294 IMLWLNFSALVLLWGAVINALTAEYFIGR 322


>gi|118581183|ref|YP_902433.1| putative ribonuclease BN [Pelobacter propionicus DSM 2379]
 gi|118503893|gb|ABL00376.1| tRNA-processing RNAse BN [Pelobacter propionicus DSM 2379]
          Length = 417

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 47/276 (17%), Positives = 110/276 (39%), Gaps = 6/276 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M+     +    Y     F    G   A+ ++ + +LS+ P +     +   LGA   + 
Sbjct: 1   MKGRLFDLLRFCYLVRAGFSLHQGALRAAALTYTTMLSLVPVLAIAFAVLKGLGAQNTLE 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
                V   +     + I+  +  V     K +  I  L       + +  + ++ N  +
Sbjct: 61  P----VLQRFAGDSQETISRIVAYVNNTNFKSIGAIGLLVLVMTVISLLGNIEMAFNTIW 116

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
            V E RS           V++  + +++ + +  ++     +V K+      L   + + 
Sbjct: 117 GVRETRSLQRRFSDYLSVVVVGPILILVATSMTTSLQN--QWVVKWLLLHEYLGEAVLSV 174

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
              +  ++++I L+F+++++P  + +  S L G I    +W +    + H+ V  + Y+ 
Sbjct: 175 FRLSPYVSVWIALVFLYIYIPNTRVRFRSALLGGILAGTAWQMAQWAYFHFQVGVANYNA 234

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           +Y  LA++   LV++Y   +  +LG E+        
Sbjct: 235 IYGTLAALPVFLVWVYTSWLIVLLGLEIVCIHQRRR 270


>gi|258451051|ref|ZP_05699087.1| conserved hypothetical protein [Staphylococcus aureus A5948]
 gi|257861293|gb|EEV84105.1| conserved hypothetical protein [Staphylococcus aureus A5948]
          Length = 405

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 119/270 (44%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L+          L   L       + I  +   
Sbjct: 72  NFLSYLIYRIGKDDASGLAAQMTYHFVLA---MFPMLLFLLTLLPFFNIKQSQITNMLSN 128

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 129 APAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGI 188

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V  V+   +     +   ++         +  I    RI   ++ +
Sbjct: 189 VLKLLSVVFTVVMGVVFVVALALPTLGSIISHFLFGPLGFDEQVKWIFNLIRIVLPIIII 248

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI  I ++   P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+
Sbjct: 249 FIIFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGII 308

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +      K
Sbjct: 309 ILLLWLYITSFIIIVGAEINAIIHQRSVIK 338


>gi|57652102|ref|YP_186766.1| ribonuclease BN, putative [Staphylococcus aureus subsp. aureus COL]
 gi|57286288|gb|AAW38382.1| ribonuclease BN, putative [Staphylococcus aureus subsp. aureus COL]
          Length = 405

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 119/270 (44%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L+          L   L       + I  +   
Sbjct: 72  NFLSYLIYRIGKDDASGLAAQMTYHFVLA---MFPMLLFLLTLLPFFNIKQSQITNMLSN 128

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 129 APAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGI 188

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V  V+   +     +   ++         +  I    RI   ++ +
Sbjct: 189 VLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIII 248

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI  I ++   P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+
Sbjct: 249 FIIFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGII 308

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +      K
Sbjct: 309 ILLLWLYITSFIIIVGAEINAIIHQRSVIK 338


>gi|15927457|ref|NP_374990.1| hypothetical protein SA1699 [Staphylococcus aureus subsp. aureus
           N315]
 gi|87160245|ref|YP_494516.1| hypothetical protein SAUSA300_1864 [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88195779|ref|YP_500588.1| hypothetical protein SAOUHSC_02097 [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|148268355|ref|YP_001247298.1| ribonuclease BN [Staphylococcus aureus subsp. aureus JH9]
 gi|150394417|ref|YP_001317092.1| ribonuclease BN [Staphylococcus aureus subsp. aureus JH1]
 gi|151222033|ref|YP_001332855.1| ribonuclease BN [Staphylococcus aureus subsp. aureus str. Newman]
 gi|161510102|ref|YP_001575761.1| ribonuclease BN [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221141456|ref|ZP_03565949.1| hypothetical protein SauraJ_07428 [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|253729641|ref|ZP_04863806.1| ribonuclease BN [Staphylococcus aureus subsp. aureus USA300_TCH959]
 gi|257793763|ref|ZP_05642742.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|258408905|ref|ZP_05681187.1| conserved hypothetical protein [Staphylococcus aureus A9763]
 gi|258420991|ref|ZP_05683922.1| ribonuclease BN [Staphylococcus aureus A9719]
 gi|258430037|ref|ZP_05688407.1| ribonuclease BN [Staphylococcus aureus A9299]
 gi|258443445|ref|ZP_05691787.1| ribonuclease BN [Staphylococcus aureus A8115]
 gi|258445303|ref|ZP_05693494.1| ribonuclease BN [Staphylococcus aureus A6300]
 gi|258453300|ref|ZP_05701285.1| ribonuclease BN [Staphylococcus aureus A5937]
 gi|269203535|ref|YP_003282804.1| ribonuclease BN, putative [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282894548|ref|ZP_06302776.1| hypothetical protein SGAG_01896 [Staphylococcus aureus A8117]
 gi|282923219|ref|ZP_06330900.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|282928055|ref|ZP_06335662.1| conserved hypothetical protein [Staphylococcus aureus A10102]
 gi|294849428|ref|ZP_06790170.1| hypothetical protein SKAG_01510 [Staphylococcus aureus A9754]
 gi|295407261|ref|ZP_06817060.1| hypothetical protein SMAG_02434 [Staphylococcus aureus A8819]
 gi|296275884|ref|ZP_06858391.1| hypothetical protein SauraMR_06032 [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297246212|ref|ZP_06930063.1| hypothetical protein SLAG_02294 [Staphylococcus aureus A8796]
 gi|304379067|ref|ZP_07361814.1| YihY family protein [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|13701676|dbj|BAB42969.1| SA1699 [Staphylococcus aureus subsp. aureus N315]
 gi|87126219|gb|ABD20733.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87203337|gb|ABD31147.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|147741424|gb|ABQ49722.1| putative ribonuclease BN [Staphylococcus aureus subsp. aureus JH9]
 gi|149946869|gb|ABR52805.1| putative ribonuclease BN [Staphylococcus aureus subsp. aureus JH1]
 gi|150374833|dbj|BAF68093.1| ribonuclease BN [Staphylococcus aureus subsp. aureus str. Newman]
 gi|160368911|gb|ABX29882.1| possible ribonuclease BN [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253726637|gb|EES95366.1| ribonuclease BN [Staphylococcus aureus subsp. aureus USA300_TCH959]
 gi|257787735|gb|EEV26075.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|257840352|gb|EEV64814.1| conserved hypothetical protein [Staphylococcus aureus A9763]
 gi|257842939|gb|EEV67357.1| ribonuclease BN [Staphylococcus aureus A9719]
 gi|257849631|gb|EEV73599.1| ribonuclease BN [Staphylococcus aureus A9299]
 gi|257851330|gb|EEV75270.1| ribonuclease BN [Staphylococcus aureus A8115]
 gi|257855821|gb|EEV78745.1| ribonuclease BN [Staphylococcus aureus A6300]
 gi|257864508|gb|EEV87251.1| ribonuclease BN [Staphylococcus aureus A5937]
 gi|262075825|gb|ACY11798.1| ribonuclease BN, putative [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269941354|emb|CBI49751.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282590119|gb|EFB95200.1| conserved hypothetical protein [Staphylococcus aureus A10102]
 gi|282593130|gb|EFB98129.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|282763035|gb|EFC03167.1| hypothetical protein SGAG_01896 [Staphylococcus aureus A8117]
 gi|285817563|gb|ADC38050.1| Ribonuclease BN [Staphylococcus aureus 04-02981]
 gi|294823565|gb|EFG39992.1| hypothetical protein SKAG_01510 [Staphylococcus aureus A9754]
 gi|294967836|gb|EFG43866.1| hypothetical protein SMAG_02434 [Staphylococcus aureus A8819]
 gi|297176919|gb|EFH36176.1| hypothetical protein SLAG_02294 [Staphylococcus aureus A8796]
 gi|302751755|gb|ADL65932.1| putative membrane protein [Staphylococcus aureus subsp. aureus str.
           JKD6008]
 gi|304342302|gb|EFM08194.1| YihY family protein [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312830255|emb|CBX35097.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ECT-R 2]
 gi|315129310|gb|EFT85304.1| hypothetical protein CGSSa03_08610 [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|315196045|gb|EFU26405.1| hypothetical protein CGSSa01_12032 [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320139739|gb|EFW31608.1| YihY family protein [Staphylococcus aureus subsp. aureus MRSA131]
 gi|320142345|gb|EFW34159.1| YihY family protein [Staphylococcus aureus subsp. aureus MRSA177]
 gi|329314559|gb|AEB88972.1| Ribonuclease BN [Staphylococcus aureus subsp. aureus T0131]
 gi|329724799|gb|EGG61303.1| YihY family protein [Staphylococcus aureus subsp. aureus 21172]
 gi|329728613|gb|EGG65043.1| YihY family protein [Staphylococcus aureus subsp. aureus 21189]
          Length = 405

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 119/270 (44%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L+          L   L       + I  +   
Sbjct: 72  NFLSYLIYRIGKDDASGLAAQMTYHFVLA---MFPMLLFLLTLLPFFNIKQSQITNMLSN 128

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 129 APAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGI 188

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V  V+   +     +   ++         +  I    RI   ++ +
Sbjct: 189 VLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIII 248

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI  I ++   P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+
Sbjct: 249 FIIFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGII 308

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +      K
Sbjct: 309 ILLLWLYITSFIIIVGAEINAIIHQRSVIK 338


>gi|237712832|ref|ZP_04543313.1| ribonuclease BN [Bacteroides sp. D1]
 gi|262408811|ref|ZP_06085356.1| ribonuclease BN [Bacteroides sp. 2_1_22]
 gi|294648195|ref|ZP_06725735.1| YihY family protein [Bacteroides ovatus SD CC 2a]
 gi|294810773|ref|ZP_06769421.1| YihY family protein [Bacteroides xylanisolvens SD CC 1b]
 gi|229447160|gb|EEO52951.1| ribonuclease BN [Bacteroides sp. D1]
 gi|262353022|gb|EEZ02117.1| ribonuclease BN [Bacteroides sp. 2_1_22]
 gi|292636470|gb|EFF54948.1| YihY family protein [Bacteroides ovatus SD CC 2a]
 gi|294442106|gb|EFG10925.1| YihY family protein [Bacteroides xylanisolvens SD CC 1b]
          Length = 439

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 48/275 (17%), Positives = 97/275 (35%), Gaps = 4/275 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +     +   IY  I  F ++     AS ++ S LL++ P +     +A   G    +  
Sbjct: 28  KFSLYNIIKTIYLCINRFTKDRMANKASALTYSTLLAIVPILAILFAVARGFGFDNLMEH 87

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
                FG   E     ++     +          +  +   +   N V  + I+ NR + 
Sbjct: 88  QFRNGFGGNIETTEAILSFVNSYLSQTKGGIFIGVGLVMLLWTVINLVSNIEITFNRIWE 147

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V + RS Y      F   LL  + +V+   + + +   L            L  I+    
Sbjct: 148 VKKARSMYRKITDYFSMFLLMPILIVVSGGLSLFMSTILK----QMDDFVLLAPIMKFMI 203

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                +  ++    +++F+P  K K    L   I    ++     L+ +  +  S Y+ +
Sbjct: 204 RLIPFVLTWLMFTGLYIFMPNTKVKFKHALIAGILAGSAYQAFQFLYINSQLWVSKYNAI 263

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           Y   A++   L++L +     + GAEL  +     
Sbjct: 264 YGSFAALPLFLLWLQISWTICLFGAELTYAGQNIR 298


>gi|167836869|ref|ZP_02463752.1| YihY family protein [Burkholderia thailandensis MSMB43]
          Length = 437

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 36/273 (13%), Positives = 94/273 (34%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A +   E+    +A  ++ + +L++ P +     L         F  ++ 
Sbjct: 8   LDTIKRLARFAAKRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQNSLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     +   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNSQIFKYLNQFASKAKGLTTAGLIVLVVTAVMMMMTIESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +                   ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSISSYLFTKSLAFTGSTSMPPIFEWLLAAASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +   +++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVVGGVCAAVAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L++LY+     + GA + +++    
Sbjct: 244 AFATVPMFLLWLYLSWFVTLAGAMIASALPAIR 276


>gi|294142884|ref|YP_003558862.1| ribonuclease BN [Shewanella violacea DSS12]
 gi|293329353|dbj|BAJ04084.1| ribonuclease BN [Shewanella violacea DSS12]
          Length = 366

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 44/275 (16%), Positives = 103/275 (37%), Gaps = 8/275 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVIDVV 66
           ++  +    +   E+     A H++   LLS+ P +    ++         +   +   +
Sbjct: 45  IWHFMVHLKQRLAEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFSEIRGQIESFI 104

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
           +  +       +   I + +   +KG   +   A    +   +  +  S+N  +R  E R
Sbjct: 105 YENFLPSAGDSVQVYINEFVDNASKG-TAVGIAALMVVAIMLISNIDKSINSIWRTTEKR 163

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S  ++  + +  + L  V +         +     +         +L  ++        M
Sbjct: 164 SMVVSFSMYWMVLTLGPVLMGASLVATSYVVSLKVFNGA------DLTGVVPLLVERLPM 217

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
                  + +++ +P  K K    L G I   + +  G   F  Y+  F +Y  +Y  LA
Sbjct: 218 FFSVATFLLIYMVVPNTKVKFFHALLGAIAAALLFEFGKKGFAFYLTQFPSYEAIYGALA 277

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
           +I    +++Y+  +  ++GAE+ A++  Y  +K P
Sbjct: 278 TIPILFMWVYLSWMIVLIGAEITAALPEYLDKKLP 312


>gi|150391950|ref|YP_001321999.1| putative ribonuclease BN [Alkaliphilus metalliredigens QYMF]
 gi|149951812|gb|ABR50340.1| putative ribonuclease BN [Alkaliphilus metalliredigens QYMF]
          Length = 276

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 60/276 (21%), Positives = 125/276 (45%), Gaps = 2/276 (0%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
           F  + +++      F +++  A+ + IS   +LS FPF++F   L G++   +     + 
Sbjct: 3   FRRIKEVLLHLYNQFDKDEVPALGAQISYYLILSFFPFLIFLIVLIGYIPLTE--ERTLY 60

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
            +    P      + + IL++       L +   L   + +S G  A+   +N+AY V E
Sbjct: 61  ELALILPHDAYSLVEEIILEITTADNTTLISFGMLGTLWTASRGTSAMIRGMNKAYNVKE 120

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R ++    +   + +  +  ++    + V   L    +         L       R   
Sbjct: 121 DRPFWKVAGMGVIFTIGLAFMILFSLTLLVFGQLLGEMLINQLNLSTLLEPTWRLVRYGV 180

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
            +LALF     ++LF P    K+ +I  G +F+ + WVV ++ F +Y+  F  Y+ +Y  
Sbjct: 181 ALLALFSTFTLLYLFGPNYHLKLKNIYWGALFSTVGWVVISLGFAYYVNNFGNYTRVYGS 240

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +  +M  L++LY+  +  ++GAE+N+++ ++  R K
Sbjct: 241 IGGVMILLIWLYLSSLIVLMGAEVNSTIWVFSKRGK 276


>gi|29346725|ref|NP_810228.1| ribonuclease BN [Bacteroides thetaiotaomicron VPI-5482]
 gi|29338622|gb|AAO76422.1| ribonuclease BN [Bacteroides thetaiotaomicron VPI-5482]
          Length = 439

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 46/275 (16%), Positives = 97/275 (35%), Gaps = 4/275 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +     +   +Y  I  F ++     AS ++ S LL++ P +     +A   G    +  
Sbjct: 28  KFSLYNIIKTVYLCINRFTKDRMANKASALTYSTLLAIVPILAILFAVARGFGFDNLMEH 87

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
                FG   E     ++     +          +  +   +   N V  + I+ NR + 
Sbjct: 88  QFRSGFGGNTETTEAILSFVNSYLSQTKGGIFIGVGLVMLLWTVINLVSNIEITFNRIWE 147

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V + RS Y      F   LL  + +V+   + + +   L            L  ++    
Sbjct: 148 VKKARSMYRKITDYFSMFLLMPILIVVSGGLSLFVSTVLK----QMDDFVLLAPVMKFSI 203

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                +  ++    +++F+P  K K    L   I    ++     L+ +  +  S Y+ +
Sbjct: 204 RLIPFVLTWLMFTGLYIFMPNTKVKFKHALIAGILAGSAYQAFQFLYINSQLWVSKYNAI 263

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           Y   A++   L++L +     + GAEL  +     
Sbjct: 264 YGSFAALPLFLLWLQISWTICLFGAELTYAGQNIR 298


>gi|15924873|ref|NP_372407.1| transporter [Staphylococcus aureus subsp. aureus Mu50]
 gi|156980199|ref|YP_001442458.1| hypothetical protein SAHV_1868 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|255006671|ref|ZP_05145272.2| hypothetical protein SauraM_09385 [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|14247655|dbj|BAB58045.1| similar to transporter [Staphylococcus aureus subsp. aureus Mu50]
 gi|156722334|dbj|BAF78751.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3]
          Length = 405

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 119/270 (44%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L+          L   L       + I  +   
Sbjct: 72  NFLSYLIYRIGKDDASGLAAQMTYHFVLA---MFPMLLFLLTLLPFFNIKQSQITNMLSN 128

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 129 APAETSTLIKSVICDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGI 188

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V  V+   +     +   ++         +  I    RI   ++ +
Sbjct: 189 VLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIII 248

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI  I ++   P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+
Sbjct: 249 FIIFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGII 308

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +      K
Sbjct: 309 ILLLWLYITSFIIIVGAEINAIIHQRSVIK 338


>gi|229918098|ref|YP_002886744.1| ribonuclease BN [Exiguobacterium sp. AT1b]
 gi|229469527|gb|ACQ71299.1| ribonuclease BN [Exiguobacterium sp. AT1b]
          Length = 317

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 58/274 (21%), Positives = 120/274 (43%), Gaps = 4/274 (1%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
                   +    F E D     + ++    LS+FP I+F   L  F    Q   +  + 
Sbjct: 10  KNWLSFGKELFRRFQEHDVQDYGATLAFFWFLSIFPGIIFILALLSFFDVSQ--DSFQNQ 67

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           +    P   A      I + +  P  GL ++ A+ A + ++ GV+ L  +   AY     
Sbjct: 68  LNDLAPGSAASGFLTGIFEAIGEPRGGLLSLGAILAIWSAAKGVDRLITTSLHAYGEDNE 127

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL--LIIWNGRIY 183
           R++++ + ++ G  +L  + ++++    V     +++V ++ P        ++I   R  
Sbjct: 128 RNFFVKKGLALGLTILLGIGMLLLILSNVFGSQIISFVTEYLPVNITGAEEMMINVFRYV 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T + L + L   +   P       S +PG IF  I W + +  F+ Y+  F +Y + Y 
Sbjct: 188 LTTVVLILTLSIFYKVSPQQHVFWKSTIPGAIFGVIGWQIVSFGFSLYVSNFGSYDSTYG 247

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
            L  I+  L++L + G+  ++G+E+NA+ + ++ 
Sbjct: 248 SLGGIIVTLLWLQLTGMIILIGSEINATWMRFFK 281


>gi|253573082|ref|ZP_04850474.1| ribonuclease BN [Bacteroides sp. 1_1_6]
 gi|251837339|gb|EES65438.1| ribonuclease BN [Bacteroides sp. 1_1_6]
          Length = 439

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 47/275 (17%), Positives = 97/275 (35%), Gaps = 4/275 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +     +   IY  I  F ++     AS ++ S LL++ P +     +A   G    +  
Sbjct: 28  KFSLYNIIKTIYLCINRFTKDRMANKASALTYSTLLAIVPILAILFAVARGFGFDNLMEH 87

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
                FG   E     ++     +          +  +   +   N V  + I+ NR + 
Sbjct: 88  QFRSGFGGNIETTEAILSFVNSYLSQTKGGIFIGVGLVMLLWTVINLVSNIEITFNRIWE 147

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V + RS Y      F   LL  + +V+   + + +   L            L  ++    
Sbjct: 148 VKKARSMYRKITDYFSMFLLMPILIVVSGGLSLFVSTVLK----QMDDFVLLAPVMKFMI 203

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                +  ++    +++F+P  K K    L   I    ++     L+ +  +  S Y+ +
Sbjct: 204 RLIPFVLTWLMFTGLYIFMPNTKVKFKHALIAGILAGSAYQAFQFLYINSQLWVSKYNAI 263

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           Y   A++   L++L +     + GAEL  +     
Sbjct: 264 YGSFAALPLFLLWLQISWTICLFGAELTYAGQNIR 298


>gi|53719578|ref|YP_108564.1| putative tRNA processing exoribonuclease [Burkholderia pseudomallei
           K96243]
 gi|52209992|emb|CAH35965.1| putative tRNA processing exoribonuclease [Burkholderia pseudomallei
           K96243]
          Length = 434

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 36/273 (13%), Positives = 95/273 (34%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A +   E+    +A  ++ + +L++ P +     L         F  ++ 
Sbjct: 5   LDTIKRLARFAAKRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQNSLQ 64

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +   + +   +  +  + N  +RV 
Sbjct: 65  GFLADHLMPAQFNSQIFKYLNQFASKAKGLTTAGLIVLVFTAVMMMMTIESAFNLIWRVR 124

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +                   ++    + 
Sbjct: 125 KPRPFAQRVLAYWALITLGPLLFGVSLSMSSYLFTKSLAFAGSTSTPPVFEWLLAAASLP 184

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +   +++ +    F +Y+    TY+ +Y 
Sbjct: 185 LTVL----AFTLLYVYLPNCTVAWRDAVVGGVCAALAFELAKRGFGYYVRRIPTYTAVYG 240

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L++LY+     + GA + +++    
Sbjct: 241 AFATVPMFLLWLYLSWFVTLAGAMIASALPAIR 273


>gi|86748374|ref|YP_484870.1| ribonuclease BN, putative [Rhodopseudomonas palustris HaA2]
 gi|86571402|gb|ABD05959.1| ribonuclease BN, putative [Rhodopseudomonas palustris HaA2]
          Length = 356

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 57/267 (21%), Positives = 115/267 (43%), Gaps = 8/267 (2%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           ++        ++    +A+ +    LL++FP I    +          +   +  +    
Sbjct: 80  VLRGTYARINDDRLMLVAAGVVFYGLLALFPGISALVSSYALFTDGGTINGHLQQLAAIV 139

Query: 71  PEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
           PE     I D++ +VLA     L      S   A +  + GV+A+  + N  Y   E R 
Sbjct: 140 PEGTYSVIEDQVGRVLANGETRLGLAFLSSLALALWSVNGGVKAVIDASNVVYDKQESRG 199

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           +     +S G+ + A   ++    + +A P+AL+ +           ++I  GR     L
Sbjct: 200 FIKLNALSLGFTIGALAAVLSAIGLVIATPIALSMIGMEGQG----AVLIGYGRWPLLAL 255

Query: 188 ALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             F GL  ++   P   +     +LPG +F  ++W+VG+ L ++Y+  F+ Y   Y  L 
Sbjct: 256 LTFAGLAVLYRHAPDRDTPHWRWVLPGCVFATLAWIVGSALLSYYLGNFANYDATYGSLG 315

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMI 273
           + +  +++++M  +  ++G ELNA + 
Sbjct: 316 AAIGLMIWMWMTAIVVLVGGELNAEIE 342


>gi|170728937|ref|YP_001762963.1| ribonuclease BN [Shewanella woodyi ATCC 51908]
 gi|226737458|sp|B1KLY8|Y4618_SHEWM RecName: Full=UPF0761 membrane protein Swoo_4618
 gi|169814284|gb|ACA88868.1| ribonuclease BN [Shewanella woodyi ATCC 51908]
          Length = 336

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 49/274 (17%), Positives = 106/274 (38%), Gaps = 8/274 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVIDVV 66
           ++  +    +   E+     A H++  +LLS+ P +    ++       Q +   + D +
Sbjct: 17  IWHFMIHLKQRLAEDQINIRAGHLAYVSLLSLVPMVAVTMSMLSAFPVFQGIRGQIEDFI 76

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
           +  +       +   I + +   +KG   +   A    +   + ++  SLN  +   E R
Sbjct: 77  YNNFIPSAGDSVQVYINEFVDNASKG-TAVGIAALMVVAIMLISSIDKSLNSIWHTKEKR 135

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S  I+  + +  + L  V +         +     +         +L  ++        M
Sbjct: 136 SMVISFSMYWMVLTLGPVLMGASLVATSYVVSLKVFNGS------DLSGVVPLLVERLPM 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           L      + +++ +P  K K    L G I   + +  G   F  Y+  F TY  +Y  LA
Sbjct: 190 LFSVATFLLIYMVVPNTKVKFFHALLGAIVAALMFEFGKKGFALYLTKFPTYEAIYGALA 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +I    +++Y+  +  +LGA + A+M  Y  +K+
Sbjct: 250 TIPILFLWVYLSWMIVLLGAVITAAMPEYLDKKQ 283


>gi|293604640|ref|ZP_06687042.1| tRNA-processing ribonuclease BN [Achromobacter piechaudii ATCC
           43553]
 gi|292816971|gb|EFF76050.1| tRNA-processing ribonuclease BN [Achromobacter piechaudii ATCC
           43553]
          Length = 437

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 44/272 (16%), Positives = 101/272 (37%), Gaps = 9/272 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF-- 67
            +    ++   EE    +AS ++ + +L++ P +    +L       Q     ++     
Sbjct: 30  RVFRFTLQRAGEEKLLQVASSLTFTTVLAIVPMLAVVLSLFTAFPVFQEFRVALEDFLTN 89

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P  ++  I + + Q  A  A  L  I        S   +  +  + N  + V   R 
Sbjct: 90  SLMPPSVSDNIMEYLNQF-ARQASRLTAIGGAFLLVTSLLLIMTIDQAFNDIWHVSRQRP 148

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
                L+ +  + L  V      +    +       R+    + ++  +I     +  ++
Sbjct: 149 LPQRALVYWAIITLGPVLAGASLWATSFV------ARESLGLVSDVPEVISVVVSFIPLV 202

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
              +G   + + +P  +      L G   T I+  +    F +Y+  F TY+ +Y   A+
Sbjct: 203 LTGLGFAALFVVVPNREVLWRDALVGGFVTAIALEIMKSGFAYYLTRFPTYTIIYGAFAT 262

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           +   L+++Y+  +  +LGA L +S  +    +
Sbjct: 263 LPIFLLWIYLSWLAVLLGATLASSAPLIRLGR 294


>gi|299820568|ref|ZP_07052458.1| YihY family protein [Listeria grayi DSM 20601]
 gi|299818063|gb|EFI85297.1| YihY family protein [Listeria grayi DSM 20601]
          Length = 285

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 63/273 (23%), Positives = 132/273 (48%), Gaps = 2/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
            F  +   +    + D    A+ ++   L S+FP ++    L GFL   +   ++  +V 
Sbjct: 10  FFRFVQLLLARMKKNDVTGNAAQLAYYMLFSIFPLLLVAVALLGFLNLDK--DSIFQMVE 67

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P+ I   I   + QVL+  + GL ++  LA  + +SNG+ A+  +LN+AY +++ R+
Sbjct: 68  DFAPKQIIDFIQTNLDQVLSNRSGGLLSVGILATLWSASNGMAAVMKALNKAYGIIDRRN 127

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           + I +L+S  + +   VT+ I   + V       ++         ++ +    R   ++L
Sbjct: 128 FIIQKLLSVLFTVAMLVTVAITLVLLVFGQQIGDFLLHSLHMPSQVIDVWNGLRELLSVL 187

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            + +   F++ F P  K  I ++LPG +F  I W + ++ F  Y+  F  Y+  Y  +  
Sbjct: 188 VILVVFTFLYWFAPNRKGTIKTVLPGALFASIGWSLASIGFAFYVNNFGNYTATYGSIGI 247

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           ++  +++ ++ G+  I+G ELN ++     +K+
Sbjct: 248 VIVLMLWFFLTGIILIVGGELNGTLAFIKQKKE 280


>gi|298386622|ref|ZP_06996178.1| YihY family protein [Bacteroides sp. 1_1_14]
 gi|298260999|gb|EFI03867.1| YihY family protein [Bacteroides sp. 1_1_14]
          Length = 439

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 47/275 (17%), Positives = 97/275 (35%), Gaps = 4/275 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +     +   IY  I  F ++     AS ++ S LL++ P +     +A   G    +  
Sbjct: 28  KFSLYNIIKTIYLCINRFTKDRMANKASALTYSTLLAIVPILAILFAVARGFGFDNLMEH 87

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
                FG   E     ++     +          +  +   +   N V  + I+ NR + 
Sbjct: 88  QFRSGFGGNIETTEAILSFVNSYLSQTKGGIFIGVGLVMLLWTVINLVSNIEITFNRIWE 147

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V + RS Y      F   LL  + +V+   + + +   L            L  ++    
Sbjct: 148 VKKARSMYRKITDYFSMFLLMPILIVVSGGLSLFVSTVLK----QMDDFVLLAPVMKFMI 203

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                +  ++    +++F+P  K K    L   I    ++     L+ +  +  S Y+ +
Sbjct: 204 RLIPFVLTWLMFTGLYIFMPNTKVKFKHALIAGILAGSAYQAFQFLYINSQLWVSKYNAI 263

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           Y   A++   L++L +     + GAEL  +     
Sbjct: 264 YGSFAALPLFLLWLQISWTICLFGAELTYAGQNIR 298


>gi|312962672|ref|ZP_07777161.1| ribonuclease BN [Pseudomonas fluorescens WH6]
 gi|311283047|gb|EFQ61639.1| ribonuclease BN [Pseudomonas fluorescens WH6]
          Length = 314

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 61/275 (22%), Positives = 125/275 (45%), Gaps = 1/275 (0%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
             +  ++   ++ FV+++    AS ++   L S+FPF++F   L GFL    F   +   
Sbjct: 9   LKLHKVLARTVKEFVDDEMSTYASALAYQMLFSLFPFLLFLIALIGFLHLPDFFSWLRLQ 68

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
                P    + +   I Q+      GL ++  + A + +S GV  +  ++N AY VVE 
Sbjct: 69  SELVLPPQALEQVNPVIDQLQQSK-GGLLSVGIVIALWTASAGVRLMMSAMNAAYDVVEG 127

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R  +    +S  Y +  +  L+  + + V  P  + ++         ++ +    R    
Sbjct: 128 RPIWKRFPLSIFYTVGIAGMLLAAAALMVLGPQVMEWLAGQIGMQEFVVTLWTIVRWPLI 187

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           ++ L   +  ++  +P  + +   I PG +   + W+V ++ F +Y+ TF+ Y+ MY  +
Sbjct: 188 VILLMFAVALMYYVMPDVEQEFRFITPGSVLAVVVWIVASLGFGYYVKTFADYNAMYGSI 247

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            +I+  L++ Y+     +LGAE+NA +       K
Sbjct: 248 GAIIVLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|241113097|ref|YP_002972932.1| ribonuclease BN [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240861305|gb|ACS58971.1| ribonuclease BN [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 359

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 57/277 (20%), Positives = 117/277 (42%), Gaps = 6/277 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
           F  + D+ +      + +    +A+ ++   LL++FP +    +L G +     +   + 
Sbjct: 60  FSGLRDVFWRVFHEVLADRVTLIAAGVTFYLLLALFPAMAALVSLYGLVADPTTISEHLR 119

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTI---SALAAAYFSSNGVEALRISLNRAYR 121
            + G  P      I ++I +++      L          A + + +G  A+  ++N AY 
Sbjct: 120 ELAGLMPSGAFDLIANQIKELVGRRDATLGVTFFVGLGIALWSTHSGTLAIFDAMNVAYE 179

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             E R      LI   + L A +  V+M  +   +P+ L+Y+          LL+ W   
Sbjct: 180 EEEKRGLIRLNLIGLCFTLCAMLLTVVMVVLVGVMPVILSYLWLDQFKEHMALLMRWPLL 239

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
           +     A+     F     PA   K+  +  G + T I+W   ++ F+ Y+  F+ Y+  
Sbjct: 240 LLVVAAAVTSVYRFGPSREPA---KLRWMTWGAVLTTIAWAAMSLGFSFYLDHFANYNAT 296

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           Y  L +++  L+++++  V  I+G ELNA +     +
Sbjct: 297 YGTLGALIGFLIWIWLSVVILIVGGELNAELEHQTAK 333


>gi|86359370|ref|YP_471262.1| putative ribonuclease protein [Rhizobium etli CFN 42]
 gi|86283472|gb|ABC92535.1| putative ribonuclease protein [Rhizobium etli CFN 42]
          Length = 307

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 151/279 (54%), Positives = 209/279 (74%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MR+    ++D++YDAI H VE+DG+AMASH++LS+LL+VFPF++FG  LA FLGA QF  
Sbjct: 1   MRKVLRTIYDVVYDAICHMVEDDGFAMASHVALSSLLAVFPFLIFGTALASFLGADQFSS 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T I ++F  WPE IAKP+ D++LQVL +   GL TIS LAAAYF+SNGVEALRISLNRAY
Sbjct: 61  TAIHLIFDTWPEAIAKPLADQVLQVLTIQRGGLLTISVLAAAYFASNGVEALRISLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R WY TRL S GYVL+A +    +S + VA+PLAL Y RK+ P   + L ++++ 
Sbjct: 121 RVQETRPWYFTRLASLGYVLIAVIIFAAISILLVAVPLALDYARKWLPLFADTLDVVFSW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           RIY T++ L IGL+ +HL+LPA K ++  ++PGV+ T + W+ GA++F +Y+ TF+ Y+ 
Sbjct: 181 RIYGTLVVLTIGLLVMHLWLPAGKRRVFDVIPGVLLTLLLWLAGALVFAYYLATFANYTA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            YAGLAS+M  L+FLYM+GV FI+GAE+NA++I +   +
Sbjct: 241 TYAGLASVMIVLIFLYMVGVIFIIGAEINAALIKFRVFR 279


>gi|254428414|ref|ZP_05042121.1| Ribonuclease BN-like family [Alcanivorax sp. DG881]
 gi|196194583|gb|EDX89542.1| Ribonuclease BN-like family [Alcanivorax sp. DG881]
          Length = 439

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 40/278 (14%), Positives = 97/278 (34%), Gaps = 7/278 (2%)

Query: 4   YFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTV 62
            F  +       +  F E+     A+ ++ + L ++ P +     +   + A        
Sbjct: 13  RFDSIKAFFALLVRQFNEDGCRQSAAALTYTTLFAIVPVMTVSFAVLSSVPALKDKGTQF 72

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
               F  +       + D +    A  A  L  +  +     S   +  +  +LNR ++V
Sbjct: 73  QTWAFEYFVPSAGNMLLDHLQSF-AKQAANLTGLGIVFLVVTSILMLSTVEQTLNRIWKV 131

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
              R    + L+ +  + L  + L +   +   +       +  F      L  +     
Sbjct: 132 QTPRKGLTSLLMYWAVLSLGPICLGLGLAISSYLTS-----QAIFSDTVGYLGGVRLWLS 186

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
               L     L  ++  +P  K  +   + G     + + +    FT +I    +Y  +Y
Sbjct: 187 LLPFLFTTAMLTLMYTVVPNTKIPLRQGVLGAAVAALLFELAKGGFTFFIKQAPSYEVVY 246

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
              A++   L+++Y+     + GAEL  +++++   ++
Sbjct: 247 GAFAAVPVFLLWIYISWTIVLGGAELVRALVVFQEHRR 284


>gi|77919575|ref|YP_357390.1| hypothetical protein Pcar_1979 [Pelobacter carbinolicus DSM 2380]
 gi|77545658|gb|ABA89220.1| tRNA-processing RNAse BN [Pelobacter carbinolicus DSM 2380]
          Length = 479

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 49/285 (17%), Positives = 112/285 (39%), Gaps = 10/285 (3%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R +      +    +  FV +     AS ++ + LLS+ P +    +L    G    +  
Sbjct: 53  RLFLMRQLQVATIVVRGFVSDGCMLRASALTYATLLSIVPLLALMFSLIKGFGGQNVLEP 112

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           ++  +F        + +   +  +     + L T+  +         +  +  S N  + 
Sbjct: 113 LLFKIFTH---GSGEVVGAILSYIENTNFRRLGTVGLVILVATVLTLLSNIEKSFNHIWG 169

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E RS        F  VLL+ + +V    +   +      + +       +   +    
Sbjct: 170 VKETRSLTRRFADYFSVVLLSPLLIVAALSLTTTLRN--QVLVQRLLETAVIGEALLLLF 227

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                LA++    F++LF+P  + ++   L G +F    W +    + ++ +  S Y+ +
Sbjct: 228 NVLPYLAVWAAFTFMYLFMPNTRVQLGPALVGGVFGGTLWQLAQWAYVNFQIGVSKYNAI 287

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAEL-----NASMIIYYWRKKP 281
           Y  +A++   +V+LY+  +  +LG EL     NA+++   + ++P
Sbjct: 288 YGTMAALPILIVWLYVSWMIVLLGLELTYAMQNATILREEYSEEP 332


>gi|288559253|sp|A8FPZ2|Y302_SHESH RecName: Full=UPF0761 membrane protein Ssed_0302
          Length = 318

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 46/278 (16%), Positives = 105/278 (37%), Gaps = 8/278 (2%)

Query: 4   YFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TV 62
           +    +  +    +   E+     A H++   LLS+ P +    ++         +   +
Sbjct: 13  FVLSTWHFMIHLKQRLAEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFSGIRGQI 72

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
              ++  +       +   I + ++  +KG   +   A    +   + A+  +LN  +R 
Sbjct: 73  EGFIYNNFLPAAGDTVQVYINEFVSNASKG-TAVGIAALMVVAIMLISAIDKALNNIWRT 131

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E RS  ++  + +  + L  V +         +     +         +L  ++     
Sbjct: 132 TEKRSMVVSFSMYWMVLTLGPVLMGASLVATSYVVSLKVFNGS------DLSGVVPVLVE 185

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
              M       + +++ +P  K K    L G I   + +  G   F  Y+  F TY  +Y
Sbjct: 186 RLPMFFSVATFLLIYMVVPNIKVKFFHALLGAIVAALLFEFGKKGFAIYLTKFPTYEAIY 245

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             LA+I    +++Y+  +  +LGAE+ A+M  Y  +++
Sbjct: 246 GALATIPILFMWVYLSWIIVLLGAEITAAMPEYLDKRQ 283


>gi|168181945|ref|ZP_02616609.1| YihY family protein [Clostridium botulinum Bf]
 gi|237796863|ref|YP_002864415.1| YihY family protein [Clostridium botulinum Ba4 str. 657]
 gi|182674758|gb|EDT86719.1| YihY family protein [Clostridium botulinum Bf]
 gi|229263986|gb|ACQ55019.1| YihY family protein [Clostridium botulinum Ba4 str. 657]
          Length = 285

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 61/264 (23%), Positives = 124/264 (46%), Gaps = 2/264 (0%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVI 74
               F+E++  A++S ++ + ++SVFPF++F   L G+L  H     ++  +    P   
Sbjct: 16  LANRFLEDEVLALSSQLAYALIISVFPFLMFVITLIGYLPIHS--EDLLLGLKEIMPSNT 73

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
              + + I +++      L + S +   + +S G  A+   LNRAY V E RS+   +++
Sbjct: 74  YLLLKNTIEEIIYTQNGNLLSFSIIFTIWTASAGFRAVVRGLNRAYDVKERRSFVKVQIM 133

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLI 194
           +    L  +  LV+  F+ V        +            I    R    +      L 
Sbjct: 134 TIFCTLGMAFVLVMSIFLLVFGKTIGRTLVYKLGFSLEFNRIWNLIRYIIMIGVTIFILA 193

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++ + P+ + +   +LPG IF  I+W++ ++ F+ Y+  F+ YS +Y  + +++  LV+
Sbjct: 194 ALYYYTPSKRLRWRDVLPGAIFATIAWIIASMGFSFYVDNFNNYSRLYGSIGAVIVFLVW 253

Query: 255 LYMLGVFFILGAELNASMIIYYWR 278
           LY+  +  I G E+NA ++    +
Sbjct: 254 LYLTSIIVITGGEINALLVSNREK 277


>gi|167582142|ref|ZP_02375016.1| YihY family protein [Burkholderia thailandensis TXDOH]
          Length = 437

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 35/273 (12%), Positives = 93/273 (34%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A     E+    +A  ++ + +L++ P +     L         F  ++ 
Sbjct: 8   LDTIKRLARFAARRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQNSLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     +   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNSQIFKYLNQFASKAKGLTTAGLIVLVVTAVMTMMTVESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +                   ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSISSYLFTKSLAFAGSTSTPPIFEWLLTAASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +   +++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVVGGVCAAVAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     + GA + +++    
Sbjct: 244 AFATVPMFLLWMYLSWFVTLAGAMIASALPAIR 276


>gi|332716378|ref|YP_004443844.1| ribonuclease [Agrobacterium sp. H13-3]
 gi|325063063|gb|ADY66753.1| ribonuclease [Agrobacterium sp. H13-3]
          Length = 305

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 144/269 (53%), Positives = 195/269 (72%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            + +DA  HF E+DGWAMASH++LS LL++FPF++FG  LAGFLGA QF  T + ++F  
Sbjct: 10  KVAFDAYSHFAEDDGWAMASHMALSILLALFPFLIFGTALAGFLGADQFSETAVHLIFDT 69

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           WPE IA P+  ++ QVL +P  GL TIS LAAAYF+SNGVEALRISLNRAYRV E R WY
Sbjct: 70  WPEAIAGPLAAQVQQVLTIPRGGLLTISVLAAAYFASNGVEALRISLNRAYRVTETRWWY 129

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           ITRL+S  YVL+A V    +S V VA+P+A ++  + FP L + L  + +  +Y T++ L
Sbjct: 130 ITRLLSLLYVLIAVVVFTGISIVLVAVPVATSFAEQRFPWLTDALNTVSSLGLYGTIVVL 189

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            +GL+  HL+LPA K +I  + PG++ T I WV+GA +F +Y+ TF+ Y+  YAGLAS+M
Sbjct: 190 TVGLVAAHLWLPAGKRRIWDVWPGILLTMIFWVIGAAIFAYYLSTFANYAATYAGLASVM 249

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWR 278
             LVFLYM+GV F+LGAE+NA+++ Y  R
Sbjct: 250 VVLVFLYMVGVIFMLGAEVNAALMKYKVR 278


>gi|148262717|ref|YP_001229423.1| putative ribonuclease BN [Geobacter uraniireducens Rf4]
 gi|146396217|gb|ABQ24850.1| tRNA-processing RNAse BN [Geobacter uraniireducens Rf4]
          Length = 449

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 38/279 (13%), Positives = 104/279 (37%), Gaps = 5/279 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R Y      I+    ++F++++    AS +S + +LS+ P       L   LG    +  
Sbjct: 31  RHYGVKYLQIMALVAKNFLDDNCMLRASALSFTTILSIVPLFALTFALLKGLGVQNKLEP 90

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           +   +         + +   +  +       +  I  +         +  +  + N  + 
Sbjct: 91  L---ILEQVTAGSHELVDKIVTYINNTNMTSMGAIGLVTLIVTVITLLGNIEKAFNVVWG 147

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E RS Y         ++   + ++    +  ++      + K+      +  ++    
Sbjct: 148 VRETRSPYRKFSDYLSVLVSGPLLMLAAISITTSLQ--SQAMVKWLVETAYIGDLMLLFF 205

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                 ++++ + F+++F+P  K +  S + G +     W +    + H+ V  + Y+ +
Sbjct: 206 RLIPYFSIWLAMFFLYIFIPNTKVRFKSAIIGGVLAGTIWQIAQWGYIHFQVGVAKYNAI 265

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           Y  LA +   +V++Y   +  + G E+ ++       ++
Sbjct: 266 YGTLALLPIFMVWIYTSWLIVLFGVEVVSAHQNIRTFRR 304


>gi|83721597|ref|YP_443133.1| YihY family protein [Burkholderia thailandensis E264]
 gi|257139363|ref|ZP_05587625.1| YihY family protein [Burkholderia thailandensis E264]
 gi|83655422|gb|ABC39485.1| YihY family protein [Burkholderia thailandensis E264]
          Length = 437

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 35/273 (12%), Positives = 93/273 (34%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A     E+    +A  ++ + +L++ P +     L         F  ++ 
Sbjct: 8   LDTIKRLARFAARRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQNSLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     +   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNSQIFKYLNQFASKAKGLTTAGLIVLVVTAVMTMMTVESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +                   ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSISSYLFTKSLAFAGSTSTPPIFEWLLTAASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +   +++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVVGGVCAAVAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     + GA + +++    
Sbjct: 244 AFATVPMFLLWMYLSWFVTLAGAMIASALPAIR 276


>gi|330504179|ref|YP_004381048.1| tRNA-processing RNAse BN [Pseudomonas mendocina NK-01]
 gi|328918465|gb|AEB59296.1| tRNA-processing RNAse BN [Pseudomonas mendocina NK-01]
          Length = 405

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 50/283 (17%), Positives = 108/283 (38%), Gaps = 9/283 (3%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV- 59
           M+              + FVE  G   A+ ++ + L +V P +     +   + A Q V 
Sbjct: 1   MQVRLKDWLGFWLSLYQRFVENRGAGNAAALTYTTLFAVVPMMTVTFAMLSAIPAFQGVG 60

Query: 60  PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +   +F  +     + + + + +      + L        A  +   +  +  + N  
Sbjct: 61  EEIQGFIFHNFVPSTGETVQEYLREFTTQARQ-LTWFGVGLLAVTAFLMLVTIEKTFNVI 119

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +RV + R    + L+ +  + L  + L     V   I            +  + ++    
Sbjct: 120 WRVRQPRRGMSSFLLYWAILSLGPLLLGAGFAVSTYIASLS------LISGPDAVVGAKT 173

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
              +A +L+       ++  +P  +  +   L G +F+ I + +   LF  Y+  F  Y 
Sbjct: 174 LLSFAPLLSSIAAFTLLYAAVPNTRVPLRHALLGGLFSAILFEIAKALFGLYVRLFPGYH 233

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMII-YYWRKKP 281
            +Y   A++   LV++Y+  +  +LGAEL   +    YWR++P
Sbjct: 234 LIYGAFATVPLFLVWIYLSWLIVLLGAELVYGLSQPRYWRREP 276


>gi|158520031|ref|YP_001527901.1| putative ribonuclease BN [Desulfococcus oleovorans Hxd3]
 gi|158508857|gb|ABW65824.1| putative ribonuclease BN [Desulfococcus oleovorans Hxd3]
          Length = 450

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 45/269 (16%), Positives = 96/269 (35%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV 62
                   I   A   F+ + G   AS ++   +LS+ P +     +A   G  Q +   
Sbjct: 37  RVLVRYARIFMIAGREFITDGGPLRASALTFYTVLSLVPVMALAFAVAKGFGLQQTLEKE 96

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
           +   F     VI + I      +       L  +      +     +  +  S N  +  
Sbjct: 97  VLAQFPGQEAVILQMIEYARALLDQTKGGLLAGVGVAVLIWTVIKVLNNIEKSFNAIWAN 156

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
              RS           +L+  + L++     V +   +  +      LG    II  G  
Sbjct: 157 TTPRSMGKKFSDYLSIMLVGPLLLILSGSATVLVATQVTAITNKIFFLGWFAPIIMTGLQ 216

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
               L +++   F++ F+P  +  + S + G +    ++ +    +  + V  S Y+ +Y
Sbjct: 217 LLPYLFVWLLFSFIYGFMPNTRVPVRSCIFGGVLAGTAFKLLQWAYLIFQVGVSRYNAIY 276

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNAS 271
              A++   L+++ +  +  + GAEL  +
Sbjct: 277 GSFAALPLFLIWMQLSWLVTLFGAELAYA 305


>gi|153808297|ref|ZP_01960965.1| hypothetical protein BACCAC_02585 [Bacteroides caccae ATCC 43185]
 gi|149129200|gb|EDM20416.1| hypothetical protein BACCAC_02585 [Bacteroides caccae ATCC 43185]
          Length = 439

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 47/275 (17%), Positives = 97/275 (35%), Gaps = 4/275 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +     +   IY  I  F ++     AS ++ S LL++ P +     +A   G    +  
Sbjct: 28  KFSLYNIIKTIYLCINRFTKDRMANKASALTYSTLLAIVPILAILFAVARGFGFDNLMEH 87

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
                FG   E     ++     +          +  +   +   N V  + I+ NR + 
Sbjct: 88  QFRNGFGGNIETTEAILSFVNSYLSQTKGGVFIGVGLVMLLWTVINLVSNIEITFNRIWE 147

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V + RS Y      F   LL  + +V+   + + +   L            L  ++    
Sbjct: 148 VKKARSMYRKITDYFSMFLLMPILIVVSGGLSLFMSTILK----QMDDFVLLAPVMKFMI 203

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                +  ++    +++F+P  K K    L   I    ++     L+ +  +  S Y+ +
Sbjct: 204 RLIPFVLTWMMFTGLYIFMPNTKVKFKHALIAGILAGSAYQAFQFLYINSQLWVSKYNAI 263

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           Y   A++   L++L +     + GAEL  +     
Sbjct: 264 YGSFAALPLFLLWLQISWTICLFGAELAYAGQNIR 298


>gi|159185810|ref|NP_357022.2| transporter [Agrobacterium tumefaciens str. C58]
 gi|159140944|gb|AAK89807.2| transporter [Agrobacterium tumefaciens str. C58]
          Length = 305

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 144/269 (53%), Positives = 194/269 (72%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            + +DA  HF E+DGWAMASH++LS LL++FPF++FG  LAGFLGA QF  T + ++F  
Sbjct: 10  KVAFDAYSHFAEDDGWAMASHMALSILLALFPFLIFGTALAGFLGADQFSETAVHLIFDT 69

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           WPE IA P+  ++ QVL +P  GL TIS LAAAYF+SNGVEALRISLNRAYRV E R WY
Sbjct: 70  WPEAIAGPLAAQVQQVLTIPRGGLLTISVLAAAYFASNGVEALRISLNRAYRVTETRWWY 129

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           +TRL+S  YVL+A V    +S V VA+P+A ++    FP L +LL  + +  +Y T++ L
Sbjct: 130 VTRLLSLLYVLIAVVVFTGISIVLVAVPVATSFAEARFPWLTDLLNTVSSLGLYGTIVVL 189

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
             GL+  HL+LPA K +I  + PG++ T I WV+GA +F +Y+ TF+ Y+  YAGLAS+M
Sbjct: 190 TAGLVAAHLWLPAGKRRIWDVWPGILLTMIFWVIGAAIFAYYLSTFANYAATYAGLASVM 249

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWR 278
             LVFLYM+GV F+LGAE+NA+++ Y  R
Sbjct: 250 VVLVFLYMVGVIFMLGAEVNAALMKYKVR 278


>gi|298695221|gb|ADI98443.1| probable membrane protein [Staphylococcus aureus subsp. aureus
           ED133]
          Length = 405

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 119/270 (44%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L+          L   L       + I  +   
Sbjct: 72  NFLSYLIYRIGKDDASGLAAQMTYHFVLA---MFPMLLFLLTLLPFFNIKQSQITNMLSN 128

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 129 APAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGI 188

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V  V+   +     +   ++         +  I    RI   ++ +
Sbjct: 189 VLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIII 248

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI  I ++   P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+
Sbjct: 249 FIVFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGII 308

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +      K
Sbjct: 309 ILLLWLYITSFIIIVGAEINAIIHQRSVIK 338


>gi|282917228|ref|ZP_06324983.1| hypothetical protein SATG_01802 [Staphylococcus aureus subsp.
           aureus D139]
 gi|282318855|gb|EFB49210.1| hypothetical protein SATG_01802 [Staphylococcus aureus subsp.
           aureus D139]
          Length = 405

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 119/270 (44%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L+          L   L       + I  +   
Sbjct: 72  NFLSYLIYRIGKDDASGLAAQMTYHFVLA---MFPMLLFLLTLLPFFNIKQSQITNMLSN 128

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 129 APAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGI 188

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V  V+   +     +   ++         +  I    RI   ++ +
Sbjct: 189 VLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIII 248

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI  I ++   P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+
Sbjct: 249 FIVFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGII 308

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +      K
Sbjct: 309 ILLLWLYITSFIIIVGAEINAIIHQRSVIK 338


>gi|170760762|ref|YP_001788733.1| YihY family protein [Clostridium botulinum A3 str. Loch Maree]
 gi|169407751|gb|ACA56162.1| YihY family protein [Clostridium botulinum A3 str. Loch Maree]
          Length = 285

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 61/264 (23%), Positives = 125/264 (47%), Gaps = 2/264 (0%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVI 74
               F+E++  A++S ++ + ++SVFPF++F   L G+L  H     ++  +    P   
Sbjct: 16  LANRFLEDEVLALSSQLAYALIISVFPFLMFVITLIGYLPIHS--EDLLLGLKEIMPSNT 73

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
              + + I +++      L + S +   + +S G  A+   LNRAY V E RS+   +++
Sbjct: 74  YLLLKNTIEEIIYTQNGNLLSFSIIFTIWTASAGFRAVVRGLNRAYDVKERRSFVKVQIM 133

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLI 194
           +    L  +  LV+  F+ V        +            I    R    +      L 
Sbjct: 134 TIFCTLGMAFVLVMSIFLLVFGKTIGRTLVYKLGFSLEFNRIWNLIRYIIMIGVTIFILA 193

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++ + P+ + +   +LPG IF+ I+W++ ++ F+ Y+  F+ YS +Y  + +++  LV+
Sbjct: 194 ALYYYTPSKRLRWRDVLPGAIFSTIAWIIASMGFSFYVDNFNNYSRLYGSIGAVIVFLVW 253

Query: 255 LYMLGVFFILGAELNASMIIYYWR 278
           LY+  +  I G E+NA ++    +
Sbjct: 254 LYLTSIIVITGGEINALLVSSREK 277


>gi|282911508|ref|ZP_06319308.1| ribonuclease BN [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282324517|gb|EFB54829.1| ribonuclease BN [Staphylococcus aureus subsp. aureus WBG10049]
 gi|312437652|gb|ADQ76723.1| YihY family protein [Staphylococcus aureus subsp. aureus TCH60]
          Length = 405

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 119/270 (44%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L+          L   L       + I  +   
Sbjct: 72  NFLSYLIYRIGKDDASGLAAQMTYHFVLA---MFPMLLFLLTLLPFFNIKQSQITNMLSN 128

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 129 APAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGI 188

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V  V+   +     +   ++         +  I    RI   ++ +
Sbjct: 189 VLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIII 248

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI  I ++   P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+
Sbjct: 249 FIVFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGII 308

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +      K
Sbjct: 309 ILLLWLYITSFIIIVGAEINAIIHQRSVIK 338


>gi|255693902|ref|ZP_05417577.1| YihY family protein [Bacteroides finegoldii DSM 17565]
 gi|260620267|gb|EEX43138.1| YihY family protein [Bacteroides finegoldii DSM 17565]
          Length = 439

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 48/270 (17%), Positives = 97/270 (35%), Gaps = 4/270 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +     +   IY  I  F ++     AS ++ S LL++ P +     +A   G +  +  
Sbjct: 28  KFSLYNIIKTIYLCINRFTKDRMANKASALTYSTLLAIVPILAILFAVARGFGFNNLMEH 87

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
                FG   E     ++     +          I  +   +   N V  + I+ NR + 
Sbjct: 88  QFRNGFGGNTETTEAILSFVDSYLSQTKGGVFIGIGLVMLLWTVINLVSNIEITFNRIWE 147

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V + RS Y      F   LL  + +V+   + + +   L            L  I+    
Sbjct: 148 VKKARSMYRKITDYFSMFLLMPILIVVSGGLSIFMSTMLK----QMDDFVLLAPIMKFMI 203

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                +  ++    +++F+P  K K    L   +    ++     L+    +  S Y+ +
Sbjct: 204 RLIPFVLTWLMFTGLYIFMPNTKVKFKHALIAGVLAGTAYQAFQYLYISSQLGVSKYNAI 263

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNAS 271
           Y   A++   L++L +     + GAEL  +
Sbjct: 264 YGSFAALPLFLLWLQISWTICLFGAELAYA 293


>gi|85859314|ref|YP_461516.1| ribonuclease BN family membrane protein [Syntrophus aciditrophicus
           SB]
 gi|85722405|gb|ABC77348.1| membrane spanning protein ribonuclease BN-like family [Syntrophus
           aciditrophicus SB]
          Length = 454

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 47/272 (17%), Positives = 104/272 (38%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           + +F  +  ++  +I  F E+     AS ++  +L+S+ P       +A   G  + +  
Sbjct: 40  KSFFLTLLRVLILSIRGFDEDKCKLRASSLTFYSLVSIVPVAAMAFGIAKGFGFEKVLEA 99

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
            +        E++A  I      +       +  I  +   +     +  +  + N  + 
Sbjct: 100 QLRSKLAGHEEILANVIQFSHSLLENTRGGVIAGIGLIVLFWAVIKVLGQIEEAFNDIWG 159

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E R+           +L+  V +++ S + V I   L  + + F  LG L  + +   
Sbjct: 160 VKERRTIGRMFSDYLSLMLICPVLIILSSSMTVFITTQLNLIMEKFTILGVLSPLFFLFL 219

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                  L+    F+++F+P  K +  S L   I     + +    +  + +    Y+ +
Sbjct: 220 KLLPYGLLWSLFTFIYIFMPNTKVRFTSGLLAGIIAGTIFQIVQWGYITFQIGVVQYNAI 279

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
           Y   A +   LV+L +  +  + GAEL+ +  
Sbjct: 280 YGSFAVLPLFLVWLQLSWLIVLYGAELSFAYQ 311


>gi|121997501|ref|YP_001002288.1| putative ribonuclease BN [Halorhodospira halophila SL1]
 gi|288559243|sp|A1WUX4|Y704_HALHL RecName: Full=UPF0761 membrane protein Hhal_0704
 gi|121588906|gb|ABM61486.1| tRNA-processing RNAse BN [Halorhodospira halophila SL1]
          Length = 451

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 38/266 (14%), Positives = 92/266 (34%), Gaps = 8/266 (3%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVIDVVFGAWPE 72
             I+   ++     A  ++   LL++ P +  G ++       +     + + +      
Sbjct: 44  YLIQRIQQDQCAKSAGMLAYVTLLAIVPLMTIGFSVLAAFPVFEGVTDRLREAMVDYLVP 103

Query: 73  VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
             +  I + +   +   A  L  +        +   +  +   LN  +RV   R      
Sbjct: 104 AASDAIDEHLENFMG-RAAELTAVGIAGLTVTALLLLNTIERVLNEIWRVERPRPTLQRF 162

Query: 133 LISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIG 192
           ++ +  + +  + L +       +             L     +I      A  +   I 
Sbjct: 163 MVYWTVLTMGPLLLGVSVASTSYMGTV------NLGPLEPPSDLIAQLLNLAPFVVQAIV 216

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
              ++  +P     ++  + G +     + +    F  +I    TY  +Y  LA++   L
Sbjct: 217 FSLIYSLVPHRSVPVLHAVIGGVVASGLFELAKGGFAAFIARAPTYEVVYGALAALPIFL 276

Query: 253 VFLYMLGVFFILGAELNASMIIYYWR 278
           V+LY+  +  ++GAE+  ++  Y WR
Sbjct: 277 VWLYISWLVILIGAEVTQALRGYRWR 302


>gi|257426015|ref|ZP_05602437.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428688|ref|ZP_05605083.1| ribonuclease BN [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257431298|ref|ZP_05607674.1| ribonuclease BN [Staphylococcus aureus subsp. aureus 68-397]
 gi|257434016|ref|ZP_05610367.1| ribonuclease BN [Staphylococcus aureus subsp. aureus E1410]
 gi|257436920|ref|ZP_05612962.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|282904514|ref|ZP_06312399.1| YihY family protein [Staphylococcus aureus subsp. aureus C160]
 gi|282906286|ref|ZP_06314138.1| ribonuclease BN [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282909202|ref|ZP_06317018.1| ribonuclease BN [Staphylococcus aureus subsp. aureus WW2703/97]
 gi|282914680|ref|ZP_06322465.1| YihY family protein [Staphylococcus aureus subsp. aureus M899]
 gi|282919717|ref|ZP_06327449.1| hypothetical protein SASG_02334 [Staphylococcus aureus subsp.
           aureus C427]
 gi|282925121|ref|ZP_06332781.1| hypothetical protein SARG_02410 [Staphylococcus aureus subsp.
           aureus C101]
 gi|283958644|ref|ZP_06376090.1| YihY family protein [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|293507757|ref|ZP_06667599.1| hypothetical protein SCAG_02273 [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|293510775|ref|ZP_06669477.1| ribonuclease BN [Staphylococcus aureus subsp. aureus M809]
 gi|293539314|ref|ZP_06671993.1| YihY family protein [Staphylococcus aureus subsp. aureus M1015]
 gi|297590065|ref|ZP_06948705.1| YihY family protein [Staphylococcus aureus subsp. aureus MN8]
 gi|257271158|gb|EEV03315.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257274332|gb|EEV05844.1| ribonuclease BN [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257277947|gb|EEV08603.1| ribonuclease BN [Staphylococcus aureus subsp. aureus 68-397]
 gi|257280942|gb|EEV11086.1| ribonuclease BN [Staphylococcus aureus subsp. aureus E1410]
 gi|257283709|gb|EEV13834.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|282313079|gb|EFB43477.1| hypothetical protein SARG_02410 [Staphylococcus aureus subsp.
           aureus C101]
 gi|282316355|gb|EFB46732.1| hypothetical protein SASG_02334 [Staphylococcus aureus subsp.
           aureus C427]
 gi|282321394|gb|EFB51720.1| YihY family protein [Staphylococcus aureus subsp. aureus M899]
 gi|282326770|gb|EFB57067.1| ribonuclease BN [Staphylococcus aureus subsp. aureus WW2703/97]
 gi|282330483|gb|EFB60000.1| ribonuclease BN [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282595070|gb|EFC00037.1| YihY family protein [Staphylococcus aureus subsp. aureus C160]
 gi|283471153|emb|CAQ50364.1| transporter [Staphylococcus aureus subsp. aureus ST398]
 gi|283789684|gb|EFC28506.1| YihY family protein [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|290919849|gb|EFD96918.1| YihY family protein [Staphylococcus aureus subsp. aureus M1015]
 gi|291094820|gb|EFE25088.1| hypothetical protein SCAG_02273 [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|291466406|gb|EFF08930.1| ribonuclease BN [Staphylococcus aureus subsp. aureus M809]
 gi|297577193|gb|EFH95907.1| YihY family protein [Staphylococcus aureus subsp. aureus MN8]
 gi|323439155|gb|EGA96883.1| ribonuclease BN, putative [Staphylococcus aureus O11]
 gi|323441561|gb|EGA99211.1| ribonuclease BN, putative [Staphylococcus aureus O46]
          Length = 405

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 119/270 (44%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L+          L   L       + I  +   
Sbjct: 72  NFLSYLIYRIGKDDASGLAAQMTYHFVLA---MFPMLLFLLTLLPFFNIKQSQITNMLSN 128

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 129 APAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGI 188

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V  V+   +     +   ++         +  I    RI   ++ +
Sbjct: 189 VLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIII 248

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI  I ++   P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+
Sbjct: 249 FIVFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGII 308

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +      K
Sbjct: 309 ILLLWLYITSFIIIVGAEINAIIHQRSVIK 338


>gi|153939153|ref|YP_001392760.1| YihY family protein [Clostridium botulinum F str. Langeland]
 gi|152935049|gb|ABS40547.1| YihY family protein [Clostridium botulinum F str. Langeland]
 gi|295320739|gb|ADG01117.1| YihY family protein [Clostridium botulinum F str. 230613]
          Length = 285

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 61/264 (23%), Positives = 124/264 (46%), Gaps = 2/264 (0%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVI 74
               F+E++  A++S ++ + ++SVFPF++F   L G+L  H     ++  +    P   
Sbjct: 16  LANRFLEDEVLALSSQLAYALIISVFPFLMFVITLIGYLPIHS--EDLLLGLKEIMPSNT 73

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
              + + I +++      L + S +   + +S G  A+   LNRAY V E RS+   +++
Sbjct: 74  YLLLKNTIEEIIYTQNGNLLSFSIIFTIWTASAGFRAVVRGLNRAYDVKERRSFVKVQIM 133

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLI 194
           +    L  +  LV+  F+ V        +            I    R    +      L 
Sbjct: 134 TIFCTLGMAFVLVMSIFLLVFGKTIGRTLVYKLGFSLEFNRIWNLIRYIIMIGVTIFILA 193

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++ + P+ + +   +LPG IF  I+W++ ++ F+ Y+  F+ YS +Y  + +++  LV+
Sbjct: 194 ALYYYTPSKRLRWRDVLPGAIFATIAWIIASMGFSFYVDNFNNYSRLYGSIGAVIVFLVW 253

Query: 255 LYMLGVFFILGAELNASMIIYYWR 278
           LY+  +  I G E+NA ++    +
Sbjct: 254 LYLTSIIVITGGEINALLVSSREK 277


>gi|89054551|ref|YP_510002.1| ribonuclease BN, putative [Jannaschia sp. CCS1]
 gi|88864100|gb|ABD54977.1| ribonuclease BN putative [Jannaschia sp. CCS1]
          Length = 318

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 58/273 (21%), Positives = 118/273 (43%), Gaps = 8/273 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D+ +   +    +    +A+ ++   LL++FP I     ++G L     +   +  + G 
Sbjct: 20  DVAFRLKDEVANDRVGLIAAGVAFYGLLALFPAITAVMAISGLLIEPNAIVDQLSRLGGL 79

Query: 70  WPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P+ +   +TD+   V      GL        L A Y +S G+ +L   +N AY   E R
Sbjct: 80  LPQEVIAIVTDQATAVAGSREGGLGLAAIFGVLVAFYSASKGMASLMQGVNVAYDEDEER 139

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            +   +L++FG  LL  V L++     +A+P  LA++         +  ++        +
Sbjct: 140 GFIRLKLVTFGLTLLLIVGLLVSLGAMLALPAVLAFID----LGPMVEALLTAALWVGLI 195

Query: 187 LALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
                GL  ++ + P+   ++   +  G +   + W+V +  F  Y+  F +Y+  +  L
Sbjct: 196 ALTIFGLSVLYRYAPSRENAEWKWVSLGAVVGCVVWIVASAGFAFYVANFGSYNESFGTL 255

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
             ++  L++ ++     +LGAELNA +     R
Sbjct: 256 GGVVVLLMWFWISAFIILLGAELNAELEAQTRR 288


>gi|253734428|ref|ZP_04868593.1| ribonuclease BN [Staphylococcus aureus subsp. aureus TCH130]
 gi|253727581|gb|EES96310.1| ribonuclease BN [Staphylococcus aureus subsp. aureus TCH130]
 gi|329731512|gb|EGG67875.1| YihY family protein [Staphylococcus aureus subsp. aureus 21193]
          Length = 405

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 119/270 (44%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L+          L   L       + I  +   
Sbjct: 72  NFLSYLIYRIGKDDASGLAAQMTYHFVLA---MFPMLLFLLTLLPFFNIKQSQITNMLSN 128

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 129 APAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGI 188

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V  V+   +     +   ++         +  I    RI   ++ +
Sbjct: 189 VLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIII 248

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI  I ++   P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+
Sbjct: 249 FIVFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGII 308

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +      K
Sbjct: 309 ILLLWLYITSFIIIVGAEINAIIHQRSVIK 338


>gi|311105400|ref|YP_003978253.1| ribonuclease BN-like family protein 1 [Achromobacter xylosoxidans
           A8]
 gi|310760089|gb|ADP15538.1| ribonuclease BN-like family protein 1 [Achromobacter xylosoxidans
           A8]
          Length = 437

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 44/272 (16%), Positives = 101/272 (37%), Gaps = 9/272 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF-- 67
            ++  + E   EE    +AS ++ + +L++ P +    +L       Q     ++     
Sbjct: 30  RVVRFSAERAGEEKLLQVASSLTFTTVLAIVPMLAVVLSLFTAFPVFQEFRVALEDFLTN 89

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P  ++  I D + Q  A  A  L  I  +     S   +  +  + N  + V   R 
Sbjct: 90  SLMPPSVSDNIMDYLNQF-ARQASRLTAIGGVFLLITSLLLIMTIDKAFNDIWHVTRQRP 148

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
                L+ +  + L  V      +    +       R+    + ++   +     +  ++
Sbjct: 149 LRQRALVYWAIITLGPVVAGASLWATSFV------ARESLGLVRDVPEALSVAVSFIPLI 202

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
              +G   + + +P  +      L G   T +   +    F +Y+  F TY+ +Y   A+
Sbjct: 203 LTALGFATLFVMVPNREVLWRDALVGGCVTAVVLEIMKSAFAYYLTRFPTYTVIYGAFAT 262

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           +   L+++Y+  +  +LGA L +S  +    +
Sbjct: 263 LPIFLLWIYLSWLAVLLGAILASSAPLIRLGR 294


>gi|217979693|ref|YP_002363840.1| ribonuclease BN [Methylocella silvestris BL2]
 gi|217505069|gb|ACK52478.1| ribonuclease BN [Methylocella silvestris BL2]
          Length = 360

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 53/274 (19%), Positives = 109/274 (39%), Gaps = 9/274 (3%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           ++      F  +    +A+ ++   LL++FP +    +L GF      V   ID++ G  
Sbjct: 87  VLQRTWRGFNTDRILLVAAGVTFYLLLAIFPAVSALVSLYGFFADRSGVGAQIDLLVGLL 146

Query: 71  PEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
           P      + DE  ++       L          + + ++ G++ L  ++N  Y   E RS
Sbjct: 147 PAGGLDLLRDEATRIATSGQSTLSAVFLFGLAVSIWSANAGMKGLFEAMNVVYEEQENRS 206

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           +      S  +   A +  +      V +P+ L YV        +   I+   R      
Sbjct: 207 FIRLNAWSLAFTFGALLFALAALGAIVLVPIILDYV----GLERSGAAILSLARWPLLFF 262

Query: 188 ALFIGLIFVHLFLPAAKS--KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +L + L  ++ + P+         I  G       W+V ++LF+ Y+  F +Y+  Y  L
Sbjct: 263 SLVLALAILYRYGPSRNPAPSWRWITWGSAAASALWLVASILFSWYVANFGSYNATYGSL 322

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            + +  + ++++     ++G ELN+ +     RK
Sbjct: 323 GAAIGFMTWIWISITVVLVGGELNSQIERQAGRK 356


>gi|82751536|ref|YP_417277.1| hypothetical protein SAB1815 [Staphylococcus aureus RF122]
 gi|82657067|emb|CAI81504.1| probable membrane protein [Staphylococcus aureus RF122]
          Length = 405

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 119/270 (44%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L+          L   L       + I  +   
Sbjct: 72  NFLSYLIYRIGKDDASGLAAQMTYHFVLA---MFPMLLFLLTLLPFFNIKQSQITNMLSN 128

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 129 APAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGI 188

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V  V+   +     +   ++         +  I    RI   ++ +
Sbjct: 189 VLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIII 248

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI  I ++   P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+
Sbjct: 249 FIVFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGII 308

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +      K
Sbjct: 309 ILLLWLYITSFIIIVGAEINAIIHQRSVIK 338


>gi|160891871|ref|ZP_02072874.1| hypothetical protein BACUNI_04329 [Bacteroides uniformis ATCC 8492]
 gi|156858349|gb|EDO51780.1| hypothetical protein BACUNI_04329 [Bacteroides uniformis ATCC 8492]
          Length = 446

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 47/270 (17%), Positives = 98/270 (36%), Gaps = 4/270 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +   IY  I  F ++     AS ++ S LL++ P +     +A   G    + + I   F
Sbjct: 41  IIKTIYLCINRFTKDRIVNKASALTYSTLLAIVPILAILFAIARGFGFDNLMESQIVNGF 100

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
           G   E     +      +    +     +  +   +   N +  + I+ NR ++V + RS
Sbjct: 101 GGPTETTEVILQFVNSYLSQTKSGIFIGVGLIMLLWTVLNLINNMEITFNRIWQVKKARS 160

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            Y      F  +LL  + LV+   + + +   +  +         L  +          +
Sbjct: 161 MYRKITDYFSMLLLMPILLVVSGGLSIFMSTMVKNLED----FTLLAPVGKFMVRLIPFV 216

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
             +     +++F+P  K K+   L   I    +      L+    +  S Y+ +Y   A+
Sbjct: 217 LTWFMFTALYVFMPNTKVKLKHALISGILAGTAHQAFQFLYISSQLWVSRYNAIYGSFAA 276

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           +   L++L +     + GAEL  +      
Sbjct: 277 LPMFLLWLQVSWTICLFGAELTYAGQNIRN 306


>gi|116254049|ref|YP_769887.1| transmembrane ribonuclease protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115258697|emb|CAK09802.1| putative transmembrane ribonuclease protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 307

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 152/279 (54%), Positives = 211/279 (75%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M +    ++D++YDAI H VE+DG+AMASH++LS+LL+VFPF++FG  LA FLGA QF  
Sbjct: 1   MPKVLRTIYDVVYDAICHMVEDDGFAMASHVALSSLLAVFPFLIFGTALASFLGADQFSS 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T I ++F  WPE IAKP+ D++LQVL +P  GL TIS LAAAYF+SNGVEALRISLNRAY
Sbjct: 61  TAIHLIFDTWPEAIAKPLADQVLQVLTIPRGGLLTISVLAAAYFASNGVEALRISLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R+WY TRL S GYVL+A +    +S + VA+PLAL Y RK+FP   + L I+++ 
Sbjct: 121 RVQETRAWYFTRLASLGYVLIAVIIFTAISILLVALPLALDYSRKWFPLFADTLDIVFSW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           RIY T++ L +GL+ +HL+LPA K ++  ++PGV+ T + W+ GA++F +Y+ TF+ Y+ 
Sbjct: 181 RIYGTLVVLTVGLLVMHLWLPAGKRRVFDVIPGVLLTLLLWLAGALIFAYYLATFANYTA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            YAGLAS+M  L+FLYM+GV FI+GAE+NA++I +   +
Sbjct: 241 TYAGLASVMIVLIFLYMVGVIFIIGAEINAALIKFRVFR 279


>gi|218663736|ref|ZP_03519666.1| putative ribonuclease protein [Rhizobium etli IE4771]
          Length = 307

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 150/279 (53%), Positives = 209/279 (74%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MR+    ++D++YDAI H VE+DG+AMASH++LS+LL+VFPF++FG  LA FLGA QF  
Sbjct: 1   MRKVLRTIYDVVYDAICHMVEDDGFAMASHVALSSLLAVFPFLIFGTALASFLGADQFSS 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T I ++F  WPE IAKP+ D++LQVL +   GL TIS LAAAYF+SNGVEALRISLNRAY
Sbjct: 61  TAIHLIFDTWPEAIAKPLADQVLQVLTIQRGGLLTISVLAAAYFASNGVEALRISLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R+WY TRL S GYVL+A +    +S + VA+PLAL Y R +FP   + L I+++ 
Sbjct: 121 RVQETRAWYFTRLASLGYVLIAVIIFAAISILLVAVPLALDYARNWFPLFADTLGIVFSW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           RIY T++ L +GL+ +HL+LPA K ++  ++PGV+ T + W+ GA++F +Y+ TF+ Y+ 
Sbjct: 181 RIYGTLVVLTVGLLVMHLWLPAGKRRVFDVIPGVLLTLLLWLAGALIFAYYLATFANYTA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            YAGLAS+M  L+FLYM+G  FI+GAE+NA++I +   +
Sbjct: 241 TYAGLASVMIVLIFLYMVGAIFIIGAEINAALIKFRVFR 279


>gi|283771032|ref|ZP_06343923.1| ribonuclease BN [Staphylococcus aureus subsp. aureus H19]
 gi|283459626|gb|EFC06717.1| ribonuclease BN [Staphylococcus aureus subsp. aureus H19]
          Length = 405

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 119/270 (44%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L+          L   L       + I  +   
Sbjct: 72  NFLSYLIYRIGKDDASGLAAQMTYHFVLA---MFPMLLFLLTLLPFFNIKQSQITNMLSN 128

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 129 APAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGI 188

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V  V+   +     +   ++         +  I    RI   ++ +
Sbjct: 189 VLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIII 248

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI  I ++   P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+
Sbjct: 249 FIVFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGII 308

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +      K
Sbjct: 309 ILLLWLYITSFIIIVGAEINAIIHQRSVIK 338


>gi|258422960|ref|ZP_05685859.1| ribonuclease BN [Staphylococcus aureus A9635]
 gi|257846747|gb|EEV70762.1| ribonuclease BN [Staphylococcus aureus A9635]
          Length = 405

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 119/270 (44%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L+          L   L       + I  +   
Sbjct: 72  NFLSYLIYRIGKDDASGLAAQMTYHFVLA---MFPMLLFLLTLLPFFNIKQSQITNMLSN 128

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 129 APAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGI 188

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V  V+   +     +   ++         +  I    RI   ++ +
Sbjct: 189 VLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIII 248

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI  I ++   P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+
Sbjct: 249 FIVFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGII 308

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +      K
Sbjct: 309 ILLLWLYITSFIIIVGAEINAIIHQRSVIK 338


>gi|241206535|ref|YP_002977631.1| ribonuclease BN [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860425|gb|ACS58092.1| ribonuclease BN [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 307

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 152/279 (54%), Positives = 211/279 (75%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M +    ++D++YDAI H VE+DG+AMASH++LS+LL+VFPF++FG  LA FLGA QF  
Sbjct: 1   MPKVLRTIYDVVYDAICHMVEDDGFAMASHVALSSLLAVFPFLIFGTALASFLGADQFSS 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T I ++F  WPE IAKP+ D++LQVL +P  GL TIS LAAAYF+SNGVEALRISLNRAY
Sbjct: 61  TAIHLIFDTWPEAIAKPLADQVLQVLTIPRGGLLTISVLAAAYFASNGVEALRISLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R+WY TRL S GYVL+A +    +S + VA+PLAL Y RK+FP   + L I+++ 
Sbjct: 121 RVQETRAWYFTRLASLGYVLIAVIIFTAISILLVALPLALDYSRKWFPLFADTLDIVFSW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           RIY T++ L +GL+ +HL+LPA K ++  ++PGV+ T + W+ GA++F +Y+ TF+ Y+ 
Sbjct: 181 RIYGTLVVLTVGLLVMHLWLPAGKRRVFDVIPGVLLTLLLWLAGALIFAYYLATFANYTA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            YAGLAS+M  L+FLYM+GV FI+GAE+NA++I +   +
Sbjct: 241 TYAGLASVMIVLIFLYMVGVIFIIGAEINAALIKFRVFR 279


>gi|189467044|ref|ZP_03015829.1| hypothetical protein BACINT_03427 [Bacteroides intestinalis DSM
           17393]
 gi|189435308|gb|EDV04293.1| hypothetical protein BACINT_03427 [Bacteroides intestinalis DSM
           17393]
          Length = 438

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 46/273 (16%), Positives = 101/273 (36%), Gaps = 4/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
              +   IY  I  F ++     AS ++ S LL++ P +     +A   G    + + + 
Sbjct: 31  LYNIIKTIYLCINRFTKDRLVNKASALTYSTLLAIVPILAILFAIARGFGFDNLMESQVR 90

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
           + FG   +     +      +    +     +  +   +   N + ++ I+ NR + + +
Sbjct: 91  MGFGGHNQTTEVILQFVNSYLSQTKSGIFIGVGLIMLLWTVINLISSIEITFNRIWEIKK 150

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            RS Y      F   LL  + +VI   + + +  +L Y+  F      L  I+       
Sbjct: 151 ARSMYRKITDYFSMFLLMPILIVISGGLSIFMSTSLKYIEDFVL----LAPILKFLIRLI 206

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
             +  +     +++++P  K +    L   I    +      L+    +  S Y+ +Y  
Sbjct: 207 PFVLTWFMFTGLYIYMPNTKVRFKPALISGILAGTAHQAFQFLYISGQLWVSRYNAIYGS 266

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
            A++   L++L +     + GAEL  +      
Sbjct: 267 FAALPLFLLWLQISWTICLFGAELTYAGQNIRN 299


>gi|224535450|ref|ZP_03675989.1| hypothetical protein BACCELL_00313 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224522916|gb|EEF92021.1| hypothetical protein BACCELL_00313 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 438

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 46/273 (16%), Positives = 98/273 (35%), Gaps = 4/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
              +   IY  I  F ++     AS ++ S LL++ P +     +A   G    +   + 
Sbjct: 31  LYNIIKTIYLCINRFTKDRLVNNASALTYSTLLAIVPILAILFAIARGFGFSNLMENQVR 90

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
           + FG   +     +      +    +     +  +   +   N +  + I+ NR +++ +
Sbjct: 91  MGFGGHNQTTEVILQFVDSYLSETKSGIFIGVGLIMLLWTVINLITNIEITFNRIWQIKK 150

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            RS Y      F   LL  + +VI   + + +   L Y+  F      L  I+       
Sbjct: 151 ARSMYRKITDYFSMFLLMPILIVISGGLSIFMSTTLKYIEDFVL----LAPILKFLIRLI 206

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
                +     +++++P  K K    L   +    +      L+    +  S Y+ +Y  
Sbjct: 207 PFALTWFMFTGLYIYMPNTKVKFKHALIAGVLAGTAHQAFQFLYISGQLWVSRYNAIYGS 266

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
            A++   L++L +     + GAEL  +      
Sbjct: 267 FAALPLFLLWLQISWTICLFGAELTYAGQNIRN 299


>gi|227823215|ref|YP_002827187.1| putative ribonuclease protein [Sinorhizobium fredii NGR234]
 gi|227342216|gb|ACP26434.1| putative ribonuclease protein [Sinorhizobium fredii NGR234]
          Length = 295

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 137/279 (49%), Positives = 195/279 (69%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M     I++ +++DA+ HF E+DGWAMASH++LS+L++VFPF++FG  L  FLGA QF  
Sbjct: 1   MPASLRIIWKVVFDALWHFSEDDGWAMASHVALSSLMAVFPFLIFGTALGSFLGADQFAV 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T + ++F AWPE IAKP+ DEI++VL +   G+ T+S +AAAYF+SNGVEALRI+LNRAY
Sbjct: 61  TAVHLIFDAWPESIAKPVADEIVEVLTIQRGGVLTLSVVAAAYFASNGVEALRIALNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R WYITRL S G+VL   + L ++S + VA+PLA+    ++ P L  +L  + N 
Sbjct: 121 RVAESRPWYITRLASLGFVLAGVLILAVISILLVAVPLAVRNADQWLPWLDAVLATVDNW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
            +   ++ L  GL+  HL+LP    KI+ +LPGV+ T + W +GA  F  Y+ TFS Y  
Sbjct: 181 GLALALVMLTGGLLVSHLWLPDGHRKIVDVLPGVLLTLLLWSIGAYAFASYLATFSNYVA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            YAGLASI+  LVFLYM+G  FI+GAE+NA+++ +  ++
Sbjct: 241 TYAGLASIVVVLVFLYMVGAIFIIGAEINAAILKFKVKR 279


>gi|258447867|ref|ZP_05696001.1| ribonuclease BN [Staphylococcus aureus A6224]
 gi|257858799|gb|EEV81668.1| ribonuclease BN [Staphylococcus aureus A6224]
          Length = 405

 Score =  149 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 118/270 (43%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L+          L   L       + I  +   
Sbjct: 72  NFLSYLIYRIGKDDASGLAAQMTYHFVLA---MFPMLLFLLTLLPFFNIKQSQITNMLSN 128

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 129 APAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGI 188

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V  V+   +     +   ++         +  I    RI   ++ +
Sbjct: 189 VLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIII 248

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI  I ++   P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+
Sbjct: 249 FIIFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGII 308

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA        K
Sbjct: 309 ILLLWLYITSFIIIVGAEINAIFHQRSVIK 338


>gi|33596535|ref|NP_884178.1| hypothetical protein BPP1917 [Bordetella parapertussis 12822]
 gi|33566304|emb|CAE37217.1| putative membrane protein [Bordetella parapertussis]
          Length = 437

 Score =  149 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 43/278 (15%), Positives = 102/278 (36%), Gaps = 9/278 (3%)

Query: 4   YFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI 63
           +F  +  ++  A +   E+    +AS ++ + +L++ P +    +L       Q     +
Sbjct: 23  WFTRMGRVVRFAGQRADEQKLLQVASSLTFTTVLAIVPMLAVVLSLFTAFPVFQEFRVAL 82

Query: 64  DVVF--GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           +        P  ++  I D + Q  A  A  L  I        S   +  +  + N  ++
Sbjct: 83  EDFLANSLMPPSVSDNIMDYLNQF-ARQATRLTAIGGAFLIVTSLLLIMTIDKTFNDIWQ 141

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V   R      L+ +  + L  V      +    +       R+    + ++   +    
Sbjct: 142 VTRQRPLPQRALVYWAVITLGPVVAGASLWATSFV------ARESLGLVRDVPEAVSVAI 195

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
            +  ++   +G   + + +P  +      L G   T I   +    F +Y+  F  Y+ +
Sbjct: 196 SFIPLVLTGLGFAALFVVVPNRRVYWKDALVGGFGTAIVLELMKAGFAYYLTRFPAYTVI 255

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           Y   A++   L+++Y+  +  + GA + AS  +    +
Sbjct: 256 YGAFATLPIFLLWIYLSWLAVLFGATVAASAPLIRLGR 293


>gi|209551132|ref|YP_002283049.1| ribonuclease BN [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209536888|gb|ACI56823.1| ribonuclease BN [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 307

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 151/279 (54%), Positives = 209/279 (74%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M +    ++D++YDAI H VE+DG+AMASH++LS+LL+VFPF++FG  LA FLGA QF  
Sbjct: 1   MPKALRTIYDVVYDAICHMVEDDGFAMASHVALSSLLAVFPFLIFGTALASFLGADQFSS 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T I ++F  WPE IAKP+ D++LQVL +P  GL TIS LAAAYF+SNGVEALRISLNRAY
Sbjct: 61  TAIHLIFDTWPEAIAKPLADQVLQVLTIPRGGLLTISVLAAAYFASNGVEALRISLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R WY TRL S GYVL+A +    +S + VA+PLAL Y R +FP   + L I+++ 
Sbjct: 121 RVQETRPWYFTRLASLGYVLIAVIIFAAISILLVAVPLALDYARNWFPLFADTLDIVFSW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           RIY T++ L +GL+ +HL+LPA K ++  ++PGV+ T + W+ GA++F +Y+ TF+ Y+ 
Sbjct: 181 RIYGTLVVLTVGLLVMHLWLPAGKRRVFDVIPGVLLTLLLWLAGALIFAYYLATFANYTA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            YAGLAS+M  L+FLYM+GV FI+GAE+NA++I +   +
Sbjct: 241 TYAGLASVMIVLIFLYMVGVIFIIGAEINAALIKFRVFR 279


>gi|330877283|gb|EGH11432.1| ribonuclease BN [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 313

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 63/271 (23%), Positives = 123/271 (45%), Gaps = 1/271 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            ++   +  F++++    AS ++   L S+FPF++F   L GFL    F   +       
Sbjct: 13  KVLVRTVNEFLDDEMSTYASALAYQMLFSLFPFLLFLIALIGFLHLPDFFSWLRLQSEFL 72

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P    + +   I Q+      GL +I  + A + +S GV  +  ++N AY VVE R  +
Sbjct: 73  LPPQALEQVNPVIDQLQQSK-GGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIW 131

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
               +S  Y +  +  L+  +   V  P  + ++         ++ +    R  A ++ L
Sbjct: 132 KRLPLSILYTVGIAGMLLAAAAFMVLGPQVMNWIAAQIGMEDFIVTLWTILRWPAIIILL 191

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + +  ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+
Sbjct: 192 MVAVALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAII 251

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             L++ Y+     +LGAE+NA +       K
Sbjct: 252 VLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|126729991|ref|ZP_01745803.1| ribonuclease BN, putative [Sagittula stellata E-37]
 gi|126709371|gb|EBA08425.1| ribonuclease BN, putative [Sagittula stellata E-37]
          Length = 322

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 59/278 (21%), Positives = 117/278 (42%), Gaps = 8/278 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
           F  + D+         +++   +A+ I+  ALLS+FP I     LAG      F+    D
Sbjct: 15  FKGLLDVGVRVWRVQNDDNLGLLAAGIAFYALLSLFPGITAAVALAGLFTDPSFMVETSD 74

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLNRAYR 121
            +    P    + +  ++ +V+   +  L     L    A + +S   +   I LN  Y 
Sbjct: 75  ALADVVPTAAEEIMLGQLREVVTTSSSSLGWAVLLSIGLALFSASRATQNFIIGLNVIYG 134

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             E R +   RL++    L   + LVI   +  A+P A +++         +  ++   R
Sbjct: 135 EKERRGFIKLRLLNIALTLGLIIGLVIAIAIVAAMPAAASFISNR----TWVTDLVLYLR 190

Query: 182 IYATMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                +    G+ FV    P+ + ++   + PG +     WV+G++ F+ Y+ +F TY+ 
Sbjct: 191 WPVLFIVGAFGIAFVFRVGPSRRYARWRWLTPGALLACALWVIGSIGFSRYVASFGTYNE 250

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            +  L  ++  L +L++     +LGA ++A +      
Sbjct: 251 TFGALGGVIVLLTWLWLTAYIVLLGAAVDAELEAQTRH 288


>gi|49484124|ref|YP_041348.1| hypothetical protein SAR1973 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|295428464|ref|ZP_06821091.1| hypothetical protein SIAG_02233 [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|49242253|emb|CAG40960.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|295127446|gb|EFG57085.1| hypothetical protein SIAG_02233 [Staphylococcus aureus subsp.
           aureus EMRSA16]
          Length = 405

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 119/270 (44%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L+          L   L       + I  +   
Sbjct: 72  NFLSYLIYRIGKDDASGLAAQMTYHFVLA---MFPMLLFLLTLLPFFNIKQSQITNMLSN 128

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 129 APAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYYVEDSRNGI 188

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V  V+   +     +   ++         +  I    RI   ++ +
Sbjct: 189 VLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIII 248

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI  I ++   P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+
Sbjct: 249 FIVFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGII 308

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +      K
Sbjct: 309 ILLLWLYITSFIIIVGAEINAIIHQRSVIK 338


>gi|320327458|gb|EFW83471.1| ribonuclease BN, putative [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 316

 Score =  148 bits (374), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 63/271 (23%), Positives = 123/271 (45%), Gaps = 1/271 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            ++   +  F++++    AS ++   L S+FPF++F   L GFL    F   +       
Sbjct: 13  KVLVRTVNEFLDDEMSTYASALAYQMLFSLFPFLLFLIALIGFLHLPDFFSWLRLQSEFL 72

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P    + +   I Q+      GL +I  + A + +S GV  +  ++N AY VVE R  +
Sbjct: 73  LPPQALEQVNPVIDQLQQSK-GGLLSIGIVIALWTASAGVRLMMSAMNAAYDVVEGRPIW 131

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
               +S  Y +  +  L+  +   V  P  + ++         ++ +    R  A ++ L
Sbjct: 132 KRLPLSILYTVGIAGMLLAAAAFMVLGPQVMNWIAAQIGMEDFIVTLWTILRWPAIIILL 191

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + +  ++  +P  K +   I PG +   + W+V ++ F  Y+ TF+ Y+ MY  + +I+
Sbjct: 192 MVAVALIYYVMPDVKQEFRFITPGSVLAVVVWIVASLAFGFYVKTFADYNAMYGSIGAII 251

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             L++ Y+     +LGAE+NA +       K
Sbjct: 252 VLLLYFYISAAVLLLGAEMNAVIEHMSAEGK 282


>gi|149926263|ref|ZP_01914525.1| putative ribonuclease bn transmembrane protein [Limnobacter sp.
           MED105]
 gi|149825081|gb|EDM84293.1| putative ribonuclease bn transmembrane protein [Limnobacter sp.
           MED105]
          Length = 455

 Score =  148 bits (374), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 42/274 (15%), Positives = 103/274 (37%), Gaps = 9/274 (3%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI- 63
                       +   E+    +A+ ++ + +LS+ P       +         + + + 
Sbjct: 52  LRWWIAFTRLVSQRISEQRLPQVAASLTFTTVLSLVPLATVVLAIFTAFPMFDRLQSSLQ 111

Query: 64  -DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
             ++   +PE +++ I   + Q  +  AKGL  I  +     +   +  +    N+ + V
Sbjct: 112 GYLIDSFFPETLSETILTYVTQF-SDKAKGLTAIGIVFLVITALTTMFTVDRVFNQIWNV 170

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
              RS     ++ +  + LA V + +   V        A + +    +  +L  ++    
Sbjct: 171 KRQRSTMNKVVLYWAVLSLAPVLIGLSISVST------ALIGETMAGVNPVLGGMFPALN 224

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
              +    +   F++  +P         L G +   + + +    F  YI  F +Y+ +Y
Sbjct: 225 LIPLTLTVLAFAFIYRIVPNRAVHWKDALVGGVLAAVLFEISKRAFAAYITHFPSYTALY 284

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             LA+    L+++Y+  +  +LGA   A++ +  
Sbjct: 285 GALAAFPIFLLWIYVSWIIVLLGASTVAALPVAR 318


>gi|90426068|ref|YP_534438.1| ribonuclease BN, putative [Rhodopseudomonas palustris BisB18]
 gi|90108082|gb|ABD90119.1| ribonuclease BN, putative [Rhodopseudomonas palustris BisB18]
          Length = 351

 Score =  148 bits (374), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 59/277 (21%), Positives = 119/277 (42%), Gaps = 8/277 (2%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV 62
             +     I+        ++   A+A+      LL++FP I    +          +   
Sbjct: 53  RSWAAWKTILVTLYHRTNDDRLLAVAAGTVFYGLLALFPAITALVSSYALFSDGNTINQH 112

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRA 119
           + ++ G  P      I D++ +VLA     L T    S   A + ++ G++A+  SLN  
Sbjct: 113 LSLLAGLVPAGAFSIIQDQVGRVLAKGDVKLGTAFLFSMALALWSANGGMKAIIDSLNVV 172

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           Y   E R ++    +S  + L +   ++    + VA P+ L+ V            +I  
Sbjct: 173 YGEQEKRGFFKLNAVSLAFTLGSLAAVLAAIGLVVAAPIVLSMV----GLGATADALIRY 228

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTY 238
           GR  A  + +  GL  ++ + P+  +     I PG +   +SW+ G+   ++Y+  F+ Y
Sbjct: 229 GRWPALAVLVLFGLAVLYRYGPSLTAPQWRWISPGSVAAALSWLAGSAALSYYLANFANY 288

Query: 239 STMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
              Y  L + +  +V+++M  +  +LGA+LN+++   
Sbjct: 289 DATYGSLGAAIGLMVWMWMTTIVVLLGAQLNSAIDQQ 325


>gi|167570181|ref|ZP_02363055.1| YihY family protein [Burkholderia oklahomensis C6786]
          Length = 437

 Score =  148 bits (374), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 35/273 (12%), Positives = 93/273 (34%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A +   E+    +A  ++ + +L++ P +     L         F  ++ 
Sbjct: 8   LDTIKRLARFAAKRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQNSLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     +   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNSQIFKYLNQFAAKAKGLTTAGLIVLVVTAVMTMMTVESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +                   ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSISSYLFTKSLAFAGSTSTPPIFEWLLTAASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP           G +   +++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAAVGGVCAAVAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     + GA + +++    
Sbjct: 244 AFATVPMFLLWMYLSWFVTLAGAMIASALPAIR 276


>gi|302333548|gb|ADL23741.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           JKD6159]
          Length = 405

 Score =  148 bits (373), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 119/270 (44%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L+          L   L       + I  +   
Sbjct: 72  NFLSYLIYRIGKDDASGLAAQMTYHFVLA---MFPMLLFLLTLLPFFNIKQSQITNMLSN 128

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 129 APAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGI 188

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V  V+   +     +   ++         +  I    RI   ++ +
Sbjct: 189 VLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIII 248

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI  I ++   P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+
Sbjct: 249 FIVFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGII 308

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +      K
Sbjct: 309 ILLLWLYITSFIIIVGAEINAIIHQRSVIK 338


>gi|23097645|ref|NP_691111.1| hypothetical protein OB0190 [Oceanobacillus iheyensis HTE831]
 gi|22775868|dbj|BAC12146.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831]
          Length = 282

 Score =  148 bits (373), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 62/256 (24%), Positives = 115/256 (44%), Gaps = 2/256 (0%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVI 74
            I  F  +D   +A+ ++   LLSVFP +V    +  +          I  +    PE +
Sbjct: 10  FITKFKNDDVPLLAASLAYYFLLSVFPLLVVAFAIIPYFNISP--QDAIQFISSILPEQL 67

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
           A    + I+ ++  P  GL TI  L   + +SNG+ A     N +Y V E RS+  TR I
Sbjct: 68  ASTFQENIVSIVETPRGGLLTIGILGTLWSASNGINAFIKVSNESYEVEETRSFIKTRAI 127

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLI 194
           +FG  +     ++    + V   + L           +   I+   R   ++  + + L+
Sbjct: 128 AFGLTIAMIFAVITAIILPVFGDVILTMAMSIVGINESTEWILQISRFAISIAVITLLLL 187

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++ F P AK  +  I+PG +   I W++ +  F+ Y+  F  YS MY  L  ++  +++
Sbjct: 188 TLYRFAPNAKLPVKHIIPGTLTASILWLIISFGFSIYVSNFGNYSNMYGSLGGVIILMIW 247

Query: 255 LYMLGVFFILGAELNA 270
            ++ G+  ++G  +N 
Sbjct: 248 FFLTGMILLIGGIINV 263


>gi|33592226|ref|NP_879870.1| hypothetical protein BP1088 [Bordetella pertussis Tohama I]
 gi|33601088|ref|NP_888648.1| hypothetical protein BB2105 [Bordetella bronchiseptica RB50]
 gi|33571871|emb|CAE41386.1| putative membrane protein [Bordetella pertussis Tohama I]
 gi|33575523|emb|CAE32601.1| putative membrane protein [Bordetella bronchiseptica RB50]
 gi|332381643|gb|AEE66490.1| hypothetical protein BPTD_1080 [Bordetella pertussis CS]
          Length = 437

 Score =  148 bits (373), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 43/278 (15%), Positives = 102/278 (36%), Gaps = 9/278 (3%)

Query: 4   YFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI 63
           +F  +  ++  A +   E+    +AS ++ + +L++ P +    +L       Q     +
Sbjct: 23  WFTRMGRVVRFAGQRADEQKLLQVASSLTFTTVLAIVPMLAVVLSLFTAFPVFQEFRVAL 82

Query: 64  DVVF--GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           +        P  ++  I D + Q  A  A  L  I        S   +  +  + N  ++
Sbjct: 83  EDFLANSLMPPSVSDNIMDYLNQF-ARQATRLTAIGGAFLIVTSLLLIMTIDKTFNDIWQ 141

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V   R      L+ +  + L  V      +    +       R+    + ++   +    
Sbjct: 142 VTRQRPLPQRALVYWAVITLGPVVAGASLWATSFV------ARESLGLVRDVPEAVSVAI 195

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
            +  ++   +G   + + +P  +      L G   T I   +    F +Y+  F  Y+ +
Sbjct: 196 SFIPLVLTGLGFAALFVVVPNRRVYWKDALVGGFGTAIVLELMKAGFAYYLTRFPAYTVI 255

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           Y   A++   L+++Y+  +  + GA + AS  +    +
Sbjct: 256 YGAFATLPIFLLWIYLSWLAVLFGATVAASAPLIRLGR 293


>gi|146308010|ref|YP_001188475.1| tRNA-processing RNAse BN [Pseudomonas mendocina ymp]
 gi|166918691|sp|A4XWM7|Y2988_PSEMY RecName: Full=UPF0761 membrane protein Pmen_2988
 gi|145576211|gb|ABP85743.1| tRNA-processing RNAse BN [Pseudomonas mendocina ymp]
          Length = 405

 Score =  148 bits (373), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 48/283 (16%), Positives = 106/283 (37%), Gaps = 9/283 (3%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV- 59
           M               + F+E  G   A+ ++ + L +V P +     +   + A Q V 
Sbjct: 1   MHRRLKDWLGFWLSLYQRFIENRGAGNAAALTYTTLFAVVPMMTVTFAMLSAIPAFQGVG 60

Query: 60  PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +   +F  +     + + + + +  A   + L        A  +   +  +  + N  
Sbjct: 61  EEIQGFIFNNFVPSTGETVQEYLREFTAQARQ-LTWFGVGLLAVTAFLMLVTIEKTFNVI 119

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +RV + R    + L+ +  + L  + L     V   I            +  + ++    
Sbjct: 120 WRVRQPRRGMSSFLLYWAILSLGPLLLGAGFAVSTYIASLS------LISGPDAVVGAKT 173

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
              +  +L+       ++  +P  +  +   L G +F+ I + +   LF  Y+  F  Y 
Sbjct: 174 LLAFTPLLSSIAAFTLLYAAVPNTRVPLRHALLGGLFSAILFEIAKALFGLYVRLFPGYH 233

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMII-YYWRKKP 281
            +Y   A++   LV++Y+  +  +LGAEL   +     WR++P
Sbjct: 234 LIYGAFATVPLFLVWIYLSWLIVLLGAELVYGLSQPRRWRRQP 276


>gi|284024929|ref|ZP_06379327.1| hypothetical protein Saura13_10091 [Staphylococcus aureus subsp.
           aureus 132]
          Length = 405

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 119/270 (44%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L+          L   L       + I  +   
Sbjct: 72  NFLSYLIYRIGKDDASGLAAQMTYHFVLA---MFPMLLFLLTLLPFFNIKQSQITNMLSN 128

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 129 APAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGI 188

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V  V+   +     +   ++         +  I    RI   ++ +
Sbjct: 189 VLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIII 248

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI  I ++   P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+
Sbjct: 249 FIIFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISIFGNYSKTYGSIAGII 308

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +      K
Sbjct: 309 ILLLWLYITSFIIIVGAEINAIIHQRSVIK 338


>gi|295690772|ref|YP_003594465.1| ribonuclease BN [Caulobacter segnis ATCC 21756]
 gi|295432675|gb|ADG11847.1| ribonuclease BN [Caulobacter segnis ATCC 21756]
          Length = 403

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 56/275 (20%), Positives = 114/275 (41%), Gaps = 9/275 (3%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
                DI++        +   A+A  ++   LL++ P I    +L G     + V   + 
Sbjct: 79  LLGWRDIVWRTWREITVDRLPAVAGGVTFYTLLALIPAIGAFVSLYGLFADVRTVEQQLR 138

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYR 121
            + G +P  + + + +++L++ +     L      S L + + ++  +  L   LN AY 
Sbjct: 139 DMAGVFPPSVVQIVGEQMLRLASQGEAKLGLAFAFSLLLSVWSANASMRTLFDGLNIAYD 198

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             E R      L+S+ +   A V  V +S V +  PL L   R     L  L       R
Sbjct: 199 EEEKRHIVRRTLLSYAFTFCALVYAVAVSAVLIVTPLLLKAAR-----LSALDSYWAPIR 253

Query: 182 IYATMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
               M    +    ++ F P+  +++   +  G       W++G++ F+ Y+   + +  
Sbjct: 254 WLMVMAMTAVAFAVLYRFAPSRAQARWRWVWIGAATASGGWLIGSLGFSTYVNRVAHFDA 313

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            Y  L +I+  +V+++   +  ++GAELNA +   
Sbjct: 314 AYGPLGAIIAFMVWVWFSIMAILVGAELNAEIEHQ 348


>gi|319901760|ref|YP_004161488.1| tRNA-processing RNAse BN [Bacteroides helcogenes P 36-108]
 gi|319416791|gb|ADV43902.1| tRNA-processing RNAse BN [Bacteroides helcogenes P 36-108]
          Length = 439

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 47/270 (17%), Positives = 96/270 (35%), Gaps = 4/270 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +   IY  I  F ++     AS ++ S LL++ P +     +A   G    +   I   F
Sbjct: 34  IIKTIYLCINRFTKDRIVNKASALTYSTLLAIVPILAILFAIARGFGFDNLMENQIISGF 93

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
           G   E     +      +    +     +  +   +   N +  + I+ NR ++V + RS
Sbjct: 94  GGPTETTEMMLRFVDSYLSQTKSGVFIGVGLVMLLWSVLNLINNMEITFNRIWQVKKARS 153

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            Y      F  +LL  + +V+   + + +   +  +         L  +          +
Sbjct: 154 MYRKITDYFSMLLLMPILIVVSGGLSIFMSTMVKNIED----FTLLAPLGKFMIRLIPFV 209

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
             +     +++F+P  K K    L   I    +      L+    V  S Y+ +Y   A+
Sbjct: 210 LTWCMFTALYVFMPNTKVKFSHALISGILAGTAHQAFQFLYISGQVWVSRYNAIYGSFAA 269

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           +   L++L +     + GAEL  +      
Sbjct: 270 LPLFLLWLQISWTICLFGAELTYAGQNIRN 299


>gi|218674258|ref|ZP_03523927.1| putative ribonuclease protein [Rhizobium etli GR56]
          Length = 314

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 148/276 (53%), Positives = 205/276 (74%)

Query: 4   YFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI 63
               ++D++YDAI H VE+DG+AMASH++LS+LL+VFPF++FG  LA FLGA QF  T I
Sbjct: 11  VLRTIYDVVYDAICHMVEDDGFAMASHVALSSLLAVFPFLIFGTALASFLGADQFSSTAI 70

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
            ++F  WPE IAKP+ D++LQVL +   GL TIS LAAAYF+SNGVEALRISLNRAYRV 
Sbjct: 71  HLIFDTWPEAIAKPLADQVLQVLTIQRGGLLTISVLAAAYFASNGVEALRISLNRAYRVQ 130

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R WY TRL S GYVL+A +    +S + VA+PLAL Y R +FP   + L I+++ RIY
Sbjct: 131 ETRPWYFTRLASLGYVLIAVIIFAAISILLVAVPLALDYARNWFPLFADTLDIVFSWRIY 190

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T++ L +GL+ +HL+LPA K ++  ++PGV+ T + W+ GA++F +Y+ TF+ Y+  YA
Sbjct: 191 GTLVVLTVGLLVMHLWLPAGKRRVFDVIPGVLLTLLLWLAGALIFAYYLATFANYTATYA 250

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           GLAS+M  L+FLYM+G  FI+GAE+NA++I +   +
Sbjct: 251 GLASVMIVLIFLYMVGAIFIIGAEINAALIKFRVFR 286


>gi|221214918|ref|ZP_03587886.1| ribonuclease BN [Burkholderia multivorans CGD1]
 gi|221165145|gb|EED97623.1| ribonuclease BN [Burkholderia multivorans CGD1]
          Length = 442

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 38/273 (13%), Positives = 97/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVI 63
              +  +   A     E+    +A  ++ + +L++ P +     L            ++ 
Sbjct: 8   LDTIKRLAQFAARRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQISLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     S   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNIQIFKYLNQFAAKAKGLTTAGLIVLVVTSVMTMMTIESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +           P+   +  ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSLSSYLFTQSLAFTGAAPSTSIVEWLLTLASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +F  +++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVIGGLFAAVAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     +LGA + +++    
Sbjct: 244 AFAALPVFLLWMYLSWFIALLGAMVTSALPAIR 276


>gi|221197719|ref|ZP_03570765.1| ribonuclease BN [Burkholderia multivorans CGD2M]
 gi|221204723|ref|ZP_03577740.1| ribonuclease BN [Burkholderia multivorans CGD2]
 gi|221175580|gb|EEE08010.1| ribonuclease BN [Burkholderia multivorans CGD2]
 gi|221181651|gb|EEE14052.1| ribonuclease BN [Burkholderia multivorans CGD2M]
          Length = 442

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 38/273 (13%), Positives = 97/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVI 63
              +  +   A     E+    +A  ++ + +L++ P +     L            ++ 
Sbjct: 8   LDTIKRLAQFAARRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQISLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     S   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNIQIFKYLNQFAAKAKGLTTAGLIVLVVTSVMTMMTIESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +           P+   +  ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSLSSYLFTQSLAFTGAAPSTSIVEWLLTLASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +F  +++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVIGGLFAAVAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     +LGA + +++    
Sbjct: 244 AFAALPVFLLWMYLSWFIALLGAMVTSALPAIR 276


>gi|170755009|ref|YP_001783041.1| YihY family protein [Clostridium botulinum B1 str. Okra]
 gi|169120221|gb|ACA44057.1| YihY family protein [Clostridium botulinum B1 str. Okra]
          Length = 285

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 62/264 (23%), Positives = 125/264 (47%), Gaps = 2/264 (0%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVI 74
               F+E++  A++S ++ + ++SVFPF++F   L G+L  H     ++  +    P   
Sbjct: 16  LANRFLEDEVLALSSQLAYALIISVFPFLMFVITLIGYLPIHS--EDLLLGLKEIMPSNT 73

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
              + + I +++      L + S +   + +S G  A+   LNRAY V E RS+   +++
Sbjct: 74  YLLLKNTIEEIIYTQNGNLLSFSIIFTIWTASAGFRAVVRGLNRAYDVKERRSFIKVQIM 133

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLI 194
           +    L  +  LV+  F+ V        +            I    R    +      L 
Sbjct: 134 TIFCTLGMAFVLVMSIFLLVFGKTIGRTLVYKLGFSLEFNRIWNLIRYIIMIGVTIFILA 193

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++ + P+ + + M +LPG IF  I+W++ ++ F+ Y+  F+ YS +Y  + +++  LV+
Sbjct: 194 ALYYYTPSKRLRWMDVLPGAIFATIAWIIASMGFSFYVDNFNNYSRLYGSIGAVIVFLVW 253

Query: 255 LYMLGVFFILGAELNASMIIYYWR 278
           LY+  +  I G E+NA ++    +
Sbjct: 254 LYLTSIIVITGGEINALLVSSREK 277


>gi|322436851|ref|YP_004219063.1| ribonuclease BN [Acidobacterium sp. MP5ACTX9]
 gi|321164578|gb|ADW70283.1| ribonuclease BN [Acidobacterium sp. MP5ACTX9]
          Length = 386

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 48/271 (17%), Positives = 107/271 (39%), Gaps = 5/271 (1%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVIDVVF 67
             I       F E++  + A+ +    L ++FP ++  + + G +  +  +   +++ + 
Sbjct: 87  LAIAKRTFHSFNEDNLLSRAAELGYYFLFALFPTLITASAILGLVVRNSTLYLKLLNYLA 146

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P    K + +   Q     +         A  + +S G  A++ +LN  Y+V E R 
Sbjct: 147 LVVPADAFKLVLETFTQTTTHSSGSKLIFGLAAGLWSASVGFSAIQDTLNIVYKVKETRP 206

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL---LIIWNGRIYA 184
           ++  +  +    +L S+ ++++            ++          L   +I+       
Sbjct: 207 YWKVKGAAILVTVLLSIIVILILGSMFTGSFVAHWLYTHIAQHQLALAVNVIVRFIAWSC 266

Query: 185 TMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
             L   +    ++ F P  K        PG       WV+ +V+   Y+  F++YS  Y 
Sbjct: 267 AALLCVLLFAVIYYFAPDVKNKHWRWFTPGAAVGIGGWVLASVILRVYLHYFNSYSVTYG 326

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMII 274
            L +++  L + YM G+  + GAE+N+ +  
Sbjct: 327 SLGAVIILLTWFYMTGLMLLTGAEMNSEIEA 357


>gi|222053928|ref|YP_002536290.1| ribonuclease BN [Geobacter sp. FRC-32]
 gi|221563217|gb|ACM19189.1| ribonuclease BN [Geobacter sp. FRC-32]
          Length = 440

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 41/271 (15%), Positives = 98/271 (36%), Gaps = 5/271 (1%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           ++ Y+     I+   I++F +++    AS +S + +LS+ PF      +         V 
Sbjct: 26  IKRYWVKYLQIMALVIKNFWDDNCLLRASALSFTTILSIVPFFALTFAVLKGFDVQNKVE 85

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
                +         + +   +  +       + TI        +   +  +  + N  +
Sbjct: 86  ---PYILEQVTAGSEELVDKIVTYINNTNMTSMGTIGLATLVVTAITLLGNIEEAFNVIW 142

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
            V   RS           +L   + ++    V   +      V ++      L  ++   
Sbjct: 143 GVKGTRSLQRKFSDYLSVLLSGPLLMLAAISVTTTLQS--QSVVRWLLQTSYLGDVLLFS 200

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                 +++++ L F+++ +P  + K  S L G +     W      + ++ V    Y+ 
Sbjct: 201 FRLIPYISVWLALFFLYILIPNTRVKAKSALIGGVLAGTVWQAAQWGYLYFQVGVGKYNA 260

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNAS 271
           +Y  LA +   +V++Y   V  + G E+ A+
Sbjct: 261 IYGTLALLPIFMVWIYTSWVIVLFGVEVVAA 291


>gi|161524966|ref|YP_001579978.1| ribonuclease BN [Burkholderia multivorans ATCC 17616]
 gi|189350287|ref|YP_001945915.1| BN-like family ribonuclease [Burkholderia multivorans ATCC 17616]
 gi|160342395|gb|ABX15481.1| ribonuclease BN [Burkholderia multivorans ATCC 17616]
 gi|189334309|dbj|BAG43379.1| BN-like family ribonuclease [Burkholderia multivorans ATCC 17616]
          Length = 442

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 38/273 (13%), Positives = 97/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVI 63
              +  +   A     E+    +A  ++ + +L++ P +     L            ++ 
Sbjct: 8   LDTIKRLAQFAARRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQISLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     S   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNIQIFKYLNQFAAKAKGLTTAGLIVLVVTSVMTMMTIESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +           P+   +  ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSLSSYLFTQSLAFTGAAPSTSIVEWLLTLASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +F  +++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVIGGLFAAVAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     +LGA + +++    
Sbjct: 244 AFAALPVFLLWMYLSWFIALLGAMVTSALPAIR 276


>gi|118589631|ref|ZP_01547036.1| ribonuclease BN, putative [Stappia aggregata IAM 12614]
 gi|118437717|gb|EAV44353.1| ribonuclease BN, putative [Stappia aggregata IAM 12614]
          Length = 317

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 65/275 (23%), Positives = 118/275 (42%), Gaps = 8/275 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
             DI          +    +A+ ++   LL++FP I     L+G +     V   ++++ 
Sbjct: 18  WLDIGVRVWNAVQRDHIDLIAAGVAFYGLLAIFPTITALTALSGLIVEPVEVSRQLELIE 77

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGL---FTISALAAAYFSSNGVEALRISLNRAYRVVE 124
              P   ++ I  +   V      GL     I    A Y +S G+ ++   LN AY  VE
Sbjct: 78  SVLPHEASQIILAQAADVAGSENAGLSFALIIGLGIAIYSTSRGMASIMEGLNIAYDEVE 137

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            RS+   ++ +    LL  +  V+     + +P+  +Y+         L  I+ + R   
Sbjct: 138 KRSFIALKVRTLAMALLLVLAFVLGLVSALLLPVIFSYLA----LPEWLERILSSARWII 193

Query: 185 TMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
             L    GL FV+ F P+   +K   I PG +   + W+  +  F+ Y+  F++Y+  + 
Sbjct: 194 LGLLTVTGLSFVYRFGPSRTDAKWKWITPGAVVACLLWLAASYGFSVYVSNFASYNKTFG 253

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            LA ++  L++L++     +LGAELN  M     R
Sbjct: 254 SLAGVIILLMWLWISAYIVLLGAELNGEMEAQTRR 288


>gi|77361434|ref|YP_341009.1| ribonuclease protein [Pseudoalteromonas haloplanktis TAC125]
 gi|76876345|emb|CAI87567.1| putative ribonuclease protein [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 319

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 58/271 (21%), Positives = 117/271 (43%), Gaps = 8/271 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
               +DI          ++   +A+ ++  ALL++FP +    ++  +  +   +   + 
Sbjct: 18  LLGWWDITKRIFTQMSRDNLSLVAAGVAFYALLAIFPALAALVSIYAYFASPTDIGAHLS 77

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYR 121
            V    PE   + I  +I  +    +  L      + +   + SS G +AL  + N +Y+
Sbjct: 78  QVIELLPESTGELILSQIASIAQSSSTSLSLSAIGTLILTIWSSSKGSQALITACNISYQ 137

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             E RS++  +L+ F + + A V  +    +   +P+ L  V        N+ L+I    
Sbjct: 138 EYEKRSFFKAQLVRFLFSIGAIVVAIFALLIIGILPVVLNLV----GLKENIDLLITFIS 193

Query: 182 IYATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                      L+ ++ + P  K  K   I  G +   I W+V ++ F+ Y+  F++Y+ 
Sbjct: 194 WPLLAFTFNFALVLLYRYAPHRKPAKWRWITLGSVIATILWIVASIGFSFYVSKFASYNE 253

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNAS 271
            Y  L  ++  L++LY+     ILGA +NA+
Sbjct: 254 TYGSLGGVVIMLMWLYISAYIVILGATINAA 284


>gi|115351390|ref|YP_773229.1| putative ribonuclease BN [Burkholderia ambifaria AMMD]
 gi|115281378|gb|ABI86895.1| tRNA-processing RNAse BN [Burkholderia ambifaria AMMD]
          Length = 443

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 39/273 (14%), Positives = 97/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVI 63
              +  +   A     E+    +A  ++ + +L++ P +     L            ++ 
Sbjct: 8   LDTIKRLAQFAARRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFSSFQISLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     S   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNVQIFKYLNQFAAKAKGLTTAGLIVLVVTSVMTMMTIESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +           P+   +  ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSISSYLFTQSLAFTGAAPSTSIVEWLLALVSLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +F  I++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVIGGLFAAIAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     +LGA + +++    
Sbjct: 244 AFAALPVFLLWVYLSWFIALLGAMVASALPAIR 276


>gi|163759906|ref|ZP_02166990.1| putative ribonuclease rnase bn (rbn) transmembrane protein [Hoeflea
           phototrophica DFL-43]
 gi|162282864|gb|EDQ33151.1| putative ribonuclease rnase bn (rbn) transmembrane protein [Hoeflea
           phototrophica DFL-43]
          Length = 317

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 133/271 (49%), Positives = 192/271 (70%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            +I+DA+ HF ++DGWAMASH++LS L+++FPF++FG  LA FLGA+ +  T   ++F  
Sbjct: 40  SVIWDAVTHFNDDDGWAMASHVALSILMALFPFMIFGTALASFLGANAYAETASHLIFDT 99

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           WPE IA PI++E+++VL V   GL T+S LAAA+FS+NGVEALR+SLNRAYRV E R+WY
Sbjct: 100 WPESIAAPISNEVVKVLTVERGGLLTLSVLAAAFFSANGVEALRVSLNRAYRVTETRAWY 159

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           +TR+ S  +V++A + ++ +SF+ V  PLAL   R+F P +  L+  + N RI      L
Sbjct: 160 VTRIQSLLFVVVAVLVIMAISFLLVLAPLALKLARQFVPWMETLISAVDNWRILIAAAVL 219

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            IGLI  HL+LP  + K+  +LPG+  T ++W+ GA++F  Y+  F+TY + YAGLASIM
Sbjct: 220 VIGLIVSHLWLPDGRRKLFDVLPGIGVTLVAWMAGALMFASYLKEFATYVSTYAGLASIM 279

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             LVFLY++   FILGAE+NA+++    R K
Sbjct: 280 IALVFLYIVAAIFILGAEINAALLKAAERAK 310


>gi|114705037|ref|ZP_01437945.1| Ribonuclease BN family protein [Fulvimarina pelagi HTCC2506]
 gi|114539822|gb|EAU42942.1| Ribonuclease BN family protein [Fulvimarina pelagi HTCC2506]
          Length = 321

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 60/270 (22%), Positives = 120/270 (44%), Gaps = 8/270 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D++    + F E     +A+ I+   LL++FP I     + G +   Q +   +  + G 
Sbjct: 25  DVLMRVKDRFDEHSVTLVAAGITFYILLALFPAITALVAIYGLVADPQTIQAQLSNLEGI 84

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P      I  ++ ++ +     L     +S L + Y S+ GV+AL  ++N AY+  + R
Sbjct: 85  VPAGALGIIHSQLERLTSQTESSLSIAFAVSILLSIYSSTKGVKALFKAMNIAYQEKDER 144

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            +    LIS  +V+ + V +++     V IP  L+ +    P    + +++         
Sbjct: 145 GFIKQNLISMAFVVASIVLVILAIVTLVVIPSVLSLL----PLPAGVTILVLVVPPLVLA 200

Query: 187 LALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           L     +  +  F P  +S     + PG + T + WV+ ++ F+ Y      +   Y  +
Sbjct: 201 LLAMAWIAGLFRFGPHRRSPTFKWLTPGAVLTILGWVIASIAFSFYASNVKNFDATYGSM 260

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           ASI+  L++ +++ +  + GAELNA +   
Sbjct: 261 ASIIVFLMWTWIMMIILLAGAELNAQLEHQ 290


>gi|90414677|ref|ZP_01222648.1| ribonuclease BN [Photobacterium profundum 3TCK]
 gi|90324219|gb|EAS40794.1| ribonuclease BN [Photobacterium profundum 3TCK]
          Length = 321

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 45/274 (16%), Positives = 93/274 (33%), Gaps = 8/274 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
               F  +         +     A  ++   LLS+ P I    +          +  ++ 
Sbjct: 18  LKQTFAYLTYLNRRVKHDRLTIAAGSMAYVTLLSLVPMITVVLSALSAFPVFAGLGELLQ 77

Query: 65  -VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             V   +     + +   + + +A  A  +  +   A    +   + ++  +LN  +RV 
Sbjct: 78  NFVIENFVPAAGEVVKTYLNEFVAN-AGKMTAVGVGALFVVAMMLMSSIDQALNYIWRVH 136

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R   I+  I +  + L  + +     V   +                +  +       
Sbjct: 137 EKRRPVISFSIYWMVLTLGPILVGSSIAVSSYLGSL------NLLNSEAVNGLFQQTLRA 190

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
             ++      + ++L +P  K K    L G +   I + +    F  YI  F +Y  +Y 
Sbjct: 191 LPVIMSSCAFLGLYLLVPNLKVKFSHALFGALVASILFELSKKGFALYISNFPSYQVIYG 250

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
            LA I    V++Y+     +LGAE+ AS+     
Sbjct: 251 ALAVIPILFVWVYLCWCIVLLGAEITASLGERKQ 284


>gi|323489179|ref|ZP_08094411.1| putative ribonuclease BN [Planococcus donghaensis MPA1U2]
 gi|323397066|gb|EGA89880.1| putative ribonuclease BN [Planococcus donghaensis MPA1U2]
          Length = 298

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 52/270 (19%), Positives = 114/270 (42%), Gaps = 2/270 (0%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
            + +    F +++   +A+  +   LL++    +    L+            I+ +    
Sbjct: 7   FVKELGNEFKKDNATTLAAAQAYYYLLAI--VPLLILLLSILPYLQIDPDEAIEFIRSIL 64

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P  +A    D I+ V+  P+ GL T   L   + +SN + A   + N+AY + E RS++ 
Sbjct: 65  PGEVANTFQDTIVSVVTTPSGGLLTFGILGTLWSASNALTAFINATNQAYGIKETRSFFK 124

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            + I+ G  +   V ++I   + +     +  ++          +I    R   ++  + 
Sbjct: 125 LKAIAIGLTIGMLVAVIIALVLPIFGGTIIEIIKSTLNLPEQTEIIFQVLRWVISVAVMS 184

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           + L  ++   P        +L G +   + W V +  F+ Y+  F +YS  Y  L  ++ 
Sbjct: 185 LVLALMYKLAPNKSFPFKEVLIGAVIATVLWQVVSFGFSIYVSNFGSYSATYGSLGGLIV 244

Query: 251 CLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            +++ ++ G+  ++GAE+NA +      KK
Sbjct: 245 LMLWFFLTGLILVIGAEINAIIDRRRTAKK 274


>gi|270296464|ref|ZP_06202664.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270273868|gb|EFA19730.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 439

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 47/270 (17%), Positives = 98/270 (36%), Gaps = 4/270 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +   IY  I  F ++     AS ++ S LL++ P +     +A   G    + + I   F
Sbjct: 34  IIKTIYLCINRFTKDRIVNKASALTYSTLLAIVPILAILFAIARGFGFDNLMESQIVNGF 93

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
           G   E     +      +    +     +  +   +   N +  + I+ NR ++V + RS
Sbjct: 94  GGPTETTEVILQFVNSYLSQTKSGIFIGVGLIMLLWTVLNLINNMEITFNRIWQVKKARS 153

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            Y      F  +LL  + LV+   + + +   +  +         L  +          +
Sbjct: 154 MYRKITDYFSMLLLMPILLVVSGGLSIFMSTMVKNLED----FTLLAPVGKFMVRLIPFV 209

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
             +     +++F+P  K K+   L   I    +      L+    +  S Y+ +Y   A+
Sbjct: 210 LTWFMFTALYVFMPNTKVKLKHALISGILAGTAHQAFQFLYISSQLWVSRYNAIYGSFAA 269

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           +   L++L +     + GAEL  +      
Sbjct: 270 LPMFLLWLQVSWTICLFGAELTYAGQNIRN 299


>gi|317480349|ref|ZP_07939450.1| YihY family protein [Bacteroides sp. 4_1_36]
 gi|316903524|gb|EFV25377.1| YihY family protein [Bacteroides sp. 4_1_36]
          Length = 439

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 47/270 (17%), Positives = 98/270 (36%), Gaps = 4/270 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +   IY  I  F ++     AS ++ S LL++ P +     +A   G    + + I   F
Sbjct: 34  IIKTIYLCINRFTKDRIVNKASALTYSTLLAIVPILAILFAIARGFGFDNLMESQIVNGF 93

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
           G   E     +      +    +     +  +   +   N +  + I+ NR ++V + RS
Sbjct: 94  GGPTETTEVILQFVNSYLSQTKSGIFIGVGLIMLLWTVLNLINNMEITFNRIWQVKKARS 153

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            Y      F  +LL  + LV+   + + +   +  +         L  +          +
Sbjct: 154 MYRKITDYFSMLLLMPILLVVSGGLSIFMSTMVKNLED----FTLLAPVGKFMVRLIPFV 209

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
             +     +++F+P  K K+   L   I    +      L+    +  S Y+ +Y   A+
Sbjct: 210 LTWFMFTALYVFMPNTKVKLKHALISGILAGTAHQAFQFLYISSQLWVSRYNAIYGSFAA 269

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           +   L++L +     + GAEL  +      
Sbjct: 270 LPMFLLWLQVSWTICLFGAELTYAGQNIRN 299


>gi|304411738|ref|ZP_07393350.1| ribonuclease BN [Shewanella baltica OS183]
 gi|307306210|ref|ZP_07585955.1| ribonuclease BN [Shewanella baltica BA175]
 gi|304349926|gb|EFM14332.1| ribonuclease BN [Shewanella baltica OS183]
 gi|306911083|gb|EFN41510.1| ribonuclease BN [Shewanella baltica BA175]
          Length = 326

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 51/276 (18%), Positives = 106/276 (38%), Gaps = 8/276 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +R  F  ++  +       VE+     A H++   LLS+ P +    ++       + + 
Sbjct: 10  IRVLFLGIWHFLLHLRRRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFKGIR 69

Query: 61  -TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +   V+  +       +   I + +   +KG   +   A    +   + A+  SLN  
Sbjct: 70  GQIEGFVYENFLPAAGDTVQVYINEFVGNASKG-TAVGIAALVVVAIMLISAIDKSLNNI 128

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +R  E RS  +   + +  + L  V +         +     +  +    +  + +    
Sbjct: 129 WRTKEKRSVVVAFSMYWMVLTLGPVLVGASLVASSYVISLKVFEAEAISGMLPIFIAR-- 186

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                 ML      + +++ +P  K K +  L G I   + + +G   F  Y+  F +Y 
Sbjct: 187 ----LPMLFSVAAFLLLYMVVPNQKVKFLHALLGAIVAALLFELGKKAFALYVTQFPSYE 242

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            +Y  LA I    V++Y+  +  +LGAE+ A+M  Y
Sbjct: 243 AIYGALAVIPIIFVWVYLSWMIVLLGAEITAAMPEY 278


>gi|52079254|ref|YP_078045.1| RNase YfkH [Bacillus licheniformis ATCC 14580]
 gi|52784619|ref|YP_090448.1| YfkH [Bacillus licheniformis ATCC 14580]
 gi|319646964|ref|ZP_08001192.1| YfkH protein [Bacillus sp. BT1B_CT2]
 gi|52002465|gb|AAU22407.1| Possible RNase YfkH [Bacillus licheniformis ATCC 14580]
 gi|52347121|gb|AAU39755.1| YfkH [Bacillus licheniformis ATCC 14580]
 gi|317391023|gb|EFV71822.1| YfkH protein [Bacillus sp. BT1B_CT2]
          Length = 271

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 66/267 (24%), Positives = 119/267 (44%), Gaps = 6/267 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
             + +    F   +G + ++ ++   LLS+FPF++F   L G+L        VI ++   
Sbjct: 2   SFLKELGWRFFLHEGPSKSAELAYFFLLSLFPFMIFLLTLIGYLPVK--TGDVIGLIEQY 59

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            PE     I + +        +GL +   +AA + +SNG+ A+  + N AY V E RS+ 
Sbjct: 60  APEDTMSVIEETL----NTGNRGLLSFGIIAALWSASNGLNAIVRAFNHAYEVEENRSFI 115

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + RL S         T+++   + V       ++          L      R   + L L
Sbjct: 116 MVRLTSLLLTAAMVFTILVALLLPVFGRAIGHFIANLDGTPEMFLTAWSALRWGISPLVL 175

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            I    ++ F P  +     +LPG +     W++ +VLF++Y+  F+ YS  Y  L  I+
Sbjct: 176 LIVFTALYFFAPNKRLSFKFVLPGAVAATAGWILVSVLFSYYVSEFANYSATYGSLGGII 235

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYY 276
             +++ Y+ G+  ILG E+NA +    
Sbjct: 236 VLMIWFYLSGMMIILGGEINALLHKRK 262


>gi|163857354|ref|YP_001631652.1| ribonuclease [Bordetella petrii DSM 12804]
 gi|288559234|sp|A9IT56|Y3042_BORPD RecName: Full=UPF0761 membrane protein Bpet3042
 gi|163261082|emb|CAP43384.1| Ribonuclease [Bordetella petrii]
          Length = 452

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 46/272 (16%), Positives = 97/272 (35%), Gaps = 9/272 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF-- 67
            +   A +   EE    +AS ++ + +L + P +    +L       Q     ++     
Sbjct: 30  RVFRFAAQRADEEKLLQVASSLTFTTVLGIVPMLAVVLSLFTAFPVFQDFRLALEDFLAN 89

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P  ++  I D + Q  A  A  L  I        S   +  +  + N  + V   R 
Sbjct: 90  SLMPPAVSDNIMDYLNQF-AYQASRLTAIGGAFLVVTSLLLIMTIDKTFNDIWHVTRQRP 148

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
                L+ +  V L  V      +    +       R+    + ++  I+     +  ++
Sbjct: 149 LPQRALVYWAVVTLGPVVAGASLWATSFL------ARESLGLVRDVPEIVSLAISFLPLI 202

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
              +G   + + +P         L G   T I   +    F +Y+  F TY+ +Y   A+
Sbjct: 203 LTGLGFAALFVVVPNRHVYWRDALVGGFGTAIVLELMKAAFAYYLTRFPTYTVIYGAFAT 262

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           +   L+++Y+  +  + GA + AS  +    +
Sbjct: 263 LPIFLLWIYLSWLAVLFGATVAASAPLIRLGR 294


>gi|323489804|ref|ZP_08095029.1| transport protein [Planococcus donghaensis MPA1U2]
 gi|323396542|gb|EGA89363.1| transport protein [Planococcus donghaensis MPA1U2]
          Length = 299

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 57/266 (21%), Positives = 119/266 (44%), Gaps = 2/266 (0%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
            + +  +   + D   + + ++   LLS+FP ++F   L  +L   +    +   +    
Sbjct: 28  FLKELFQRIKDVDVPGLGAQLAFFFLLSIFPLLIFLVTLLPYLALSR--GEIFSFLEEVV 85

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P  +   I   +++VL     GL +   LA  + +S G+ AL  SLN +Y+V E R   +
Sbjct: 86  PGTVYVLIESTVIEVLTTQNTGLLSFGILATIWSASLGMNALIKSLNLSYKVAENRPILL 145

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            R +S    +L    L++   + +        +  F     N L++  + R     + +F
Sbjct: 146 ARAMSIILTVLLIFILIVALALPIFGEQLGRLIFSFLGLEANFLVVWNSVRFTIPAIVIF 205

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           +    ++   P  +  I+S+L G  F    W++ + LF+ Y+  F  +S  Y  + +I+ 
Sbjct: 206 VACAIIYWLAPNVRLNILSVLVGAAFAATGWLLTSYLFSIYVKNFGNFSATYGSIGAIIV 265

Query: 251 CLVFLYMLGVFFILGAELNASMIIYY 276
            +++LY+  +  ++G ++NA M    
Sbjct: 266 LMLWLYVSAMILVIGGQINAVMKERR 291


>gi|255010345|ref|ZP_05282471.1| putative tRNA processing ribonuclease [Bacteroides fragilis 3_1_12]
 gi|313148145|ref|ZP_07810338.1| ribonuclease BN [Bacteroides fragilis 3_1_12]
 gi|313136912|gb|EFR54272.1| ribonuclease BN [Bacteroides fragilis 3_1_12]
          Length = 439

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 48/276 (17%), Positives = 99/276 (35%), Gaps = 4/276 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +     +   IY  +  F ++     AS ++ S LL++ P +     +A   G    + +
Sbjct: 28  KFSIYNIIKTIYLCVNRFNKDRIVNKASALTYSTLLAIVPILAIVFAIARGFGVSTLMES 87

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
                FG   E     +      +          +  +   +   N V  + I+ NR ++
Sbjct: 88  QFRDGFGGSTEATDVILQFVDSYLSQTKNGIFIGVGLVMLLWTVLNLVSNIEITFNRIWQ 147

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V + RS Y      F   LL  + +V+   + + +   L  +  F      L  I+    
Sbjct: 148 VKKGRSMYRKITDYFSMFLLMPILIVVSGGLSIFVGTMLKSMADFVL----LAPILKFLI 203

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                +  ++    +++F+P  K K    L   I    ++     L+    +  S Y+ +
Sbjct: 204 RLIPFVLTWLMFTGLYIFMPNTKVKFKHALISGILAGSAYQAFQFLYISSQLWVSKYNAI 263

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           Y   A++   L++L +     + GAEL  +      
Sbjct: 264 YGSFAALPMFLLWLQISWTICLFGAELTYAGQNIRN 299


>gi|295136139|ref|YP_003586815.1| ribonuclease BN [Zunongwangia profunda SM-A87]
 gi|294984154|gb|ADF54619.1| ribonuclease BN [Zunongwangia profunda SM-A87]
          Length = 297

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 54/277 (19%), Positives = 117/277 (42%), Gaps = 8/277 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
            +++I +       +    +++ ++  A L+VFP I+   +L G     Q +   I+ + 
Sbjct: 22  WWEVIKEVKNEISADKVSIVSAGVAFYAFLAVFPAIMALISLYGLATDPQEIQRQINELS 81

Query: 68  GAWPEVIAKPIT---DEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
              P    + +    D  LQ              + + + ++ G   L   ++ AY  +E
Sbjct: 82  AMMPRQAFEVLQQRVDVFLQTHGDQLGWGTVFGIIFSIWSANKGTNGLLTGVDIAYDTIE 141

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
             + +   L++  + +   + L++   + V  P  +  +         L  +I   R   
Sbjct: 142 NHNIFKQYLMASVFTIGGLIMLILSMILIVGFPALVHKI----GLPAKLEDLISWSRWLL 197

Query: 185 TMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
               + I L  V+ F PA  K     ++PG +F+ I W+  +  F+ Y+  F  Y  +Y 
Sbjct: 198 LAFLVSIFLCLVYKFAPARPKPTTRWVIPGALFSTIVWLAASYGFSFYVSNFGNYGEVYG 257

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            +++++  L++LY+     +LGAE+N  ++ Y   +K
Sbjct: 258 SISAVVVLLLWLYITCFIILLGAEINTEIVDYLIAEK 294


>gi|317403320|gb|EFV83834.1| membrane protein [Achromobacter xylosoxidans C54]
          Length = 437

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 45/272 (16%), Positives = 99/272 (36%), Gaps = 9/272 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF-- 67
                  +   EE    +AS ++ + +L++ P +    +L       Q     ++     
Sbjct: 30  RAFVFTAQRADEEKLLQVASSLTFTTVLAIVPMLAVVLSLFTAFPVFQEFRVALEDFLTN 89

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P  ++  I D + Q  A  A  L  I        S   +  +  + N  + V   R 
Sbjct: 90  SLMPPSVSDNIMDYLNQF-ARQASRLTAIGGGFLLVTSLLLIMTIDKAFNDIWHVTRQRP 148

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
                L+ +  + L  V      +    +       R+    + ++  ++     +  ++
Sbjct: 149 LPQRALVYWAVITLGPVVAGASLWATSFV------ARESLGLVRDVPEVVSVAISFIPLV 202

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
              +G   + + +P  +      L G   T ++  V    F +Y+  F TY+ +Y   A+
Sbjct: 203 LTGLGFAALFVVVPNRQVLWRDALIGGCVTAVALEVMKSAFAYYLTRFPTYTVIYGAFAT 262

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           +   L+++Y+  +  +LGA L AS  +    +
Sbjct: 263 LPIFLLWIYLSWLAVLLGATLAASAPLIRLGR 294


>gi|222149946|ref|YP_002550903.1| ribonuclease transmembrane protein [Agrobacterium vitis S4]
 gi|221736928|gb|ACM37891.1| ribonuclease transmembrane protein [Agrobacterium vitis S4]
          Length = 298

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 138/279 (49%), Positives = 201/279 (72%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MR Y   ++ + +DA+ HF E+DGWAMASH++LS LL+VFPF++FG  LAG LGA+ F P
Sbjct: 1   MRSYLGRLYKVAFDAVWHFTEDDGWAMASHVALSILLAVFPFLIFGTALAGLLGANTFAP 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T I  +F  WPE IAKPI+++++QVL +P  GL TIS LAAAYF+SNGVEALR +LNRAY
Sbjct: 61  TAIHFIFDTWPEEIAKPISEQVVQVLTIPRGGLLTISVLAAAYFASNGVEALRTALNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R WYITRLIS G+V++      ++S + +A+P+AL +  + FP L + L ++ N 
Sbjct: 121 RVTETRPWYITRLISLGFVIMGVAAFAVISVLLIAVPIALRFAERQFPLLKDFLALVSNW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
            +  T++ L +GL   HL+LPA + +++ +LPG+  T + W++GA+ F  Y+ TF+ Y+ 
Sbjct: 181 SVLGTLILLAVGLTISHLWLPADRRRLIDVLPGICLTLLLWLLGALAFAAYLATFANYAA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            YAGLAS+M  ++FLYMLGV F++GAE NA+++ +   +
Sbjct: 241 TYAGLASVMVVIIFLYMLGVLFLIGAEFNAALMKFSRPR 279


>gi|114319682|ref|YP_741365.1| putative ribonuclease BN [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312407|sp|Q0ABB2|Y521_ALHEH RecName: Full=UPF0761 membrane protein Mlg_0521
 gi|114226076|gb|ABI55875.1| tRNA-processing RNAse BN [Alkalilimnicola ehrlichii MLHE-1]
          Length = 445

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 45/278 (16%), Positives = 102/278 (36%), Gaps = 7/278 (2%)

Query: 4   YFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTV 62
           +  +  D      E F  +     A+ +S + LL++ P +  G ++             +
Sbjct: 24  WLRVAVDFPLYVAERFRRDACLQNAATLSYTTLLALVPLLTIGLSIFAAFPVFSGLTEQM 83

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
           +D++F          +   +   +   A GL  +  LA    +   + A+  ++N  +RV
Sbjct: 84  LDLLFENLVPASTAVVQQHLEDFVG-RAAGLTVVGLLALMVSALLMMAAIDRAMNDIWRV 142

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            + R      ++ +  + LA + +     +   +     +       L  L  +      
Sbjct: 143 QQRRRPLHGFMVYWTVLTLAPILMGASLGISSYVISVTRF-----GELEALSGLQGLLLA 197

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
               +A  +   F++  +P  +  +   L G +     +      F  Y+    TY  +Y
Sbjct: 198 GMPFVAETVAFTFLYAAVPNFRVPLRHALLGGLLAAALFEAAKGGFGWYVANIPTYEAIY 257

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             LA++   L++LY+  V  ++GAE   ++  Y   + 
Sbjct: 258 GALAALPIFLIWLYLSWVVVLVGAEFTQALASYSVARH 295


>gi|39997555|ref|NP_953506.1| ribonuclease BN [Geobacter sulfurreducens PCA]
 gi|39984446|gb|AAR35833.1| ribonuclease BN, putative [Geobacter sulfurreducens PCA]
          Length = 397

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 39/263 (14%), Positives = 93/263 (35%), Gaps = 5/263 (1%)

Query: 18  HFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKP 77
           +F+++     AS ++ S LLS+ PF      +   LG    +      +         + 
Sbjct: 3   NFMDDQCLLHASALTYSTLLSIVPFFALAFAVLKGLGVQNTLE---PFILDQVAAGSHEI 59

Query: 78  ITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFG 137
           +   +  +       L  +  +     +   +  +  + N  + V E RS Y        
Sbjct: 60  VDRIVTYINNTKVGSLGAVGLVTLVVSTVTLLGNIEETFNSIWGVRETRSLYRRFSDYLS 119

Query: 138 YVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVH 197
            V+   + +     V   +        ++      L  ++         +++++ L+F++
Sbjct: 120 VVVFGPILIFAAISVTTTLE--SQKAVQWLIGTAYLGDVLVAAFRLVPYVSIWLALVFLY 177

Query: 198 LFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYM 257
           + +P  K +  S L G +     W      + H+ V  + Y+ +Y  LA +   +++LY 
Sbjct: 178 MLIPNTKVRFRSALVGGVIAGTLWQAAQWGYIHFQVGVAKYNAIYGTLAVLPVFMIWLYA 237

Query: 258 LGVFFILGAELNASMIIYYWRKK 280
                + G E+  +       + 
Sbjct: 238 SWSIVLFGVEVVYAHQHRRTFRH 260


>gi|167762332|ref|ZP_02434459.1| hypothetical protein BACSTE_00686 [Bacteroides stercoris ATCC
           43183]
 gi|167699975|gb|EDS16554.1| hypothetical protein BACSTE_00686 [Bacteroides stercoris ATCC
           43183]
          Length = 439

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 50/273 (18%), Positives = 97/273 (35%), Gaps = 4/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
              +   IY  I  F ++     AS ++ S LL++ P +     +A   G    + + I 
Sbjct: 31  LYNIIKTIYLCINRFTKDRLVNKASALTYSTLLAIVPILAIVFAIARGFGFDNLMESQIV 90

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
             FG   E            +          +  +   +   N +  + I+ NR ++V +
Sbjct: 91  QGFGGPSETTEVIFQFVNSYLSQTKNGIFIGVGLIMLLWTVLNLINNMEITFNRIWQVKK 150

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            RS Y      F  +LL  + LV+   + + +   L  V         L  I        
Sbjct: 151 ARSMYRKITDYFSMLLLIPLLLVVSGGLSIFMSTMLKNVTD----FTLLAPIGKFLIRLI 206

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
             +  ++    +++F+P  K K+   L   I    +      L+    +  S Y+ +Y  
Sbjct: 207 PFVLTWVMFTALYVFMPNTKVKLKHALISGILAGTAHQAFQFLYISSQLWVSRYNAIYGS 266

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
            A++   L++L +     + GAEL  +      
Sbjct: 267 FAALPMFLLWLQISWTICLFGAELTYAGQNIRN 299


>gi|330991211|ref|ZP_08315163.1| Putative ribonuclease-like protein yfkH [Gluconacetobacter sp.
           SXCC-1]
 gi|329761704|gb|EGG78196.1| Putative ribonuclease-like protein yfkH [Gluconacetobacter sp.
           SXCC-1]
          Length = 313

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 61/274 (22%), Positives = 118/274 (43%), Gaps = 7/274 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           V  ++     + V +     A+  +  A LS+FP +    +L G L   Q V   + V+ 
Sbjct: 19  VRQVLRQVARNIVSDQITLAAAGCAFYATLSLFPAMSTLISLYGLLFDLQTVEPQLVVLR 78

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLNRAYRVVE 124
              P      I D I  ++A     L     +    A + +S    +L +++N AY   E
Sbjct: 79  NLLPPSAYGVIGDRIHLLVAESHSSLTLNLIISTTIATWSASAATRSLIMAMNVAYNTPE 138

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPA---LGNLLLIIWNGR 181
            RS+   + ++ G    +    ++   + VA+P  + Y+ +        G++ L+I  G 
Sbjct: 139 TRSFVRFQAMAMGLTFCSICGGILTLALMVALPFLIDYLPEHLSLAPPPGSVELLIHMGG 198

Query: 182 IYATMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
               +L +      ++ F P    +    ILPG +   + W++ +  F++Y+   + YS 
Sbjct: 199 PILMLLFVLSLCSVLYRFGPNRPHTYWRCILPGSVGATLLWLLSSSGFSYYVSHIAGYSA 258

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMII 274
            Y  L + +  +++ Y+     +LGAELNA + I
Sbjct: 259 TYGPLGAFIAIMMWFYVSAYVVLLGAELNAGLEI 292


>gi|60682237|ref|YP_212381.1| putative tRNA processing ribonuclease [Bacteroides fragilis NCTC
           9343]
 gi|253564684|ref|ZP_04842140.1| ribonuclease [Bacteroides sp. 3_2_5]
 gi|265766340|ref|ZP_06094381.1| ribonuclease BN [Bacteroides sp. 2_1_16]
 gi|60493671|emb|CAH08460.1| putative tRNA processing ribonuclease [Bacteroides fragilis NCTC
           9343]
 gi|251946149|gb|EES86526.1| ribonuclease [Bacteroides sp. 3_2_5]
 gi|263254008|gb|EEZ25473.1| ribonuclease BN [Bacteroides sp. 2_1_16]
 gi|301163715|emb|CBW23269.1| putative tRNA processing ribonuclease [Bacteroides fragilis 638R]
          Length = 439

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 48/276 (17%), Positives = 99/276 (35%), Gaps = 4/276 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +     +   IY  +  F ++     AS ++ S LL++ P +     +A   G    + +
Sbjct: 28  KFSIYNIIKTIYLCVNRFNKDRIVNKASALTYSTLLAIVPILAIVFAIARGFGVSTLMES 87

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
                FG   E     +      +          +  +   +   N V  + I+ NR ++
Sbjct: 88  QFRDGFGGSTEATDIILQFVDSYLSQTKNGIFIGVGLVMLLWTVLNLVSNIEITFNRIWQ 147

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V + RS Y      F   LL  + +V+   + + +   L  +  F      L  I+    
Sbjct: 148 VKKGRSMYRKITDYFSMFLLMPILIVVSGGLSIFVGTMLKSMADFVL----LAPILKFLI 203

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                +  ++    +++F+P  K K    L   I    ++     L+    +  S Y+ +
Sbjct: 204 RLIPFVLTWLMFTGLYIFMPNTKVKFKHALISGILAGSAYQAFQFLYISSQLWVSKYNAI 263

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           Y   A++   L++L +     + GAEL  +      
Sbjct: 264 YGSFAALPMFLLWLQISWTICLFGAELTYAGQNIRN 299


>gi|170703573|ref|ZP_02894322.1| ribonuclease BN [Burkholderia ambifaria IOP40-10]
 gi|170131516|gb|EDT00095.1| ribonuclease BN [Burkholderia ambifaria IOP40-10]
          Length = 443

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 39/273 (14%), Positives = 97/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVI 63
              +  +   A     E+    +A  ++ + +L++ P +     L            ++ 
Sbjct: 8   LDTIKRLAQFAARRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFSSFQISLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     S   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNVQIFKYLNQFASKAKGLTTAGLIVLVVTSVMTMMTIESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +           P+   +  ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSISSYLFTQSLAFTGAAPSTSIVEWLLALVSLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +F  I++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVIGGLFAAIAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     +LGA + +++    
Sbjct: 244 AFAALPVFLLWVYLSWFIALLGAMVASALPAIR 276


>gi|172060429|ref|YP_001808081.1| ribonuclease BN [Burkholderia ambifaria MC40-6]
 gi|171992946|gb|ACB63865.1| ribonuclease BN [Burkholderia ambifaria MC40-6]
          Length = 443

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 39/273 (14%), Positives = 97/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVI 63
              +  +   A     E+    +A  ++ + +L++ P +     L            ++ 
Sbjct: 8   LDTIKRLAQFAARRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFSSFQISLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     S   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNVQIFKYLNQFAAKAKGLTTAGLIVLVVTSVMTMMTIESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +           P+   +  ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSISSYLFTQSLAFTGAAPSTSIVEWLLALVSLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +F  I++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVIGGLFAAIAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     +LGA + +++    
Sbjct: 244 AFAALPVFLLWVYLSWFIALLGAMVASALPAIR 276


>gi|53714041|ref|YP_100033.1| ribonuclease BN [Bacteroides fragilis YCH46]
 gi|52216906|dbj|BAD49499.1| ribonuclease BN [Bacteroides fragilis YCH46]
          Length = 439

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 48/276 (17%), Positives = 99/276 (35%), Gaps = 4/276 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +     +   IY  +  F ++     AS ++ S LL++ P +     +A   G    + +
Sbjct: 28  KFSIYNIIKTIYLCVNRFNKDRIVNKASALTYSTLLAIVPILAILFAIARGFGVSTLMES 87

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
                FG   E     +      +          +  +   +   N V  + I+ NR ++
Sbjct: 88  QFRDGFGGSTEATDIILQFVDSYLSQTKNGIFIGVGLVMLLWTVLNLVSNIEITFNRIWQ 147

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V + RS Y      F   LL  + +V+   + + +   L  +  F      L  I+    
Sbjct: 148 VKKGRSMYRKITDYFSMFLLMPILIVVSGGLSIFVGTMLKSMADFVL----LAPILKFLI 203

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                +  ++    +++F+P  K K    L   I    ++     L+    +  S Y+ +
Sbjct: 204 RLIPFVLTWLMFTGLYIFMPNTKVKFKHALISGILAGSAYQAFQFLYISSQLWVSKYNAI 263

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           Y   A++   L++L +     + GAEL  +      
Sbjct: 264 YGSFAALPMFLLWLQISWTICLFGAELTYAGQNIRN 299


>gi|154685267|ref|YP_001420428.1| YfkH [Bacillus amyloliquefaciens FZB42]
 gi|154351118|gb|ABS73197.1| YfkH [Bacillus amyloliquefaciens FZB42]
          Length = 279

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 70/268 (26%), Positives = 121/268 (45%), Gaps = 2/268 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
             I +    F   +G + ++ ++   LLS+FP ++F   L  +L        V+  V   
Sbjct: 2   SFIKELFARFSLHEGQSKSAELAYFFLLSLFPLMIFMLTLTAYLPISA--EDVLGAVDQY 59

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P+     +     Q L   + GL +   +A  + +SNG+ A+  + N AY V E RS+ 
Sbjct: 60  APDSAMSMVKSITEQTLNKRSGGLLSFGIIAVIWSASNGMNAIVRAFNHAYEVEENRSFI 119

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           I RL S    +   VT++I   + V           F  A G  L +    R   + L L
Sbjct: 120 IIRLTSIFLTIAMVVTILIALLLPVFGREIGMLAADFIGASGLFLQVWSVVRWGISPLIL 179

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            I    +++F P  +  +  +LPG +F    W++ ++LF+ Y+ TF+ YS  Y  +  I+
Sbjct: 180 LIVFTALYIFAPNKRLSLRFVLPGAVFAAAGWIIVSMLFSFYVGTFANYSATYGSIGGII 239

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYW 277
             +++ Y+ G   ILG E+NA +     
Sbjct: 240 VLMIWFYLTGTLLILGGEINALLHKRKK 267


>gi|308172652|ref|YP_003919357.1| integral inner membrane protein [Bacillus amyloliquefaciens DSM 7]
 gi|307605516|emb|CBI41887.1| putative integral inner membrane protein with ribonuclease fold
           [Bacillus amyloliquefaciens DSM 7]
          Length = 279

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 70/268 (26%), Positives = 121/268 (45%), Gaps = 2/268 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
             + +    F   +G + ++ ++   LLS+FP I+F   L  +L        V+  V   
Sbjct: 2   SFMKELFARFSLHEGQSKSAELAYFFLLSLFPLIIFILTLTAYLPISA--EDVLGAVDQY 59

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P+     +     Q L   + GL +   +A  + +SNG+ A+  + N AY V E RS+ 
Sbjct: 60  APDSAMSMVKSITEQTLNKRSGGLLSFGIIAVIWSASNGMNAIVRAFNHAYEVEENRSFI 119

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           I RL S    +   VT++I   + V           F  A G  L +    R   + L L
Sbjct: 120 ILRLTSIFLTIAMVVTILIALLLPVFGREIGLLAADFIGAPGLFLKVWSVVRWGISPLIL 179

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            I    +++F P  +  +  +LPG +F    W++ ++LF+ Y+ TF+ YS  Y  +  I+
Sbjct: 180 LIVFTALYIFAPNKRLSLRFVLPGAVFAAAGWIIVSMLFSFYVGTFANYSATYGSIGGII 239

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYW 277
             +++ Y+ G   ILG E+NA +     
Sbjct: 240 VLMIWFYLTGTLLILGGEINALLHKRKK 267


>gi|116494587|ref|YP_806321.1| ribonuclease BN-like family protein [Lactobacillus casei ATCC 334]
 gi|191638025|ref|YP_001987191.1| YihY family protein [Lactobacillus casei BL23]
 gi|301066135|ref|YP_003788158.1| ribonuclease BN-like family enzyme [Lactobacillus casei str. Zhang]
 gi|116104737|gb|ABJ69879.1| Ribonuclease BN-like family enzyme [Lactobacillus casei ATCC 334]
 gi|190712327|emb|CAQ66333.1| YihY family protein [Lactobacillus casei BL23]
 gi|300438542|gb|ADK18308.1| Ribonuclease BN-like family enzyme [Lactobacillus casei str. Zhang]
 gi|327382107|gb|AEA53583.1| Methionine aminopeptidase Map [Lactobacillus casei LC2W]
 gi|327385249|gb|AEA56723.1| Methionine aminopeptidase Map [Lactobacillus casei BD-II]
          Length = 335

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 66/269 (24%), Positives = 121/269 (44%), Gaps = 2/269 (0%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
            +  AI    E +    A+ ++   LLS+FP I+F AN   + G       +   +  A 
Sbjct: 42  FVKLAINRITESNIGQSAAALAYYTLLSLFPLILFVANALPYFGL--TYKGLAAYLTQAI 99

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P  +   +   I  +L   + GL  I A+A  + +S GV  L++  N+ Y V   +++ I
Sbjct: 100 PSNVMNWLDPVIANLLDSSSGGLLGIGAVATLWAASLGVNGLKMGFNQIYGVESSQNFII 159

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            RL+S        + +  +  VF      L ++        + L      R   T+ ALF
Sbjct: 160 QRLLSMLMTFTLIIVMGAILIVFAFGRQFLEWLIPLLRLNDDWLRTFNTLRWPVTITALF 219

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           + ++F++ FLP  K ++ ++LPG  FT   W++ A  F+ Y+  F T    Y  + + + 
Sbjct: 220 VIIMFLNYFLPNVKIRMWTVLPGTAFTVAGWLLIAQAFSLYMKYFGTRYLSYGTIGTFIA 279

Query: 251 CLVFLYMLGVFFILGAELNASMIIYYWRK 279
            +++L    +  + GA +NA    Y+  +
Sbjct: 280 IMLWLNFSALVLLWGAVINALTAEYFIGR 308


>gi|254472479|ref|ZP_05085879.1| YihY family protein [Pseudovibrio sp. JE062]
 gi|211958762|gb|EEA93962.1| YihY family protein [Pseudovibrio sp. JE062]
          Length = 296

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 103/276 (37%), Positives = 163/276 (59%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R  +   + ++ DA+ HF  +DG+A+ASH++LS+L+++FPF++F A  +GFLG +    +
Sbjct: 4   RGLWGKSYQVLADALGHFNSDDGYAVASHVALSSLMALFPFLIFVAAFSGFLGLNSVAQS 63

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
             +++F  WPE +A P++ EI  VL  P   L T   +   +FSSNGVEA+R+ LNRAYR
Sbjct: 64  ATELIFDVWPERVAGPVSGEIKAVLTQPRGDLLTFGVVVTLWFSSNGVEAMRVGLNRAYR 123

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V + RSW+  R  S   VL+ +  L++ +F+ V  PLA  +     P +          R
Sbjct: 124 VRDNRSWFFCRTQSILAVLIGTAVLMVSTFLIVFGPLAWEWAVHLAPVMEKFSYKANIVR 183

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
              T L L   L+  H++LPA + + + +LPG+  T I W+V    F  Y+  ++ Y ++
Sbjct: 184 YGITSLLLLFALLAAHMYLPAGRRRFLEVLPGIALTMILWIVAGTAFGAYLARWANYVSL 243

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           YAGLA IMT ++F+Y+  V FILG E NA+++    
Sbjct: 244 YAGLAGIMTAIIFMYLTAVIFILGGEFNAALMRVRR 279


>gi|170732784|ref|YP_001764731.1| ribonuclease BN [Burkholderia cenocepacia MC0-3]
 gi|169816026|gb|ACA90609.1| ribonuclease BN [Burkholderia cenocepacia MC0-3]
          Length = 442

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 40/273 (14%), Positives = 97/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVI 63
              +  +   A     E+    +A  ++ + LL++ P +     L            ++ 
Sbjct: 8   LDTIKRLAQFAARRSAEDRIPQVAGSLTFTTLLALVPLLTVAFALFTAFPMFASFQISLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     S   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNIQIFKYLNQFASKAKGLTTAGLIVLVVTSVMTMMTIESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +           P+   +  ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSISSYLFTQSLAFTGAGPSTSMVEWLLALASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +F  I++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVIGGLFAAIAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     +LGA + +++    
Sbjct: 244 AFAALPVFLLWVYLSWFIALLGAMVASALPAIR 276


>gi|124383383|ref|YP_001026405.1| ribonuclease BN [Burkholderia mallei NCTC 10229]
 gi|126448742|ref|YP_001080322.1| tRNA-processing ribonuclease BN [Burkholderia mallei NCTC 10247]
 gi|254358675|ref|ZP_04974948.1| tRNA-processing ribonuclease BN [Burkholderia mallei 2002721280]
 gi|124291403|gb|ABN00672.1| ribonuclease BN [Burkholderia mallei NCTC 10229]
 gi|126241612|gb|ABO04705.1| tRNA-processing ribonuclease BN [Burkholderia mallei NCTC 10247]
 gi|148027802|gb|EDK85823.1| tRNA-processing ribonuclease BN [Burkholderia mallei 2002721280]
          Length = 436

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 36/273 (13%), Positives = 95/273 (34%), Gaps = 6/273 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A +   E+    +A  ++ + +L++ P +     L         F  ++ 
Sbjct: 8   LDTIKRLARFAAKRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQNSLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +   + +   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNSQIFKYLNQFASKAKGLTTAGLIVLVFTAVMMM-TIESAFNLIWRVR 126

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +                   ++    + 
Sbjct: 127 KPRPFAQRVLAYWALITLGPLLFGVSLSMSSYLFTKSLAFAGSTSTPPVFEWLLAAASLP 186

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +   +++ +    F +Y+    TY+ +Y 
Sbjct: 187 LTVL----AFTLLYVYLPNCTVAWRDAVVGGVCAALAFELAKRGFGYYVRRIPTYTAVYG 242

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L++LY+     + GA + +++    
Sbjct: 243 AFATVPMFLLWLYLSWFVTLAGAMIASALPAIR 275


>gi|328552413|gb|AEB22905.1| integral inner membrane protein with ribonuclease fold [Bacillus
           amyloliquefaciens TA208]
 gi|328910764|gb|AEB62360.1| putative integral inner membrane protein with ribonuclease fold
           [Bacillus amyloliquefaciens LL3]
          Length = 279

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 70/268 (26%), Positives = 121/268 (45%), Gaps = 2/268 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
             + +    F   +G + ++ ++   LLS+FP I+F   L  +L        V+  V   
Sbjct: 2   SFMKELFARFSLHEGQSKSAELAYFFLLSLFPLIIFILTLTAYLPISA--EDVLGAVDQY 59

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P+     +     Q L   + GL +   +A  + +SNG+ A+  + N AY V E RS+ 
Sbjct: 60  APDSAMSMVKSITEQTLNKRSGGLLSFGIIAVIWSASNGMNAIVRAFNHAYEVEENRSFI 119

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           I RL S    +   VT++I   + V           F  A G  L +    R   + L L
Sbjct: 120 IIRLTSIFLTIAMVVTILIALLLPVFGREIGLLAADFIGAPGLFLQVWSVVRWGISPLIL 179

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            I    +++F P  +  +  +LPG +F    W++ ++LF+ Y+ TF+ YS  Y  +  I+
Sbjct: 180 LIVFTALYIFAPNKRLSLRFVLPGAVFAAAGWIIVSMLFSFYVGTFANYSATYGSIGGII 239

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYW 277
             +++ Y+ G   ILG E+NA +     
Sbjct: 240 VLMIWFYLTGTLLILGGEINALLHKRKK 267


>gi|54310542|ref|YP_131562.1| ribonuclease BN [Photobacterium profundum SS9]
 gi|67460675|sp|Q6LLR8|Y3489_PHOPR RecName: Full=UPF0761 membrane protein PBPRA3489
 gi|46914985|emb|CAG21760.1| putative ribonuclease BN [Photobacterium profundum SS9]
          Length = 319

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 43/267 (16%), Positives = 90/267 (33%), Gaps = 8/267 (2%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID-VVFGAW 70
           +         +     A  ++   LLS+ P I               +  ++   V   +
Sbjct: 23  LTYLNRRIKHDRLTIAAGSMAYVTLLSLVPMITVVLAALSAFPVFAGLGELLQNFVIENF 82

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
                + +   + + +A  A  +  +   A    +   + ++  +LN  +RV E R   I
Sbjct: 83  VPAAGEVVKTYLNEFVAN-AGKMTAVGIGALFVVAMMLMSSIDHALNYIWRVHEKRRPVI 141

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
           +  I +  + L  + +     V   +                +  +         ++   
Sbjct: 142 SFSIYWMVLTLGPILVGSSIAVSSYLGSL------NLLNSEAVNGLFQQTLRALPVIMSS 195

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
              + ++L +P  K K    L G +     + +    F  YI  F +Y  +Y  LA I  
Sbjct: 196 SAFLGLYLLVPNLKVKFSHALLGALVASSLFELSKKGFALYISNFPSYQVIYGALAVIPI 255

Query: 251 CLVFLYMLGVFFILGAELNASMIIYYW 277
             V++Y+     +LGAE+ AS+     
Sbjct: 256 LFVWVYLCWCIVLLGAEITASLGERKQ 282


>gi|329955890|ref|ZP_08296693.1| YihY family protein [Bacteroides clarus YIT 12056]
 gi|328525270|gb|EGF52320.1| YihY family protein [Bacteroides clarus YIT 12056]
          Length = 439

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 50/273 (18%), Positives = 96/273 (35%), Gaps = 4/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
              +   IY  I  F ++     AS ++ S LL++ P +     +A   G    + + I 
Sbjct: 31  LYNIIKTIYLCINRFTKDRLVNKASALTYSTLLAIVPILAIVFAIARGFGFDNLMESQIV 90

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
             FG   E            +    +     +  +   +   N +  + I+ NR ++V +
Sbjct: 91  KGFGGPSETTEVIFQFVNSYLSQTKSGIFIGVGLIMLLWTVLNLINNMEITFNRIWQVKK 150

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            RS Y      F  +LL  + LV+   + + +   L  V         L  I        
Sbjct: 151 ARSMYRKITDYFSMLLLIPILLVVSGGLSIFMSTMLKNVAD----FTLLAPIGKFLVRLI 206

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
             +  +     +++F+P  K K    L   I    +      L+    +  S Y+ +Y  
Sbjct: 207 PFVLTWFMFTALYVFMPNTKVKFKHALISGILAGTAHQAFQFLYISSQLWVSRYNAIYGS 266

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
            A++   L++L +     + GAEL  +      
Sbjct: 267 FAALPMFLLWLQISWTICLFGAELTYAGQNIRN 299


>gi|288553956|ref|YP_003425891.1| hypothetical protein BpOF4_04675 [Bacillus pseudofirmus OF4]
 gi|288545116|gb|ADC48999.1| hypothetical protein BpOF4_04675 [Bacillus pseudofirmus OF4]
          Length = 276

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 62/270 (22%), Positives = 125/270 (46%), Gaps = 2/270 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
             +   +E    +     ++  +   +LS+FP ++F   L  +   +  +  V  +++  
Sbjct: 5   SFMKHFMEQLKTDPIPDWSATFAYYFMLSIFPLLIFMIALLPYFQLN--IDQVYQILYDY 62

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P  +A    + IL+V++ P  GL +   +AA + +SNGV AL  ++NRAY + E R++ 
Sbjct: 63  VPSDLADLFGNTILEVISHPQGGLVSFGVIAAMWSASNGVNALIRAVNRAYGIEETRNFL 122

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
             RL+S    L     +V    + V   L +  +   F         +   R    +  +
Sbjct: 123 SLRLLSILLTLCMIFVVVTTLLLPVFGKLIINGMEYLFAVPPETAEFLNVLRWIIGIGLM 182

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + L+F++   P  K K   ++ G +   I W + ++LF++Y+  F  YS  Y  L  ++
Sbjct: 183 TLVLMFLYWAAPNVKLKFKQVIIGALSATIGWQIISLLFSYYVTNFGNYSATYGSLGGVI 242

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             +++ ++ G+  I+G E+NA++      K
Sbjct: 243 ILMLWFFLTGLIIIVGGEINATIFHQKRAK 272


>gi|167562990|ref|ZP_02355906.1| YihY family protein [Burkholderia oklahomensis EO147]
          Length = 428

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 35/273 (12%), Positives = 93/273 (34%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A +   E+    +A  ++ + +L++ P +     L         F  ++ 
Sbjct: 8   LDTIKRLARFAAKRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQNSLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     +   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNSQIFKYLNQFAAKAKGLTTAGLIVLVVTAVMTMMTVESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +                   ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSISSYLFTKSLAFAGSTSTPPIFEWLLTAASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP           G +   +++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAAVGGVCAAVAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     + GA + +++    
Sbjct: 244 AFATVPMFLLWMYLSWFVTLAGAMIASALPAIR 276


>gi|157373443|ref|YP_001472043.1| ribonuclease BN [Shewanella sediminis HAW-EB3]
 gi|157315817|gb|ABV34915.1| putative ribonuclease BN [Shewanella sediminis HAW-EB3]
          Length = 298

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 46/265 (17%), Positives = 102/265 (38%), Gaps = 8/265 (3%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVIDVVFGAWPEVIA 75
           +   E+     A H++   LLS+ P +    ++         +   +   ++  +     
Sbjct: 6   QRLAEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFSGIRGQIEGFIYNNFLPAAG 65

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
             +   I + ++  +KG   +   A    +   + A+  +LN  +R  E RS  ++  + 
Sbjct: 66  DTVQVYINEFVSNASKG-TAVGIAALMVVAIMLISAIDKALNNIWRTTEKRSMVVSFSMY 124

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIF 195
           +  + L  V +         +     +         +L  ++        M       + 
Sbjct: 125 WMVLTLGPVLMGASLVATSYVVSLKVFNGS------DLSGVVPVLVERLPMFFSVATFLL 178

Query: 196 VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFL 255
           +++ +P  K K    L G I   + +  G   F  Y+  F TY  +Y  LA+I    +++
Sbjct: 179 IYMVVPNIKVKFFHALLGAIVAALLFEFGKKGFAIYLTKFPTYEAIYGALATIPILFMWV 238

Query: 256 YMLGVFFILGAELNASMIIYYWRKK 280
           Y+  +  +LGAE+ A+M  Y  +++
Sbjct: 239 YLSWIIVLLGAEITAAMPEYLDKRQ 263


>gi|110834404|ref|YP_693263.1| ribonuclease BN-like family protein [Alcanivorax borkumensis SK2]
 gi|110647515|emb|CAL16991.1| Ribonuclease BN-like family protein [Alcanivorax borkumensis SK2]
          Length = 458

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 39/280 (13%), Positives = 100/280 (35%), Gaps = 7/280 (2%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVP 60
           +  F  +       +  F E+     A+ ++ + L ++ P +     +   + A      
Sbjct: 40  QARFNSIKAFFVLLVRQFNEDGCRQSAAALTYTTLFAIVPVMTVSFVVLSSVPALQGKSA 99

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            + +  F  +       + D +    A  A  L  +  +     S   +  +  +LNR +
Sbjct: 100 QLQEWAFEYFVPSAGNMLLDHLQSF-AKQATNLTVLGIVFLVVTSVLMLSTVEQTLNRIW 158

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           +V   R   ++ L+ +  + L  + L +   +   +       +  F    + L  +   
Sbjct: 159 KVQTPRKGLVSLLMYWALLSLGPICLGLGLAITSYLTS-----QAIFSDTVSYLGGVRLW 213

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                 L     L  ++  +P         + G     + + +    FT +I    +Y  
Sbjct: 214 LAVLPFLFTTAMLTLMYTVVPNTTVPFRQGVLGAAMAALLFELAKGAFTFFIKQAPSYQV 273

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +Y   A++   L+++Y+     + GAEL  +++++   ++
Sbjct: 274 VYGAFAAVPVFLLWIYISWTIVLGGAELVRALVVFQEHQR 313


>gi|308270567|emb|CBX27179.1| hypothetical protein N47_A12080 [uncultured Desulfobacterium sp.]
          Length = 445

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 47/269 (17%), Positives = 102/269 (37%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +R        II  A + FV +     AS ++  +LLSV P +     +A      + + 
Sbjct: 30  LRRILIKHLRIIIIASKEFVYDKCPLRASALTYYSLLSVVPVVAMAFAIAKGFKLQELLE 89

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
             I   F     ++ + I      +       +  +  +   +   N +  +  + N   
Sbjct: 90  AEIIEKFSGQEAMMMQIIEFSRNMLKDTKGGIIAGVGVVVLLWAVINVLSQIEDTFNDIS 149

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
            V + RS+          +L+  + L++     V I   L  + +    LG    ++   
Sbjct: 150 GVKKGRSFGRKFSDYLSLILIGPLLLIMSGSAMVLISTHLPQITQKIALLGIFSPLVAII 209

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                   ++I   F+++F+P  K    S L   I     +V+   L+  + +  + Y+T
Sbjct: 210 IKVLPYCFIWILFTFIYIFMPNQKVPFFSGLIAGIAAGTIFVIVQKLYIFFQIGVAKYNT 269

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELN 269
           +Y   A++   L+++ +     + GAE++
Sbjct: 270 VYGSFAALPLFLLWMQLSWFIMLFGAEIS 298


>gi|269103703|ref|ZP_06156400.1| ribonuclease BN [Photobacterium damselae subsp. damselae CIP
           102761]
 gi|268163601|gb|EEZ42097.1| ribonuclease BN [Photobacterium damselae subsp. damselae CIP
           102761]
          Length = 322

 Score =  146 bits (368), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 45/269 (16%), Positives = 96/269 (35%), Gaps = 8/269 (2%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID-VVF 67
           F       +    +     A  ++   LLS+ P I    +        Q +  V+   V 
Sbjct: 36  FAYFRYLFQRINHDRLTVTAGSMAYVTLLSLVPLITVVLSALSSFPVFQGLGEVLQNFVI 95

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
             +     + +   + Q +A  A  +  +   A    +   + ++  +LN  +RV E R 
Sbjct: 96  ENFVPAAGEVVKTYLNQFVAN-AGKMTAVGIGALFVVAMMLISSIDTALNYIWRVSEKRR 154

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
             I+  I +  + L  + +     V   +                +  ++     +  ++
Sbjct: 155 PVISFSIYWMVLTLGPILVGSSLAVSSYLGSL------NIMGSDAVNGLLQQSLRWLPVM 208

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
              +  + ++L +P  K +    + G     + + +    F  YI  F +Y  +Y  LA 
Sbjct: 209 MSTMAFLGLYLLVPNTKVRFHHAVIGAGCASLLFELSKKGFALYITNFPSYQVIYGALAV 268

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYY 276
           I    V++Y+     +LGAE+ AS+    
Sbjct: 269 IPILFVWVYLCWCIVLLGAEITASLGERK 297


>gi|239981438|ref|ZP_04703962.1| hypothetical protein SalbJ_18513 [Streptomyces albus J1074]
 gi|291453289|ref|ZP_06592679.1| membrane protein [Streptomyces albus J1074]
 gi|291356238|gb|EFE83140.1| membrane protein [Streptomyces albus J1074]
          Length = 336

 Score =  146 bits (368), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 49/269 (18%), Positives = 99/269 (36%), Gaps = 3/269 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
            +  +      F  +D    A+ ++  A+L+V P ++      G + +       +  V 
Sbjct: 20  WWVALRRTPGAFWRDDVSDFAAALTYYAILAVLPALLVVVIAFGLV-SPDTAERFVGQVT 78

Query: 68  GAWPEVIAKPITDEILQVL--AVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
              P      + + + +V+     A  L      +A + +S+ +   R +L+R Y V + 
Sbjct: 79  AWAPGGSGASLREVLTRVVRVDSTAWTLLVTGGASALWSASSYLAVSRRALHRMYGVRDR 138

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           RS +          L     L++ S + +        + +       +       R    
Sbjct: 139 RSPWGKAHRIVATALALLALLLVSSLLLMLTEPVAESIGRLLGLDAGVAWAWSVLRWPLL 198

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +  +   ++ V    P A  +    +PG       W+  +     Y    STYS +Y  L
Sbjct: 199 LCLVACLVVVVFRNGPVAARRRAHSIPGGALAATLWLTASAGLALYASVLSTYSRLYGSL 258

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMII 274
           A I+  LV+L++  V  +LGA+  A +  
Sbjct: 259 AGIVVFLVWLWLSNVALLLGAQFTAELCR 287


>gi|225025891|ref|ZP_03715083.1| hypothetical protein EUBHAL_00119 [Eubacterium hallii DSM 3353]
 gi|224956788|gb|EEG37997.1| hypothetical protein EUBHAL_00119 [Eubacterium hallii DSM 3353]
          Length = 325

 Score =  146 bits (368), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 63/272 (23%), Positives = 129/272 (47%), Gaps = 2/272 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R+    +++++ D ++   ++   A  +  +   LLS+FPF++F   L  ++   +    
Sbjct: 4   RKRIKNLYELVMDFLKKCSDDHVGAFGAMSAFFILLSIFPFMIFLLTLTRYIPFSK--DD 61

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           +I ++           I   + ++       +  IS +AA + SS GV ++ I LN  Y 
Sbjct: 62  IIVILTRMISFEEGSLIKSIVNEIYRKTGTTVSAISIIAALWSSSRGVYSIVIGLNSVYD 121

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           + E R+++  RL S  Y LL ++ + +M  ++V      +Y  + FP +  +L    + R
Sbjct: 122 IDENRNYFAIRLFSLVYTLLFALMISVMLVMWVFGNSLYSYFLQKFPFVVPILGYFMHKR 181

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
           I  +++ L +  + ++ ++P   S      PG +   + WV  +V  + Y+  F+ +S +
Sbjct: 182 IIFSLIFLTLLFMIIYKWIPNRVSSFRKQFPGALIATLGWVAVSVGCSIYMDNFTNFSYI 241

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
           Y  +A IM  L++LY        GAE+N  + 
Sbjct: 242 YGSMAGIMILLLWLYFCMSMVFYGAEVNYFLE 273


>gi|15966391|ref|NP_386744.1| putative ribonuclease RNase BN (RBN) transmembrane protein
           [Sinorhizobium meliloti 1021]
 gi|307313022|ref|ZP_07592649.1| ribonuclease BN [Sinorhizobium meliloti BL225C]
 gi|307321028|ref|ZP_07600434.1| ribonuclease BN [Sinorhizobium meliloti AK83]
 gi|15075662|emb|CAC47217.1| Probable transporter [Sinorhizobium meliloti 1021]
 gi|306893303|gb|EFN24083.1| ribonuclease BN [Sinorhizobium meliloti AK83]
 gi|306899341|gb|EFN29975.1| ribonuclease BN [Sinorhizobium meliloti BL225C]
          Length = 291

 Score =  146 bits (368), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 143/278 (51%), Positives = 195/278 (70%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M  +  I++ +++DA+ HF E+DGWAMASH++LS+L++VFPF++FG  LA FLGA QF  
Sbjct: 1   MPAFVRIIWKVVFDALWHFSEDDGWAMASHVALSSLMAVFPFLIFGTALASFLGADQFAQ 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T + ++F  WPE IAKP+ DE+++VL +P   L TIS LAAAYF+SNGVEALRI+LNRAY
Sbjct: 61  TAVHLIFDTWPESIAKPVADEVVRVLTIPRGSLLTISVLAAAYFASNGVEALRIALNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R WY+TRL S G+VL A + L  +S + VA+PLA+    ++FP L  L+  + + 
Sbjct: 121 RVAESRYWYVTRLASLGFVLGAVLILAALSILLVAVPLAVRNADQWFPWLDALMAAVDDW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
            +  T+  L  GL+  HL+LPA    ++ +LPG+  T + W VGA  F  YI  FS Y T
Sbjct: 181 GLPLTLTMLTAGLLVAHLWLPAGHRNVVDVLPGIFLTLVLWSVGAYAFASYIANFSNYVT 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            YAGLASIM  LVFLYMLG  FI+GAE+NA+++ Y  +
Sbjct: 241 TYAGLASIMIVLVFLYMLGAIFIIGAEINAAILKYKVK 278


>gi|16264680|ref|NP_437472.1| hypothetical protein SM_b21356 [Sinorhizobium meliloti 1021]
 gi|307318683|ref|ZP_07598116.1| ribonuclease BN [Sinorhizobium meliloti AK83]
 gi|15140818|emb|CAC49332.1| conserved hypothetical membrane protein [Sinorhizobium meliloti
           1021]
 gi|306895710|gb|EFN26463.1| ribonuclease BN [Sinorhizobium meliloti AK83]
          Length = 330

 Score =  145 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 57/270 (21%), Positives = 120/270 (44%), Gaps = 8/270 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D+ +       EE    +A+ +S   LLS+FP +    ++ G +     + T + ++   
Sbjct: 36  DVFWRVFSEIGEERVMLIAAGVSFYLLLSLFPALGALVSIYGLVADPSEIGTHVGILQAL 95

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLNRAYRVVEMR 126
            P      I D++  +       L     +    + + ++NG+ AL  ++N AY   E R
Sbjct: 96  LPADSYGLIMDQLETLTTQKPSTLGIGFFVSLSISLWLAANGIAALFDAMNVAYGEREKR 155

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            +    L+   +   A +  V +      +P  LAYV         + L+    R  A +
Sbjct: 156 GFLSRTLLCLAFTFAALLFAVALIAAIGVVPAVLAYV----WVDRWVELVTRAARWPAVL 211

Query: 187 LALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           L +  G I ++ F P+  ++K+  +  G +F+ + W+  + LF++Y+  F+ Y+  Y  L
Sbjct: 212 LLVTFGTILIYRFGPSRERAKLRWLNWGAVFSTLFWLAASWLFSYYLEHFANYNATYGAL 271

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            ++   + ++++  +  I+GA +NA +   
Sbjct: 272 GALAGLMTWVWISVMILIIGALINAELEHQ 301


>gi|114561519|ref|YP_749032.1| ribonuclease BN [Shewanella frigidimarina NCIMB 400]
 gi|122300991|sp|Q088X1|Y331_SHEFN RecName: Full=UPF0761 membrane protein Sfri_0331
 gi|114332812|gb|ABI70194.1| tRNA-processing RNAse BN [Shewanella frigidimarina NCIMB 400]
          Length = 320

 Score =  145 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 44/273 (16%), Positives = 108/273 (39%), Gaps = 8/273 (2%)

Query: 4   YFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TV 62
           +F  ++  +    +   E+     A H++   LLS+ P +    ++       + +   +
Sbjct: 13  FFSGIWQFLLHLKQRLAEDQINIRAGHLAYVTLLSLVPMLAVTMSMLSAFPVFKGIRGNI 72

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
              ++  +       +   I + +A  +KG   +  +A  + +   + A+  +LN  +R+
Sbjct: 73  EGFIYNNFIPAAGDTVQVHINEFVANASKG-TFVGIIALVFVAIMLISAIDKALNNIWRI 131

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E RS+ ++  + +  + L  V +         +             L   ++       
Sbjct: 132 TEKRSYVVSFSMYWMVLTLGPVLIGASLVATSYVVSLEVVAGTELSGLVPWIV------E 185

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
              ++     ++ +++ +P  K   +  L G I   + +  G   F  Y+  F +Y  +Y
Sbjct: 186 RLPLIFSAASILLLYMVVPNKKVHFLHALLGAIVAAVLFEAGKKGFAFYVTQFPSYEAIY 245

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
             LA +    V++Y+  +  +LGAE+ A++  Y
Sbjct: 246 GALAVVPILFVWVYLSWMIVLLGAEITAALPEY 278


>gi|254245626|ref|ZP_04938947.1| Ribonuclease BN [Burkholderia cenocepacia PC184]
 gi|124870402|gb|EAY62118.1| Ribonuclease BN [Burkholderia cenocepacia PC184]
          Length = 453

 Score =  145 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 40/273 (14%), Positives = 97/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVI 63
              +  +   A     E+    +A  ++ + LL++ P +     L            ++ 
Sbjct: 19  LVTIKRLAQFAARRSAEDRIPQVAGSLTFTTLLALVPLLTVAFALFTAFPMFASFQISLQ 78

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     S   +  +  + N  +RV 
Sbjct: 79  GFLADHLMPAQFNIQIFKYLNQFASKAKGLTTAGLIVLVVTSVMTMMTIESAFNLIWRVR 138

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +           P+   +  ++    + 
Sbjct: 139 KPRPFAQRVLAYWALITLGPLLFGVSLSISSYLFTQSLAFTGAGPSTSMVEWLLALASLP 198

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +F  I++ +    F +Y+    TY+ +Y 
Sbjct: 199 LTVL----AFTLLYVYLPNCTVAWRDAVIGGLFAAIAFELAKRGFGYYVRRIPTYTAVYG 254

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     +LGA + +++    
Sbjct: 255 AFAALPVFLLWVYLSWFIALLGAMVASALPAIR 287


>gi|330816655|ref|YP_004360360.1| YihY family protein [Burkholderia gladioli BSR3]
 gi|327369048|gb|AEA60404.1| YihY family protein [Burkholderia gladioli BSR3]
          Length = 437

 Score =  145 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 41/273 (15%), Positives = 101/273 (36%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A +   E+    +A  ++ + +L+V P +     L         F  ++ 
Sbjct: 8   LVTIRRLARFAAKRGAEDRIPQVAGSLTFTTILAVVPLVTVAFALFTAFPMFSSFQSSLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   +  AKGL T   +     S   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQINNQIFKYLNQFSAKAKGLTTAGLIVLVVTSVMTMMTIESAFNVIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  + ++ LA +   I   +   +      +     A  ++  ++    + 
Sbjct: 128 KSRPFAQRVLAYWAFITLAPLLFGISLSISSYLFTKSLAIAGAPGATTSVEWLLTAASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP           G I   I++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAAVGGICAAIAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+  +  + GA + +++ +  
Sbjct: 244 AFAAVPLFLLWMYLSWLITLAGAMVASALPVIR 276


>gi|255527896|ref|ZP_05394741.1| ribonuclease BN [Clostridium carboxidivorans P7]
 gi|296184663|ref|ZP_06853074.1| YihY family protein [Clostridium carboxidivorans P7]
 gi|255508423|gb|EET84818.1| ribonuclease BN [Clostridium carboxidivorans P7]
 gi|296050445|gb|EFG89868.1| YihY family protein [Clostridium carboxidivorans P7]
          Length = 282

 Score =  145 bits (367), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 52/269 (19%), Positives = 120/269 (44%), Gaps = 2/269 (0%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
           I + +  F E+D  +++S ++ S + + FPF++F   + G+   +     V+  +    P
Sbjct: 9   IKNLMFRFNEDDVLSLSSQLAYSLIFAFFPFLIFLMTVLGYSSINS--QDVLAGLNRIIP 66

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
               + I + I++V+      L + S +   + +S+G   +   LN+AY  +E RS+   
Sbjct: 67  RSALELIKNTIIEVVDYKNPHLMSFSLIFTIWSASSGFNGVIKGLNKAYDELEHRSFLKV 126

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
           + I+    +   + +  M F+ V   +    +           ++    R    ++    
Sbjct: 127 QFIAVLCTIGLVIAIFTMIFLLVFGQIIGNSLALNLGFSEEFKIMWHIVRYIIIIVLTIF 186

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
            L  ++ + P  +     +  G IF  I  ++ ++ F  Y+  F  YS +Y  + +++  
Sbjct: 187 ILAALYHYTPCRRLTWREVSSGAIFATIGLILVSIGFAFYVNNFGNYSKIYGSIGAVIIL 246

Query: 252 LVFLYMLGVFFILGAELNASMIIYYWRKK 280
           L +L+++ +  ++G ELNA++      K+
Sbjct: 247 LTWLFLVSITVVMGGELNATLAFDREGKE 275


>gi|116689478|ref|YP_835101.1| putative ribonuclease BN [Burkholderia cenocepacia HI2424]
 gi|116647567|gb|ABK08208.1| tRNA-processing RNAse BN [Burkholderia cenocepacia HI2424]
          Length = 442

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 40/273 (14%), Positives = 97/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVI 63
              +  +   A     E+    +A  ++ + LL++ P +     L            ++ 
Sbjct: 8   LVTIKRLAQFAARRSAEDRIPQVAGSLTFTTLLALVPLLTVAFALFTAFPMFASFQISLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     S   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNIQIFKYLNQFASKAKGLTTAGLIVLVVTSVMTMMTIESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +           P+   +  ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSISSYLFTQSLAFTGAGPSTSMVEWLLALASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +F  I++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVIGGLFAAIAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     +LGA + +++    
Sbjct: 244 AFAALPVFLLWVYLSWFIALLGAMVASALPAIR 276


>gi|241889551|ref|ZP_04776849.1| ribonuclease BN [Gemella haemolysans ATCC 10379]
 gi|241863173|gb|EER67557.1| ribonuclease BN [Gemella haemolysans ATCC 10379]
          Length = 300

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 62/273 (22%), Positives = 125/273 (45%), Gaps = 2/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +   + +     + ++   +++++S   +LS+FP ++    L  +    Q    +++ + 
Sbjct: 21  IKKFVKEMYYRLMYDEISLLSANLSYYFILSLFPMLIVALALTPYFKIDQ--QFLLEKIQ 78

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P  +   + D I +VL      + T+  +   + +S+G+  + I+ N A+RV + R 
Sbjct: 79  NYAPGDLGNYLFDMISEVLNNKNNTIITVGIVFTLWSASSGIYGIIIAFNNAFRVRDGRI 138

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           W +T++IS     L  V + +   + V        +   F        +         +L
Sbjct: 139 WIVTKIISVILTALFLVGMFLALALIVFGKQLTYILFHKFNLDQGFYNLWSVINYTLPLL 198

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            +F   +F++   P  K K +SILPG +F  +SW + + LF +YI  FS+Y   Y  + +
Sbjct: 199 FIFFVFVFLYTMGPNLKLKAISILPGALFATLSWTIVSRLFGYYIDHFSSYIKTYGTIGA 258

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            M  +++LY+ G   I+GAE+NA    Y    +
Sbjct: 259 FMAFILWLYITGYILIIGAEINAIFHNYKVEHR 291


>gi|146283159|ref|YP_001173312.1| ribonuclease [Pseudomonas stutzeri A1501]
 gi|145571364|gb|ABP80470.1| probable ribonuclease [Pseudomonas stutzeri A1501]
          Length = 391

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 40/264 (15%), Positives = 95/264 (35%), Gaps = 9/264 (3%)

Query: 20  VEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV-PTVIDVVFGAWPEVIAKPI 78
           + + G   A+ ++ + L +V P +     +   + A + V   +   +F  +       I
Sbjct: 1   MADQGPQSAAALTYTTLFAVVPMMTVTFAMLSAIPAFKGVGEQIQFYIFNNFIPSTGATI 60

Query: 79  TDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGY 138
            + +L   +   + L           +   +  +  + N  +RV + R    + L+ +  
Sbjct: 61  QEYLLAFTSQARQ-LTWFGVGFLMATALMMLLTIEKAFNTIWRVRQPRRGVSSFLLYWAI 119

Query: 139 VLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHL 198
           + L  + L         I         +          +        +L        ++ 
Sbjct: 120 LSLGPLLLGAGFATSTYIASLSLISGPYALIG------VGTLIKVMPLLLSVAAFTLIYA 173

Query: 199 FLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYML 258
            +P  +  +   L G +FT + +     +F  Y+  F +Y  +Y   A++   L+++Y+ 
Sbjct: 174 AVPNTRVPLRHALVGGVFTAVLFEAAKQMFGVYVSYFPSYQLIYGAFAAVPLFLLWIYLS 233

Query: 259 GVFFILGAELNASM-IIYYWRKKP 281
            +  + GAEL   +     WR++P
Sbjct: 234 WMIVLFGAELVCGLSSSQQWRRRP 257


>gi|125974669|ref|YP_001038579.1| putative ribonuclease BN [Clostridium thermocellum ATCC 27405]
 gi|256004132|ref|ZP_05429116.1| ribonuclease BN [Clostridium thermocellum DSM 2360]
 gi|281418859|ref|ZP_06249878.1| ribonuclease BN [Clostridium thermocellum JW20]
 gi|125714894|gb|ABN53386.1| putative ribonuclease BN [Clostridium thermocellum ATCC 27405]
 gi|255991880|gb|EEU01978.1| ribonuclease BN [Clostridium thermocellum DSM 2360]
 gi|281407943|gb|EFB38202.1| ribonuclease BN [Clostridium thermocellum JW20]
 gi|316941794|gb|ADU75828.1| ribonuclease BN [Clostridium thermocellum DSM 1313]
          Length = 276

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 66/272 (24%), Positives = 132/272 (48%), Gaps = 2/272 (0%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
             + +II D      ++D  A+A+ ++   +L++FPF++F   L  +          ++ 
Sbjct: 7   LKLIEIIKDIYTRSRDDDVPALAAQLTYYFILALFPFLIFLITLLSYTPI--TGEEAMNF 64

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
                P +    + D + ++ A P +   +   +AA + SSNG++A+   +N+AY   E 
Sbjct: 65  FARILPPLAFNAVLDVVNEITASPRETFLSFGMIAALWASSNGMKAVIRGINKAYDQKET 124

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R +++ RLIS   V++ + T++    + +    A   +   F        +    R    
Sbjct: 125 RPFWMVRLISLVAVIILAFTVIFSLALLLFGETAEKELFYHFRFPNIYRGVCTTVRFLLP 184

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           ++ +F   I +++  P+ +  +  +LPG  F+ +SW++   LF+ YI  F+ +S MY  +
Sbjct: 185 VILMFCVFILLYMLTPSRRLSLKEVLPGSAFSALSWILVTTLFSLYINNFADFSKMYGSI 244

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
             I+  LV+LY + +  +LG ELNAS+     
Sbjct: 245 GGIIALLVWLYWISIIIMLGGELNASLAQKKE 276


>gi|311746051|ref|ZP_07719836.1| putative ribonuclease BN [Algoriphagus sp. PR1]
 gi|126576268|gb|EAZ80546.1| putative ribonuclease BN [Algoriphagus sp. PR1]
          Length = 327

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 55/279 (19%), Positives = 126/279 (45%), Gaps = 4/279 (1%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV---PTV 62
             V+D+    I+   ++D    A  ++ S  L++FP I+F  N+  +L     +     +
Sbjct: 30  KNVYDVGRIFIQQLQKDDIVERAGSVAFSFTLALFPLILFLLNIIPYLQDFIPIVTTQNI 89

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
           +  +    P  +       I+ +++ P + L ++    A + S+ GV ++  S N  Y+ 
Sbjct: 90  LTFIQEMLPGELYAQAETTIMDIVSRPRQSLISLGFFFALFSSTQGVVSMMNSFNSVYQT 149

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E R ++ TR I+   V +  +T+   S V +   + +  + +      + ++ +++   
Sbjct: 150 KENRGFFQTRAIAASIVFILVLTIFAASAVMIIGGVIIRRLDELQLFNSDFMIFLFSTLK 209

Query: 183 YATMLALF-IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
           +  +L +F I   F+  F PA   K      G     +   +G   FT Y+  F++Y+ +
Sbjct: 210 FMVLLFMFYITTAFIFRFAPAVHDKWRFFSTGARLGGLLITLGFYGFTFYLNNFASYNKL 269

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           Y  + +++  +++L +  +  ++  E+N S+ +    KK
Sbjct: 270 YGSIGTLIALMLWLLITSLIVLVCFEVNVSLDLVEEDKK 308


>gi|154252348|ref|YP_001413172.1| putative ribonuclease BN [Parvibaculum lavamentivorans DS-1]
 gi|154156298|gb|ABS63515.1| putative ribonuclease BN [Parvibaculum lavamentivorans DS-1]
          Length = 322

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 62/275 (22%), Positives = 124/275 (45%), Gaps = 8/275 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
             D+         E+    +A+ +S   LL++FP +    ++ GF+   + +   I  + 
Sbjct: 27  WRDVALRVWAKINEDSVMLVAAGVSFYILLALFPALAAFVSIYGFVADPKTIADHIAFLG 86

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLNRAYRVVE 124
           G  P    + I  ++  +L      L     L    A + ++N V+AL  ++N AY   E
Sbjct: 87  GFLPTDGLELIRAQLDGLLRQKPNSLGLGFLLGLGVALWSANNSVKALFEAMNVAYEEEE 146

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            RS+    L+SF + L A    V+       +P ALA +R           +I  GR   
Sbjct: 147 KRSFVKRHLVSFSFTLGAIAIGVLFLLTVGIVPAALAVLR----IESWAETLIRLGRWPV 202

Query: 185 TMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            ++A+ I +  ++ + P+   +K+  +  G     + W+  +V F++Y+  F+ Y+  Y 
Sbjct: 203 MLIAVGIAISLIYRYGPSREHAKLRWLSWGAALATLVWIAASVGFSYYLENFANYNATYG 262

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            L +++  +++ ++  +  ++GAE+NA M     R
Sbjct: 263 ALGAVIGLMMWTWISVMIILIGAEINAEMEHQTAR 297


>gi|88812085|ref|ZP_01127337.1| Ribonuclease BN [Nitrococcus mobilis Nb-231]
 gi|88790589|gb|EAR21704.1| Ribonuclease BN [Nitrococcus mobilis Nb-231]
          Length = 331

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 56/275 (20%), Positives = 110/275 (40%), Gaps = 8/275 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
                DI     +     +   +A+ ++  ALLS+FP +V   +L G +     V     
Sbjct: 28  LNGWRDIALRLKDDITNHNISIIAAGVAFYALLSIFPALVAIVSLYGLVANPADVQQQFT 87

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYR 121
              G  PE     I+ ++ ++ A     +        L A + ++ G +A  ++LN  Y 
Sbjct: 88  HYGGILPEEAQLLISQQLQRITASATSAMSAGVISGVLFAVWSATRGTKAFMLALNIVYN 147

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             E R +     I+        + +V+   + V +P+ L+ +       G L  ++    
Sbjct: 148 EKEKRGFLQFNKIALMITFGMIMLVVLALGLIVTLPILLSILN----LPGALSTVLSFFP 203

Query: 182 IYATMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                      L  +  + P+  + +   +  G I   + WV+ ++LF+ Y+  F  Y+ 
Sbjct: 204 WLLLSGCFVFWLAMLFRYGPSRSEPQWNWVSVGSIAATVLWVITSMLFSFYVGNFGKYAN 263

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            Y  + +I+  L++ Y+     + GAELNA M   
Sbjct: 264 TYGSVGAIIILLLWFYLTAFVILFGAELNAQMEHQ 298


>gi|78066072|ref|YP_368841.1| ribonuclease BN [Burkholderia sp. 383]
 gi|77966817|gb|ABB08197.1| tRNA-processing RNAse BN [Burkholderia sp. 383]
          Length = 443

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 38/273 (13%), Positives = 97/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVI 63
              +  +   A     E+    +A  ++ + +L++ P +     L            ++ 
Sbjct: 8   LDTIKRLAQFAARRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQISLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     S   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNIQIFKYLNQFASKAKGLTTAGLIVLVVTSVMTMMTIESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +           P+   +  ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSISSYLFTQSLAFTGAAPSTSIVEWLLALVSLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +F  +++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVIGGLFAAVAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     +LGA + +++    
Sbjct: 244 AFAALPVFLLWVYLSWFIALLGAMVASALPAIR 276


>gi|91794795|ref|YP_564446.1| ribonuclease BN [Shewanella denitrificans OS217]
 gi|123356418|sp|Q12IK3|Y3448_SHEDO RecName: Full=UPF0761 membrane protein Sden_3448
 gi|91716797|gb|ABE56723.1| tRNA-processing RNAse BN [Shewanella denitrificans OS217]
          Length = 313

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 47/274 (17%), Positives = 106/274 (38%), Gaps = 6/274 (2%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R ++  V+  I       +++     A H++   LLS+ P I    ++       + +  
Sbjct: 11  RYFYISVWRFILHLKARLIDDQINIRAGHLAYVTLLSLVPMIAVTMSMLSAFPVFKGIRV 70

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
            I+ +  ++    A       +      A     +  +A    +   + A+  +LN  +R
Sbjct: 71  NIESLVYSYFLPAAGDSAQVYINEFVNNASKGTFVGIIALLVVAILLISAIDKALNNIWR 130

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             E RS  ++  + +  + L  V +         +     + +     L   L+      
Sbjct: 131 TTEKRSLVVSFSMYWMVLTLGPVLMGSSLVATSYVVSLELFSQSELSGLLPWLV------ 184

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
               ML     ++ +++ +P  K +    L G +   + +  G   F +Y+  F +Y  +
Sbjct: 185 ERLPMLFSVASILLLYMVVPTQKVRFFHALLGAVVAALLFEAGKRAFAYYVTQFPSYEAI 244

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           Y  LA+I    V++Y+  +  ++GAE+ A++  Y
Sbjct: 245 YGALATIPILFVWVYLSWMIVLVGAEITAALPEY 278


>gi|81429127|ref|YP_396128.1| putative ribonuclease [Lactobacillus sakei subsp. sakei 23K]
 gi|78610770|emb|CAI55821.1| Putative ribonuclease [Lactobacillus sakei subsp. sakei 23K]
          Length = 312

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 75/268 (27%), Positives = 128/268 (47%), Gaps = 2/268 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
            +   I   I    E +    A  I+  ALLS FP ++   N+  +      V +V D V
Sbjct: 21  KLIAFIKLMIRRSSEANISDNAKIIAYYALLSFFPLLIVIGNILPYFQLD--VLSVADYV 78

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
             A P  I   I   +  +L     GL ++  L   + +S G+ AL+IS+NRAYRV ++ 
Sbjct: 79  KSAVPPTIFNRIMPILQSLLNKRNSGLLSVGILGTLWAASKGINALKISINRAYRVDKIH 138

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           ++ + RLIS G  L+  + LV +  VF      L ++   F    + + +    +   T 
Sbjct: 139 NFILKRLISLGTTLVLLLLLVSLIVVFTFGQQFLEFITPIFKIPEDYINVFGQLKWPITS 198

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           + LF+ LIFV+ F+P  K ++ S+LPG   T + W++ A  F+ Y+  F T    Y  + 
Sbjct: 199 IVLFVILIFVYFFVPNVKMQLRSVLPGAFLTTVGWLILAQAFSLYMRYFGTSWNSYGTIG 258

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMII 274
           + +  L++L    +  + GA +N ++  
Sbjct: 259 AFIILLLWLNYSAMVLMFGAVVNVAIEE 286


>gi|197116978|ref|YP_002137405.1| membrane-bound transcriptional regulator/ribonuclease BN-like
           protein [Geobacter bemidjiensis Bem]
 gi|197086338|gb|ACH37609.1| membrane-bound transcriptional regulator, ribonuclease BN-related
           protein [Geobacter bemidjiensis Bem]
          Length = 446

 Score =  145 bits (366), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 38/270 (14%), Positives = 104/270 (38%), Gaps = 5/270 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +     +   +     +F+  +    A+ +S + +LS+ P +    ++   LGA      
Sbjct: 27  KGRMVRLLQFLSFTFSNFMANNSLLRATALSFTTVLSLVPLLALAFSVLKGLGAQN---R 83

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           +  ++         + +   +  +       +  I   A  + + + + ++  + N  + 
Sbjct: 84  LAPLILKEVTAGSEEVVNRVVSYIGNTNMGSVGAIGLAALLFTAISMLGSIEEAFNVVWG 143

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E RS Y         ++ A + L+  + +   +     ++  +      L  +     
Sbjct: 144 VQETRSLYRKFSDYLSVLISAPLLLLAATSITTTLQS--KWLIGWLMERTYLGDLFLFML 201

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                L++++ +  ++ F+P  + +  S L G +     W      + H+ V    Y+ +
Sbjct: 202 GLTPYLSVWVAIFLLYTFIPNTRVRYTSALIGAVLAGTLWQFAQWAYIHFQVGAGNYNAI 261

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNAS 271
           Y  LA++   +V++Y+  +  + G E+ A+
Sbjct: 262 YGTLAALPILMVWIYVSWIIVLFGMEVVAA 291


>gi|329767146|ref|ZP_08258674.1| hypothetical protein HMPREF0428_00371 [Gemella haemolysans M341]
 gi|328837871|gb|EGF87496.1| hypothetical protein HMPREF0428_00371 [Gemella haemolysans M341]
          Length = 300

 Score =  145 bits (366), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 65/273 (23%), Positives = 127/273 (46%), Gaps = 2/273 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +   + +     + ++   +++++S   +LS+FP ++    L  +    Q    +++ + 
Sbjct: 21  IKKFVKEMYYRLMYDEISLLSANLSYYFILSLFPMLIVALALTPYFKIDQ--QFLLERIQ 78

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P  +   + D I +VL      + T+  +   + +S+G+  + I+ N A+RV + R 
Sbjct: 79  NFAPGDLGNYLFDMISEVLNNKNNTIITVGIVFTLWSASSGIYGIIIAFNNAFRVRDGRI 138

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           W +T+LIS     L  V + ++  + V        +   F        +         +L
Sbjct: 139 WIVTKLISVVITALFLVGMFVVLALVVFGKQLTYLLFHKFNLDEGFYNLWSVLNYSFPIL 198

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
             FI  +F+++  P  K K +SILPG IF  +SW + + LF +YI  FS+Y   Y  + +
Sbjct: 199 FTFIVFVFLYIMGPNLKLKAISILPGSIFATVSWTLISRLFGYYIDHFSSYIKTYGTIGA 258

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            M  +++LY+ G   I+GAE+NA    Y    +
Sbjct: 259 FMAFIIWLYITGYILIIGAEINAIFHNYRVEHR 291


>gi|107022529|ref|YP_620856.1| ribonuclease BN [Burkholderia cenocepacia AU 1054]
 gi|105892718|gb|ABF75883.1| tRNA-processing RNAse BN [Burkholderia cenocepacia AU 1054]
          Length = 442

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 40/273 (14%), Positives = 97/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVI 63
              +  +   A     E+    +A  ++ + LL++ P +     L            ++ 
Sbjct: 8   LVTIKRLAQFAARRSAEDRIPQVAGSLTFTTLLALVPLLTVAFALFTAFPMFASFQISLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     S   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNIQIFKYLNQFASRAKGLTTAGLIVLVVTSVMTMMTIESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +           P+   +  ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSISSYLFTQSLAFTGAGPSTSMVEWLLALASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +F  I++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVIGGLFAAIAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     +LGA + +++    
Sbjct: 244 AFAALPVFLLWVYLSWFIALLGAMVASALPAIR 276


>gi|237746063|ref|ZP_04576543.1| ribonuclease BN transmembrane protein [Oxalobacter formigenes
           HOxBLS]
 gi|229377414|gb|EEO27505.1| ribonuclease BN transmembrane protein [Oxalobacter formigenes
           HOxBLS]
          Length = 433

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 49/271 (18%), Positives = 110/271 (40%), Gaps = 9/271 (3%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI--DVVFG 68
           I+    E   E +   +A +IS + +LS+ P +     +         +   +      G
Sbjct: 29  ILRYCGERLKENNLTDVAGNISFTVILSLVPMLAIVLAVFTTFPEFGTLQDTLETYFAQG 88

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
             P+ IA+ I + + +  +  A  +  +  LA  + + + +  +  + +R + ++  R  
Sbjct: 89  MIPDNIARTILNYLGEFASNAAN-VSIVGGLALLFTTLSTISTIESAFDRIWHIMNPRPL 147

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +   ++     +LA V L I  ++   + L+   +  + P L  +   +           
Sbjct: 148 WKRVILYIAIAVLAPVLLGISIYLTSHLVLSEHGLIGWLPFLNGVSAPLIAIIW------ 201

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
             I    ++  LP           G +F+ +S+ +   LF  +IV FS+Y  +Y  LA+ 
Sbjct: 202 TAIAFTLLYRILPNRLVLWKDAAAGGLFSAVSFEIAIRLFAFFIVNFSSYERIYGALAAF 261

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
              +++LY+  +  +LGA + A +      +
Sbjct: 262 PIFMMWLYISSLIMLLGAMVAALLPEIRNGR 292


>gi|229543009|ref|ZP_04432069.1| ribonuclease BN [Bacillus coagulans 36D1]
 gi|229327429|gb|EEN93104.1| ribonuclease BN [Bacillus coagulans 36D1]
          Length = 280

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 73/266 (27%), Positives = 127/266 (47%), Gaps = 2/266 (0%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
           I   +E+    D   MA+ +S   LLS+FP ++F   L  +L        V+++V    P
Sbjct: 15  IAALVENSKRNDITGMAAQLSYFFLLSLFPLLIFLFTLLPYLPIKS--DDVLNMVRHFAP 72

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
               K I   + +VL     GL +   +A  + +SNG+ A+  +LNRAY+V E R   + 
Sbjct: 73  SQSFKLIETTLKEVLTNRHGGLLSFGMIATLWSASNGMNAVIKALNRAYKVEESRPPVMQ 132

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
           RL+S    L   +  + +  + V     + YV  +F    +L  +I   R   T + LFI
Sbjct: 133 RLMSVMLTLGMIIVFIAVILIPVFGEQLIHYVFSYFGLPNDLKNMINILRWVLTPVLLFI 192

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
               ++ F P  K   ++++PG IF  + W+V ++  + Y+  F  Y+  Y  L  ++  
Sbjct: 193 VFALLYFFAPNEKFGCLTVVPGAIFATVGWIVASLALSFYVSHFGNYNATYGSLGGMIIM 252

Query: 252 LVFLYMLGVFFILGAELNASMIIYYW 277
           +++ Y+ G+  I G ELNA +   + 
Sbjct: 253 MLWFYISGIILIFGGELNAVLNDKHK 278


>gi|312795954|ref|YP_004028876.1| ribonuclease BN [Burkholderia rhizoxinica HKI 454]
 gi|312167729|emb|CBW74732.1| Ribonuclease BN (EC 3.1.-.-) [Burkholderia rhizoxinica HKI 454]
          Length = 469

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 43/287 (14%), Positives = 96/287 (33%), Gaps = 12/287 (4%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +         E+    +A  ++ + +LS+ P +     L         F  ++ 
Sbjct: 28  LDALKRLARFVATRSAEDRIPQVAGSLTFTTVLSLVPLVTVAFALFTAFPIFASFQQSLQ 87

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T+  +     S   +  +  + N  +RV 
Sbjct: 88  GFLADHLMPAQINSQIFKYLNQFAEKAKGLTTVGMITLVVTSVMTMMIVESAFNTIWRVR 147

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAI-----------PLALAYVRKFFPALGN 172
           + R      L+ +  + L  + + +   V   +            +A A       A   
Sbjct: 148 KSRPLAQRILVYWAVITLGPLLIGVSLSVSSYLLTHSMLASTVANVAGAASAASGAASRA 207

Query: 173 LLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYI 232
           +          A +    +     +++LP  +      L G +   I++ +    F  YI
Sbjct: 208 MPAFAEWALTGAVLTLSVLAFTLSYVYLPNCRVAWRDALVGGLCAAIAFELAKRGFGLYI 267

Query: 233 VTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
               TY+ +Y   A+I   L+++Y+  +  + GA + +++       
Sbjct: 268 RRIPTYTAVYGAFATIPIFLLWVYLSWLITLFGAMVTSALPEIRLGH 314


>gi|218130143|ref|ZP_03458947.1| hypothetical protein BACEGG_01730 [Bacteroides eggerthii DSM 20697]
 gi|217987647|gb|EEC53975.1| hypothetical protein BACEGG_01730 [Bacteroides eggerthii DSM 20697]
          Length = 439

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 51/273 (18%), Positives = 98/273 (35%), Gaps = 4/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
              +   IY  I  F ++     AS ++ S LL++ P +     +A   G    + + I 
Sbjct: 31  LYNIIKTIYLCINRFTKDRLVNKASALTYSTLLAIVPILAIVFAIARGFGFDNLMESQIV 90

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
             FG   E            +    +     I  +   +   N +  + I+ NR ++V +
Sbjct: 91  KGFGGPSETTEVIFQFVNSYLSQTKSGIFIGIGLIMLLWTVLNLINNMEITFNRIWQVKK 150

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            RS Y      F  +LL  + LV+   + + +   L  V         L  I        
Sbjct: 151 ARSMYRKITDYFSMLLLIPLLLVVSGGLSIFMSTMLKNVAD----FTLLAPIGKFLIRLI 206

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
             +  +     +++F+P  K K+   L   + T  +      L+    +  S Y+ +Y  
Sbjct: 207 PFVLTWFMFTGLYVFMPNTKVKLKHALISGVLTGTAHQAFQFLYISSQLWVSRYNAIYGS 266

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
            A++   L++L +     + GAEL  +      
Sbjct: 267 FAALPMFLLWLQISWTICLFGAELTYAGQNIRN 299


>gi|317476636|ref|ZP_07935881.1| YihY family protein [Bacteroides eggerthii 1_2_48FAA]
 gi|316907232|gb|EFV28941.1| YihY family protein [Bacteroides eggerthii 1_2_48FAA]
          Length = 439

 Score =  145 bits (365), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 50/273 (18%), Positives = 97/273 (35%), Gaps = 4/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
              +   IY  I  F ++     AS ++ S LL++ P +     +A   G    + + I 
Sbjct: 31  LYNIIKTIYLCINRFTKDRLVNKASALTYSTLLAIVPILAIVFAIARGFGFDNLMESQIV 90

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
             FG   E            +    +     I  +   +   N +  + I+ NR ++V +
Sbjct: 91  KGFGGPSETTEVIFQFVNSYLSQTKSGIFIGIGLIMLLWTVLNLINNMEITFNRIWQVKK 150

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            RS Y      F  +LL  + LV+   + + +   L  V         L  I        
Sbjct: 151 ARSMYRKITDYFSMLLLIPLLLVVSGGLSIFMSTMLKNVAD----FTLLAPIGKFLIRLI 206

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
             +  +     +++F+P  K K+   L   +    +      L+    +  S Y+ +Y  
Sbjct: 207 PFVLTWFMFTGLYVFMPNTKVKLKHALISGVLAGTAHQAFQFLYISSQLWVSRYNAIYGS 266

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
            A++   L++L +     + GAEL  +      
Sbjct: 267 FAALPMFLLWLQISWTICLFGAELTYAGQNIRN 299


>gi|307303467|ref|ZP_07583221.1| ribonuclease BN [Sinorhizobium meliloti BL225C]
 gi|306902858|gb|EFN33450.1| ribonuclease BN [Sinorhizobium meliloti BL225C]
          Length = 330

 Score =  145 bits (365), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 56/270 (20%), Positives = 119/270 (44%), Gaps = 8/270 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D+ +       EE    +A+ +S   LLS+FP +    ++ G +     + T + ++   
Sbjct: 36  DVFWRVFSEIGEERVMLIAAGVSFYLLLSLFPALGALVSIYGLVADPSEIGTHVGILQAL 95

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLNRAYRVVEMR 126
            P      I D++  +       L     +    + + ++NG+ A   ++N AY   E R
Sbjct: 96  LPADSYGLIMDQLETLTTQKPSTLGIGFFVSLSISLWLAANGIAATFDAMNVAYGEREKR 155

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            +    L+   +   A +  V +      +P  LAYV         + L+    R  A +
Sbjct: 156 GFLSRTLLCLAFTFAALLFAVALIAAIGVVPAVLAYV----WVDRWVELVTRAARWPAVL 211

Query: 187 LALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           L +  G I ++ F P+  ++K+  +  G +F+ + W+  + LF++Y+  F+ Y+  Y  L
Sbjct: 212 LLVTFGTILIYRFGPSRERAKLRWLNWGAVFSTLFWLAASWLFSYYLEHFANYNATYGAL 271

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            ++   + ++++  +  I+GA +NA +   
Sbjct: 272 GALAGLMTWVWISVMILIIGALINAELEHQ 301


>gi|254502756|ref|ZP_05114907.1| YihY family protein [Labrenzia alexandrii DFL-11]
 gi|222438827|gb|EEE45506.1| YihY family protein [Labrenzia alexandrii DFL-11]
          Length = 294

 Score =  145 bits (365), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 118/273 (43%), Positives = 163/273 (59%)

Query: 4   YFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI 63
           +      ++ DAI HF  +DG+AMASH++LS LL++FP ++F A+LAGF G      TV 
Sbjct: 9   FAKASLAVLKDAIGHFSRDDGFAMASHVALSGLLAIFPLLIFIASLAGFFGMVGAADTVS 68

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
           ++VF AWP+ +A P+  EI  VL VP   L T  A+AA +F+SNGVEALR +LNRAYR +
Sbjct: 69  ELVFDAWPKTVAAPVVREIENVLTVPRSDLLTFGAVAALWFASNGVEALRTALNRAYRQI 128

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E RS+ + R+ S   V+L +V L+  +F+ V  PL +  +R F P +   LL I   R  
Sbjct: 129 EKRSFILLRIQSLALVILGAVILLAYTFLVVLAPLGIEALRGFVPQVEPFLLSINIARYT 188

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
                L +GL   H  LP+ K     I PGVI T + W+V    F  Y+  F+ Y + Y 
Sbjct: 189 LAGSLLIVGLFMTHWLLPSGKRSFSDIWPGVIATLLLWIVSGSAFGAYLARFANYVSTYG 248

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           GLA IMT L+FLY+  + FILG ELNA++    
Sbjct: 249 GLAGIMTALIFLYICSLAFILGGELNAAIARQR 281


>gi|152987671|ref|YP_001349907.1| ribonuclease [Pseudomonas aeruginosa PA7]
 gi|166918690|sp|A6VA22|Y4558_PSEA7 RecName: Full=UPF0761 membrane protein PSPA7_4558
 gi|150962829|gb|ABR84854.1| probable ribonuclease [Pseudomonas aeruginosa PA7]
          Length = 411

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 43/269 (15%), Positives = 95/269 (35%), Gaps = 8/269 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MRE+F    +        FV +     A+ ++ + L +V P +    ++   + A   + 
Sbjct: 1   MREHFNDGIEFARFLAHRFVTDKAPNSAAALTYTTLFAVVPMMTVMFSMLSLIPAFHGMG 60

Query: 61  T-VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +   +F  +     + +   +       A+ L  +  +  A  +   +  +  + N  
Sbjct: 61  ESIQTFIFRNFVPSAGEAVETYLKSF-TTQARHLTWVGVVFLAVTAFTMLVTIEKAFNEI 119

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +RV + R      L+ +  + L  + L     V   I               + L     
Sbjct: 120 WRVRQPRRGVGRFLLYWAILSLGPLLLGAGFAVTTYITSLS------LLHGPDALPGAET 173

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                 +         ++  +P A+  +   L G +FT + +     LF  Y+  F  Y 
Sbjct: 174 LLGLMPLAFSVAAFTLLYSAVPNARVPVRHALMGGMFTAVLFEAAKTLFGLYVSLFPGYQ 233

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAEL 268
            +Y   A++   L+++Y+  +  + GA L
Sbjct: 234 LIYGAFATVPIFLLWIYLSWMIVLFGAVL 262


>gi|134295525|ref|YP_001119260.1| putative ribonuclease BN [Burkholderia vietnamiensis G4]
 gi|134138682|gb|ABO54425.1| tRNA-processing RNAse BN [Burkholderia vietnamiensis G4]
          Length = 443

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 38/273 (13%), Positives = 97/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVI 63
              +  +   A     E+    +A  ++ + +L++ P +     L            ++ 
Sbjct: 8   LDTLKRLAQFAARRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQISLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     S   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNVQIFKYLNQFAAKAKGLTTAGLIVLVVTSVMTMMTIESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +           P+   +  ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSLSSYLFTQSLAFTGAAPSTSIIEWLLALASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +F  +++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVIGGLFAAVAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     +LGA + +++    
Sbjct: 244 AFAALPVFLLWVYLSWFIALLGAMVASALPAIR 276


>gi|329960789|ref|ZP_08299095.1| YihY family protein [Bacteroides fluxus YIT 12057]
 gi|328532390|gb|EGF59191.1| YihY family protein [Bacteroides fluxus YIT 12057]
          Length = 439

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 50/270 (18%), Positives = 96/270 (35%), Gaps = 4/270 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +   IY  I  F ++     AS ++ S LL++ P +     +A   G    +   I   F
Sbjct: 34  IIKTIYLCINRFTKDRIVNKASALTYSTLLAIVPILAIVFAIARGFGFDNLMENQIISGF 93

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
           G   E     +      +    +     +  +   +   N +  + I+ NR ++V + RS
Sbjct: 94  GGPTETTTVILQFVNSYLSQTKSGIFIGVGLVMLLWSVLNLINNMEITFNRIWQVKKARS 153

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            Y      F  +LL  + LV+   + + +   L  V         L  I           
Sbjct: 154 MYRKITDYFSMLLLIPILLVLSGGISIFMSTMLKNVED----FTLLAPIGKFLVRLIPFA 209

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
             +     +++F+P  K K+   L   I    +      L+    +  S Y+ +Y   A+
Sbjct: 210 LTWFMFTGLYVFMPNTKVKLKHALISGILAGTAHQAFQFLYISSQLWVSRYNAIYGSFAA 269

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           +   L++L +     + GAEL  +      
Sbjct: 270 LPMFLLWLQISWTICLFGAELTYAGQNIRN 299


>gi|212633182|ref|YP_002309707.1| ribonuclease BN [Shewanella piezotolerans WP3]
 gi|212554666|gb|ACJ27120.1| Ribonuclease BN [Shewanella piezotolerans WP3]
          Length = 308

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 49/276 (17%), Positives = 103/276 (37%), Gaps = 8/276 (2%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVID 64
             ++      +  F E+     A H++   LLS+ P +    ++         +   +  
Sbjct: 2   WSIWAFFLHLLRRFKEDQVNIKAGHLAYVTLLSLVPIVAVMFSMLSAFPVFAGIRGQLEG 61

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
            V+  +       +   I + +A  +KG  T+   A    +   + A+  SLN  +R  E
Sbjct: 62  FVYDNFLPAAGDTVQIYINEFVANASKG-TTVGIAALVVVALMLISAIDKSLNSIWRTKE 120

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R   ++  + +  + L  V +         +                L  ++       
Sbjct: 121 KRQVAVSFSMYWMVLTLGPVLVGASLVATSYLVSL------KLFNDSELSGVVPLIIERL 174

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
            M+      + +++ +P  K K    L G I   + + +G   F  Y+  F +Y  +Y  
Sbjct: 175 PMMFSVAAFLLLYMVVPNKKVKFFHALLGAIVAAMLFELGKKGFAFYVTQFPSYEAIYGA 234

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           LA I    V++Y+  +  ++GAE+ A+M  Y   ++
Sbjct: 235 LAVIPILFVWVYVSWIIVLVGAEITAAMPEYLRERQ 270


>gi|269929219|ref|YP_003321540.1| ribonuclease BN [Sphaerobacter thermophilus DSM 20745]
 gi|269788576|gb|ACZ40718.1| ribonuclease BN [Sphaerobacter thermophilus DSM 20745]
          Length = 369

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 58/282 (20%), Positives = 120/282 (42%), Gaps = 4/282 (1%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH---Q 57
           M+        +  + +  F ++D   MA+  +   + S+ P ++F A L+G +  +    
Sbjct: 1   MQLREVDFKAVGKEVVREFSDDDVTGMAAQAAYQIIFSLPPLLIFFAALSGLVARYTGVD 60

Query: 58  FVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLN 117
               ++ +     P  +   +   +  +    + GL +   L A + +S  +  +    N
Sbjct: 61  VFGQLLSLAEEGLPASVFDTVEIILGGIQEQSSAGLLSFGFLLAIWSASGALNTMISLFN 120

Query: 118 RAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLII 177
           RAY V + R +   RL++ G  +  +V ++    +FV       ++ +F        L+ 
Sbjct: 121 RAYDVDDTRGFIKKRLLAIGLTIGLAVLVIGAFVLFVFGQRIGLWIAEFAGLGEAFTLVW 180

Query: 178 WNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
              R  A ++ + + L  ++   PA +     I PG +F  + W++    F+ Y+  FS 
Sbjct: 181 NIVRWPAIVIFMMLALAILYWAGPAIEQTFRWISPGAVFATLLWLLATFGFSLYL-RFSN 239

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             + Y  L  ++  L FLY+  +  +LG E+NA +   Y  K
Sbjct: 240 PGSAYGILGGLVVLLFFLYLSSIVLLLGCEVNAVIDKRYDPK 281


>gi|206559830|ref|YP_002230594.1| putative tRNA processing exoribonuclease [Burkholderia cenocepacia
           J2315]
 gi|198035871|emb|CAR51762.1| putative tRNA processing exoribonuclease [Burkholderia cenocepacia
           J2315]
          Length = 439

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 39/273 (14%), Positives = 97/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVI 63
              +  +   A     E+    +A  ++ + +L++ P +     L            ++ 
Sbjct: 5   LDTIKRLAQFAARRSAEDRIPQVAGSLTFTTMLAIVPLVTVAFALFTAFPMFASFQISLQ 64

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     S   +  +  + N  +RV 
Sbjct: 65  GFLADHLMPAQFNIQIFKYLNQFASKAKGLTTAGLIVLVVTSVMTMMTIESAFNLIWRVR 124

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +           P+   +  ++    + 
Sbjct: 125 KPRPFAQRVLAYWALITLGPLLFGVSLSISSYLFTQSLAFTGAGPSTSIVEWLLALASLP 184

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +F  I++ +    F +Y+    TY+ +Y 
Sbjct: 185 LTVL----AFTLLYVYLPNCAVAWRDAVIGGLFAAIAFELAKRGFGYYVRRIPTYTAVYG 240

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     +LGA + +++    
Sbjct: 241 AFAALPVFLLWVYLSWFIALLGAMVASALPAIR 273


>gi|315193410|gb|EFU23807.1| hypothetical protein CGSSa00_04751 [Staphylococcus aureus subsp.
           aureus CGS00]
          Length = 380

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 65/270 (24%), Positives = 119/270 (44%), Gaps = 3/270 (1%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           + +   I    ++D   +A+ ++   +L+          L   L       + I  +   
Sbjct: 72  NFLSYLIYRIGKDDASGLAAQMTYHFVLA---MFPMLLFLLTLLPFFNIKQSQITNMLSN 128

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   +  I   I  +    + GL +I  + A + +SNG+ A+  S N AY V + R+  
Sbjct: 129 APAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYDVEDSRNGI 188

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           + +L+S  + ++  V  V+   +     +   ++         +  I    RI   ++ +
Sbjct: 189 VLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIRIVLPIIII 248

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           FI  I ++   P  K+K+ S+LPG +FT I W+ G+  F  YI  F  YS  Y  +A I+
Sbjct: 249 FIVFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKTYGSIAGII 308

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L++LY+     I+GAE+NA +      K
Sbjct: 309 ILLLWLYITSFIIIVGAEINAIIHQRSVIK 338


>gi|254520560|ref|ZP_05132616.1| YihY family protein [Clostridium sp. 7_2_43FAA]
 gi|226914309|gb|EEH99510.1| YihY family protein [Clostridium sp. 7_2_43FAA]
          Length = 280

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 63/275 (22%), Positives = 130/275 (47%), Gaps = 2/275 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +E    V D I   I     +D +A+ + ++   +L+ FPF++F   L GF   +     
Sbjct: 6   KENKRSVIDSIIYFIVKINNDDIFALGAQLAYYLILAFFPFLIFLLTLIGFSRLNSA--D 63

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           ++D +    P  +   +   +++++     GL   S + + + +S+G  A+   +N+AY 
Sbjct: 64  ILDGLRTILPNNVFTLVDTTVVEIVDTQNAGLLGASIVLSMWSASSGFRAVIKGVNKAYD 123

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           + E RS+     I+  + L  ++ +++   + V   +   Y+   FP    L  I    R
Sbjct: 124 IREHRSFIKRAFIAIFFTLALALIIMLTLAMLVFGEIIGKYLISVFPFQNILRNIWNISR 183

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
               +LA+      ++ + PA K     + PG I + + W+V ++ F++YI   + YS +
Sbjct: 184 YIVVILAMIWIFACIYRYTPARKIPWKEVFPGAIVSTLGWIVVSLAFSYYINNIANYSRL 243

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           Y  + ++   + +LY+  +  ILGAE+N+ + I  
Sbjct: 244 YGSVGAVFILMTWLYITSMILILGAEINSVLSIRK 278


>gi|83591770|ref|YP_425522.1| ribonuclease BN [Rhodospirillum rubrum ATCC 11170]
 gi|83574684|gb|ABC21235.1| Ribonuclease BN [Rhodospirillum rubrum ATCC 11170]
          Length = 313

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 50/275 (18%), Positives = 104/275 (37%), Gaps = 8/275 (2%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
           F +I         +    +A+ ++  +LL+ FP +V    L G     Q     I     
Sbjct: 28  FSVIRAVSRRSDRDHVGVLAAGVAFFSLLASFPALVTLITLYGLFTGPQEAVRQIAEAGV 87

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRVVEM 125
             P  +   + + + ++       L      S L + + +S G+ A+   ++ AY+V + 
Sbjct: 88  YLPRGVHDLLAEHLPRLAQASPGSLGLGAITSLLFSIWSASRGMGAMVDGVDIAYQVGDG 147

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R +    ++  G  L   V   I   + V +P     +    P    +   +   R    
Sbjct: 148 RGFLRKSILVVGLTLAGLVVSAIALPLIVGLPA----LFDRLPLPLEIRWALALARWPLL 203

Query: 186 MLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
              +   L  +  + P     +   + PG +     W++ +   + Y+   S+Y   Y  
Sbjct: 204 FALVLGALAVLFRYAPDRENPRWRWVTPGALAAATLWILASGGLSLYVGLVSSYDQTYGT 263

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           LA ++  +++LY+     +LGAE+NA +      +
Sbjct: 264 LAGVVVAMMWLYLASYAVLLGAEINAELEDRGMER 298


>gi|150397725|ref|YP_001328192.1| putative ribonuclease BN [Sinorhizobium medicae WSM419]
 gi|150029240|gb|ABR61357.1| putative ribonuclease BN [Sinorhizobium medicae WSM419]
          Length = 290

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 141/276 (51%), Positives = 195/276 (70%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV 62
               I++ +++DA+ HF E+DGWAMASH++LS+L++VFPF++FG  LA FLGA QF  T 
Sbjct: 2   PVIRIIWKVVFDALWHFSEDDGWAMASHVALSSLMAVFPFLIFGTALASFLGADQFAETA 61

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
           + ++F  WPE IAKP+ DE+++VL +P   L TIS LAAAYF+SNGVEALRI+LNRAYRV
Sbjct: 62  VHLIFDTWPESIAKPVADEVVRVLTIPRGSLLTISVLAAAYFASNGVEALRIALNRAYRV 121

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E RSWY+TRL S G+VL A + L  +S + VA+PLA+    ++FP L  ++  + +  +
Sbjct: 122 AESRSWYVTRLSSLGFVLGAVLILAALSLLLVAVPLAVRNADQWFPWLDTVMAAVDDWGL 181

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
             T+  L  GL+  HL+LP+    I+ +LPG+  T + W VG   F  YI  FS+Y+T Y
Sbjct: 182 TLTLAMLTAGLLVAHLWLPSGHRNIVDVLPGIFLTLVLWSVGGYAFASYIANFSSYATTY 241

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           AGLASIM  LVFLYMLG  FI+GAE+NA+++ Y  +
Sbjct: 242 AGLASIMVVLVFLYMLGAIFIIGAEINAAILKYKVK 277


>gi|325529541|gb|EGD06437.1| ribonuclease BN [Burkholderia sp. TJI49]
          Length = 438

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 38/273 (13%), Positives = 97/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVI 63
              +  +   A     E+    +A  ++ + +L++ P +     L            ++ 
Sbjct: 8   LDTLKRLAQFAARRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQISLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     S   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNIQIFKYLNQFAAKAKGLTTAGLIVLVVTSVMTMMTIESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +           P+   +  ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSLSSYLFTQSLAFTGAAPSTSIVEWLLTLASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +F  +++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVIGGLFAAVAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     +LGA + +++    
Sbjct: 244 AFAALPVFLLWMYLSWFIALLGAMVTSALPAIR 276


>gi|288559252|sp|A1SB50|Y3404_SHEAM RecName: Full=UPF0761 membrane protein Sama_3404
          Length = 323

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 45/276 (16%), Positives = 103/276 (37%), Gaps = 8/276 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           ++ +F  V+  +   +    E+     A H++   LLS+ P +    ++       Q + 
Sbjct: 10  IQSFFLGVWRFVLHLVSRLKEDQINVRAGHLTYVTLLSLVPMVAVTMSVLSAFPVFQGIR 69

Query: 61  -TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
            T+   V+          +   I + +   +KG   +        +   + A+  SLN  
Sbjct: 70  GTIETFVYENMIPAAGDTVQTYINEFVKNASKG-TAVGIGFLVVVAIMLISAIDKSLNAI 128

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +R  E R + +   + +  + L  V +     V   +               ++  ++  
Sbjct: 129 WRTKEKRRFMVAFSMYWMVLTLGPVLMGASIAVTSYLVSLKVLSEA------DVYGVVPM 182

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                 ++      + +++ +P  K K +  L G +   + +  G   F  Y+ TF +Y 
Sbjct: 183 LIEKLPLMFSVAAFLLLYMAVPNQKVKFLHALLGALVAALLFEAGKRGFALYVTTFPSYE 242

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            +Y  LA+I    V++Y+     + G  + A++  Y
Sbjct: 243 AIYGTLATIPILFVWVYLSWTIVLFGGVIAAALPEY 278


>gi|254780367|ref|YP_003064780.1| ribonuclease protein [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040044|gb|ACT56840.1| ribonuclease protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 281

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 281/281 (100%), Positives = 281/281 (100%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP
Sbjct: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY
Sbjct: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG
Sbjct: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST
Sbjct: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
           MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP
Sbjct: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281


>gi|118593797|ref|ZP_01551163.1| Ribonuclease BN [Stappia aggregata IAM 12614]
 gi|118433592|gb|EAV40257.1| Ribonuclease BN [Stappia aggregata IAM 12614]
          Length = 296

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 117/276 (42%), Positives = 162/276 (58%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R+   +++ ++ DAI HF  +DG+AMASH++LS LL++FP ++F A+LA FLG      T
Sbjct: 4   RQTVLVIYAVLKDAIGHFARDDGFAMASHVALSGLLAIFPLLIFIASLAAFLGMTGAADT 63

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           V +++F AWP  +A P+  EI  VL +    L T  A+AA +FSSNGVEALR +LNRAYR
Sbjct: 64  VSELLFDAWPRSVASPVVREIQNVLTIRRGDLVTFGAVAALWFSSNGVEALRTALNRAYR 123

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             E RS  + RL S G VLL +  L+  +F+ V  PLA+  ++ F P +   LL I   R
Sbjct: 124 QHETRSIVLLRLQSIGLVLLGASILLAYTFLVVLAPLAIEGLKVFVPQVETFLLSINVAR 183

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                  L IGL   H  LPA       + PGV  T   W++    F  Y+ +F+ Y + 
Sbjct: 184 YTLAGSLLIIGLFITHWLLPAGHRTFRDLWPGVFATLFMWIIAGSAFGAYLASFANYVST 243

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           Y GLA IMT L+FLY+  + FILG ELNA++     
Sbjct: 244 YGGLAGIMTALIFLYICALVFILGGELNAAISRQRR 279


>gi|148360703|ref|YP_001251910.1| ribonuclease BN [Legionella pneumophila str. Corby]
 gi|288559231|sp|A5IGR4|Y2650_LEGPC RecName: Full=UPF0761 membrane protein LPC_2650
 gi|148282476|gb|ABQ56564.1| ribonuclease BN [Legionella pneumophila str. Corby]
 gi|158512137|gb|ABW69098.1| ribonuclease BN [Legionella pneumophila]
          Length = 412

 Score =  144 bits (363), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 49/271 (18%), Positives = 112/271 (41%), Gaps = 11/271 (4%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVIDVVFG 68
             +   I+HF+++D   +AS ++ ++LL+V P +  G  +       Q     V + +F 
Sbjct: 16  RFVRFVIQHFIQDDCTYIASALAFTSLLAVVPLMSVGLAIFSSFPVFQGLAEPVQNFIFD 75

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            +     K +   + Q  +  +K L     +   + +   +  +  ++N+ +RV   R  
Sbjct: 76  NFVPATGKIVQSYLQQFTSQVSK-LSIWGVVFLIFTALLVMFTIERAMNKIWRVSSSRHG 134

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
               L+ +  + LA V L +       +           P         +    Y+    
Sbjct: 135 VSAFLLYWAIISLAPVLLGLSLAASSYLFSMPILADHRAP---------YTILHYSPFFL 185

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
             IG  F+++ +P    KI     G +   I +      F +Y++ ++TY  +Y   A++
Sbjct: 186 SLIGFTFLYVVVPNCPVKIRHAFWGGLVAAILFESAKHAFAYYLIRYNTYELLYGAFATV 245

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
               +++Y + +  +LGAE++ +  +++ R+
Sbjct: 246 PIFFIWVYWVWIITLLGAEISYAFSVHHQRR 276


>gi|110632679|ref|YP_672887.1| putative ribonuclease BN [Mesorhizobium sp. BNC1]
 gi|110283663|gb|ABG61722.1| putative ribonuclease BN [Chelativorans sp. BNC1]
          Length = 322

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 57/273 (20%), Positives = 121/273 (44%), Gaps = 8/273 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI +       E+    +A+ ++   LL++FP +    +L G +     V   I  + G 
Sbjct: 28  DIGWRVFREIGEDRITLIAAGVTFYLLLALFPALAAFVSLYGLVSDPVTVADHIAYLGGL 87

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFT---ISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P    + +  ++  +++  ++ L     I    A + ++NG++AL  ++N AY   E R
Sbjct: 88  LPPTAIEIVQQQLQALVSERSQSLGLGFLIGLAIALWSANNGIKALFEAMNVAYDETEKR 147

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            +    L+S  + L   V  +++      +P  LA +            +I   R    +
Sbjct: 148 GFIKLNLLSLSFTLATLVLGIMLIIAVGVVPAVLAIL----GLSPWAETLIAFARWPTLL 203

Query: 187 LALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           L    G++ ++ F P+  + K   +  G +   + W+  +V F++Y+  F+ Y   Y  L
Sbjct: 204 LVSMFGILMLYRFGPSRERPKWRWLSWGAVIATLVWLAASVAFSYYLQNFADYDATYGSL 263

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            +I+  +++ ++  V  I+GAE++A +     R
Sbjct: 264 GAIIGLMMWTWISVVVLIVGAEIDAEIEHQTAR 296


>gi|150376885|ref|YP_001313481.1| putative ribonuclease BN [Sinorhizobium medicae WSM419]
 gi|150031432|gb|ABR63548.1| putative ribonuclease BN [Sinorhizobium medicae WSM419]
          Length = 330

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 53/270 (19%), Positives = 119/270 (44%), Gaps = 8/270 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D+ +  +    EE    +A+ +S   LLS+FP +    ++ G +     + T + ++   
Sbjct: 36  DVFWRVVSEIAEERVVLIAAGVSFYLLLSLFPALGALVSIYGLVADPSEIGTHMGILQAL 95

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLNRAYRVVEMR 126
            P+     I D++  +       L     +    + + ++NG+ AL  ++N AY   E R
Sbjct: 96  LPQDSYGLIMDQLKTLTTQKPSTLGMGFFISLSISLWLAANGIAALFDAMNVAYGEREKR 155

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            +    ++   +   A +  V +      +P  LA           + L+    R  A +
Sbjct: 156 GFLFRTVLCIAFTFAALLFAVALIVAIGVVPAVLA----HLWVDRWVELVTRVARWPALL 211

Query: 187 LALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           L +  G + ++ F P+  ++K+  +  G +F+ + W   + LF++Y+  F+ Y+  Y  L
Sbjct: 212 LLVTFGTVLIYRFGPSRERAKLRWLNWGAVFSTLFWFAASWLFSYYLEHFANYNATYGAL 271

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            ++   + ++++  +  I+GA +NA +   
Sbjct: 272 GALAGLMTWVWISVMILIIGALINAELEHQ 301


>gi|313105837|ref|ZP_07792100.1| putative ribonuclease [Pseudomonas aeruginosa 39016]
 gi|310878602|gb|EFQ37196.1| putative ribonuclease [Pseudomonas aeruginosa 39016]
          Length = 411

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 43/269 (15%), Positives = 95/269 (35%), Gaps = 8/269 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MRE+F    +        FV +     A+ ++ + L +V P +    ++   + A   + 
Sbjct: 1   MREHFNDGVEFARFLAHRFVTDKAPNSAAALTYTTLFAVVPMMTVMFSMLSLIPAFHGMG 60

Query: 61  T-VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +   +F  +     + +   +       A+ L  +  +  A  +   +  +  + N  
Sbjct: 61  ESIQTFIFRNFVPSAGEAVETYLKSF-TTQARHLTWVGVVFLAVTAFTMLVTIEKAFNEI 119

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +RV + R      L+ +  + L  + L     V   I               + L     
Sbjct: 120 WRVRQPRRGVGRFLLYWAILSLGPLLLGAGFAVTTYITSLS------LLHGPDALPGAET 173

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                 +         ++  +P A+  +   L G +FT + +     LF  Y+  F  Y 
Sbjct: 174 LLGLMPLAFSVAAFTLLYSAVPNARVPVRHALMGGVFTAVLFEAAKTLFGLYVSLFPGYQ 233

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAEL 268
            +Y   A++   L+++Y+  +  + GA L
Sbjct: 234 LIYGAFATVPIFLLWIYLSWMIVLFGAVL 262


>gi|288559250|sp|A3QIW3|Y3545_SHELP RecName: Full=UPF0761 membrane protein Shew_3545
          Length = 305

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 46/280 (16%), Positives = 107/280 (38%), Gaps = 8/280 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +R     ++  +    +   E+     A H++   LLS+ P +    ++       + + 
Sbjct: 10  LRSIMLGIWQFMIHLKQRITEDQINMRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFKGIR 69

Query: 61  TVID-VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
           + I+  ++  +       +   I + +A  +KG   +   A    +   +  +  SLN  
Sbjct: 70  SHIETFIYENFIPSAGDSVQMYINEFVANASKG-TAVGIGALVVVAILLISNIDKSLNGI 128

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +R  E R   ++  + +  + L  V +         +     +         +L  ++  
Sbjct: 129 WRTTEKRPMVVSFSMYWMVLTLGPVLMGASLVATSYVVSLKLFSG------TDLSGVVPL 182

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                 M       + +++ +P  K K    L G I   + + +G   F  Y+  F  Y 
Sbjct: 183 LVERLPMFFSVATFLLIYMVVPNTKVKFFHALLGAIVAALLFELGKKGFALYLTEFPAYE 242

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            +Y  LA+I    +++Y+  +  ++GAE+ A+M  Y  ++
Sbjct: 243 AIYGALATIPILFMWVYLSWIIVLIGAEITAAMPEYLDKR 282


>gi|239994832|ref|ZP_04715356.1| ribonuclease BN [Alteromonas macleodii ATCC 27126]
          Length = 294

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 50/274 (18%), Positives = 104/274 (37%), Gaps = 8/274 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVIDVV 66
           V D+    I+   E++    A H++   LLS+ PFI+    +     A   V   +   V
Sbjct: 17  VRDLFSIFIKRCREDNITISAGHLAYVTLLSLVPFIMVTFTIMSAFPAFASVRSKLEHFV 76

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
           F  +    +  +   +   +   ++ +  I  L+    +   +  +  +LNR +R    R
Sbjct: 77  FSNFVPTASDVVHKYMTDFVGNASQ-MSAIGILSLLVVALMLISNVDKTLNRIWRTQSDR 135

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
               T  I +  + L  + +     V   +    A+  ++ P LG               
Sbjct: 136 PIVYTFAIYWMVITLGPMLIGSSVVVSSYLTGLAAFTEEYTPGLGTF------LLSLVPS 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
            A  +    +++ +P  +      L G I   I++ +    F  Y+  F +Y  +Y  LA
Sbjct: 190 GAAMLAFTILYMVVPNRRVFARHALVGAIVATIAFEITKSGFALYVTNFPSYELIYGALA 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            +    +++Y+  +  + GAE   S+   +  +K
Sbjct: 250 VVPILFLWVYLSWIIVLFGAEFTCSLGEAFENRK 283


>gi|300312602|ref|YP_003776694.1| ribonuclease BN transmembrane protein [Herbaspirillum seropedicae
           SmR1]
 gi|300075387|gb|ADJ64786.1| ribonuclease BN transmembrane protein [Herbaspirillum seropedicae
           SmR1]
          Length = 470

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 48/272 (17%), Positives = 103/272 (37%), Gaps = 9/272 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI--DVVF 67
           D++  A     E+    +A  ++ + +LS+ P +     L             +    V 
Sbjct: 21  DLLRFAGRRLREDRLPQVAGSLTFTTILSLVPMLTIALALFTAFPLFSTFRASLEAYFVE 80

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P+ +A  I   + Q  A  +  +  +  +     S   +  +    N+ +RV + R 
Sbjct: 81  NLMPKGVANTILGYLNQF-AAKSARISAVGGVVLILTSVLTMSTIESVFNQIWRVKKSRP 139

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
                L+ +  + L  + + +   V   +  A     K  P LG     +       +++
Sbjct: 140 LVQRVLVYWAIITLGPLLIGVSISVTSYLSTATGGAVKSLPWLGASFYTL------VSLM 193

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
              +    ++  +P         L G +   I   +   LF  YI+ F TY+ +Y  +A 
Sbjct: 194 FSTLAYTLLYSTVPNQTVDWRDALAGGLLAGIGLEIAKRLFAVYILKFPTYTMVYGTVAV 253

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           +   LV++YM+ +  + GA L A++ +  + +
Sbjct: 254 LPIFLVWIYMMWMITLFGALLTAALPVVRYER 285


>gi|312886962|ref|ZP_07746566.1| ribonuclease BN [Mucilaginibacter paludis DSM 18603]
 gi|311300274|gb|EFQ77339.1| ribonuclease BN [Mucilaginibacter paludis DSM 18603]
          Length = 329

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 58/267 (21%), Positives = 127/267 (47%), Gaps = 1/267 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           ++ +     +   +E     AS ++ + LL++FP  +F   L  ++    F  T+++++ 
Sbjct: 34  LYTVAIFFFQELKQESLANKASSLAYTFLLAIFPGTIFLFTLIPYIPIKSFQDTLLNIIE 93

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P          I  ++     GL +   L+A +F++NGV  L  + N++  +VE R+
Sbjct: 94  LILPSNAYAAFESTIEDIVKNQHGGLLSFGFLSAMFFATNGVHKLMRAFNKSSLIVETRT 153

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFP-ALGNLLLIIWNGRIYATM 186
           W   R I+    +L S +L +   +       +++++          + ++   R    +
Sbjct: 154 WLKRRWIALVLTMLISFSLFVAILIMTISQYIISFIQFQLNTGGKFWIYLVMISRWLIVI 213

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           +  F+ +  ++ + PA K +   + PG I      V+ ++ FT YI  FS+Y+ +Y  L 
Sbjct: 214 VLFFVTVSILYRYGPAHKRRWKFLSPGSILATCLAVLTSLGFTFYINHFSSYNKLYGSLG 273

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMI 273
           +++  +++LY+  +  ++G ELNAS+ 
Sbjct: 274 TLIVIMLWLYLNSLIILIGFELNASID 300


>gi|119945515|ref|YP_943195.1| putative ribonuclease BN [Psychromonas ingrahamii 37]
 gi|119864119|gb|ABM03596.1| putative ribonuclease BN [Psychromonas ingrahamii 37]
          Length = 442

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 54/269 (20%), Positives = 107/269 (39%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M+ +      II  AI  F E+     AS ++  +LLS+ P       +A   G  + + 
Sbjct: 27  MKLFGLRQLRIILLAIRGFAEDKCMLRASALTFFSLLSMVPVAAMAFGIAKGFGFDKKLE 86

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T++        EV+ K I      +       +  I  +   +     +  +  S N  +
Sbjct: 87  TLLFDNLQGQEEVVEKLIGFSQAMLENTQGGIIAGIGTVVLFWAVIKVLGQIEESFNEIW 146

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
            + + RS+          +L+  V L+I S   V I   +  + +    LG ++ +I   
Sbjct: 147 GIKKSRSFARKFSDYVSIMLICPVLLIISSSTTVIISSQVTLLVEKISFLGPIVPLIITS 206

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                   ++    F+++F+P  K    + L G I    ++ +   ++  + V    Y  
Sbjct: 207 LKILPYAVIWTVFTFIYIFIPNTKVNFKAGLLGGIIAGTTYQIVQWIYITFQVGVLKYGA 266

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELN 269
           +Y   A++   LV+L M  +  +LGAE++
Sbjct: 267 IYGSFAALPLFLVWLQMSWLIVLLGAEVS 295


>gi|107100407|ref|ZP_01364325.1| hypothetical protein PaerPA_01001432 [Pseudomonas aeruginosa PACS2]
 gi|254239302|ref|ZP_04932625.1| hypothetical protein PACG_05496 [Pseudomonas aeruginosa C3719]
 gi|254245235|ref|ZP_04938557.1| hypothetical protein PA2G_06126 [Pseudomonas aeruginosa 2192]
 gi|126171233|gb|EAZ56744.1| hypothetical protein PACG_05496 [Pseudomonas aeruginosa C3719]
 gi|126198613|gb|EAZ62676.1| hypothetical protein PA2G_06126 [Pseudomonas aeruginosa 2192]
          Length = 411

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 43/269 (15%), Positives = 95/269 (35%), Gaps = 8/269 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MRE+F    +        FV +     A+ ++ + L +V P +    ++   + A   + 
Sbjct: 1   MREHFNDGVEFARFLAHRFVTDKAPNSAAALTYTTLFAVVPMMTVMFSMLSLIPAFHGMG 60

Query: 61  T-VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +   +F  +     + +   +       A+ L  +  +  A  +   +  +  + N  
Sbjct: 61  ESIQTFIFRNFVPSAGEAVETYLKSF-TTQARHLTWVGVVFLAVTAFTMLVTIEKAFNEI 119

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +RV + R      L+ +  + L  + L     V   I               + L     
Sbjct: 120 WRVRQPRRGVGRFLLYWAILSLGPLLLGAGFAVTTYITSLS------LLHGPDALPGAET 173

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                 +         ++  +P A+  +   L G +FT + +     LF  Y+  F  Y 
Sbjct: 174 LLGLMPLAFSVAAFTLLYSAVPNARVPVRHALMGGVFTAVLFEAAKTLFGLYVSLFPGYQ 233

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAEL 268
            +Y   A++   L+++Y+  +  + GA L
Sbjct: 234 LIYGAFATVPIFLLWIYLSWMIVLFGAVL 262


>gi|296390694|ref|ZP_06880169.1| ribonuclease [Pseudomonas aeruginosa PAb1]
          Length = 411

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 43/269 (15%), Positives = 95/269 (35%), Gaps = 8/269 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MRE+F    +        FV +     A+ ++ + L +V P +    ++   + A   + 
Sbjct: 1   MREHFNDGVEFARFLAHRFVTDKAPNSAAALTYTTLFAVVPMMTVMFSMLSLIPAFHGMG 60

Query: 61  T-VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +   +F  +     + +   +       A+ L  +  +  A  +   +  +  + N  
Sbjct: 61  ESIQTFIFRNFVPSAGEAVETYLKSF-TTQARHLTWVGVVFLAVTAFTMLVTIEKAFNEI 119

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +RV + R      L+ +  + L  + L     V   I               + L     
Sbjct: 120 WRVRQPRRGVGRFLLYWAILSLGPLLLGAGFAVTTYITSLS------LLHGPDALPGAET 173

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                 +         ++  +P A+  +   L G +FT + +     LF  Y+  F  Y 
Sbjct: 174 LLGLMPLAFSVAAFTLLYSAVPNARVPVRHALMGGVFTAVLFEAAKTLFGLYVSLFPGYQ 233

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAEL 268
            +Y   A++   L+++Y+  +  + GA L
Sbjct: 234 LIYGAFATVPIFLLWIYLSWMIVLFGAVL 262


>gi|15615917|ref|NP_244221.1| hypothetical protein BH3355 [Bacillus halodurans C-125]
 gi|10175978|dbj|BAB07074.1| BH3355 [Bacillus halodurans C-125]
          Length = 272

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 63/267 (23%), Positives = 117/267 (43%), Gaps = 2/267 (0%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
             Y   +    +     ++ ++   +LS+FP I+F   L  +    Q    +  ++    
Sbjct: 6   FFYQFFKQLKTDPIPDWSATLAYYFMLSIFPLIIFILALIPYFSIDQ--QYLYQIIVDYL 63

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           PE +A   T  IL V++ P  GL +  ALAA + +SNG+ AL  ++NR Y V E RS Y 
Sbjct: 64  PEDLADVFTSVILDVVSRPQGGLVSFGALAAIWTASNGMNALIRAVNRCYAVEETRSLYN 123

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            R +S    +   +  V    + V   L +  +   F        ++   R    +  + 
Sbjct: 124 LRFLSIMLTIGMMLVFVTTLLLPVFGHLIIQLLDWLFIVPEGTASVLNALRWIVGICLMT 183

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           I LI ++L  P    K+  ++ G +   I W + +  F+ Y+  F  +S  Y  L  ++ 
Sbjct: 184 IILIVIYLLAPNTSLKLKDVVTGAVVATIGWQLISYGFSAYVSNFGNFSATYGSLGGVIV 243

Query: 251 CLVFLYMLGVFFILGAELNASMIIYYW 277
            +++ ++  +  I+G E+NA+      
Sbjct: 244 LMLWFFLSSLMLIIGGEVNAATYRLKQ 270


>gi|116048875|ref|YP_792324.1| ribonuclease [Pseudomonas aeruginosa UCBPP-PA14]
 gi|122257982|sp|Q02IB2|Y5196_PSEAB RecName: Full=UPF0761 membrane protein PA14_51960
 gi|115584096|gb|ABJ10111.1| probable ribonuclease [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 411

 Score =  143 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 43/269 (15%), Positives = 95/269 (35%), Gaps = 8/269 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MRE+F    +        FV +     A+ ++ + L +V P +    ++   + A   + 
Sbjct: 1   MREHFNDGVEFARFLAHRFVTDKAPNSAAALTYTTLFAVVPMMTVMFSMLSLIPAFHGMG 60

Query: 61  T-VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +   +F  +     + +   +       A+ L  +  +  A  +   +  +  + N  
Sbjct: 61  ESIQTFIFRNFVPSAGEAVETYLKSF-TTQARHLTWVGVVFLAVTAFTMLVTIEKAFNEI 119

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +RV + R      L+ +  + L  + L     V   I               + L     
Sbjct: 120 WRVRQPRRGVGRFLLYWAILSLGPLLLGAGFAVTTYITSLS------LLHGPDALPGAET 173

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                 +         ++  +P A+  +   L G +FT + +     LF  Y+  F  Y 
Sbjct: 174 LLGLMPLAFSVAAFTLLYSAVPNARVPVRHALMGGVFTAVLFEAAKTLFGLYVSLFPGYQ 233

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAEL 268
            +Y   A++   L+++Y+  +  + GA L
Sbjct: 234 LIYGAFATVPIFLLWIYLSWMIVLFGAVL 262


>gi|54296667|ref|YP_123036.1| hypothetical protein lpp0698 [Legionella pneumophila str. Paris]
 gi|53750452|emb|CAH11846.1| hypothetical protein lpp0698 [Legionella pneumophila str. Paris]
          Length = 412

 Score =  143 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 49/271 (18%), Positives = 112/271 (41%), Gaps = 11/271 (4%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVIDVVFG 68
             +   I+HF+++D   +AS ++ ++LL+V P +  G  +       Q     V + +F 
Sbjct: 16  RFVRFVIQHFIQDDCTYIASALAFTSLLAVVPLMSVGLAIFSSFPVFQGLAEPVQNFIFD 75

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            +     K +   + Q  +  +K L     +   + +   +  +  ++N+ +RV   R  
Sbjct: 76  NFVPATGKIVQSYLQQFTSQVSK-LSIWGIVFLIFTALLVMFTIEQAMNKIWRVSSSRHG 134

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
               L+ +  + LA V L +       +           P         +    Y+    
Sbjct: 135 VSAFLLYWAIISLAPVLLGLSLAASSYLFSMPILADHRAP---------YTILHYSPFFL 185

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
             IG  F+++ +P    KI     G +   I +      F +Y++ ++TY  +Y   A++
Sbjct: 186 SLIGFTFLYVVVPNCPVKIRHAFWGGLVAAILFESAKHAFAYYLIRYNTYELLYGAFAAV 245

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
               +++Y + +  +LGAE++ +  +++ R+
Sbjct: 246 PIFFIWVYWVWIITLLGAEISYAFSVHHQRR 276


>gi|288559255|sp|Q0VPA7|Y1543_ALCBS RecName: Full=UPF0761 membrane protein ABO_1543
          Length = 429

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 39/280 (13%), Positives = 100/280 (35%), Gaps = 7/280 (2%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVP 60
           +  F  +       +  F E+     A+ ++ + L ++ P +     +   + A      
Sbjct: 11  QARFNSIKAFFVLLVRQFNEDGCRQSAAALTYTTLFAIVPVMTVSFVVLSSVPALQGKSA 70

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            + +  F  +       + D +    A  A  L  +  +     S   +  +  +LNR +
Sbjct: 71  QLQEWAFEYFVPSAGNMLLDHLQSF-AKQATNLTVLGIVFLVVTSVLMLSTVEQTLNRIW 129

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           +V   R   ++ L+ +  + L  + L +   +   +       +  F    + L  +   
Sbjct: 130 KVQTPRKGLVSLLMYWALLSLGPICLGLGLAITSYLTS-----QAIFSDTVSYLGGVRLW 184

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                 L     L  ++  +P         + G     + + +    FT +I    +Y  
Sbjct: 185 LAVLPFLFTTAMLTLMYTVVPNTTVPFRQGVLGAAMAALLFELAKGAFTFFIKQAPSYQV 244

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +Y   A++   L+++Y+     + GAEL  +++++   ++
Sbjct: 245 VYGAFAAVPVFLLWIYISWTIVLGGAELVRALVVFQEHQR 284


>gi|218893079|ref|YP_002441948.1| putative ribonuclease [Pseudomonas aeruginosa LESB58]
 gi|226737450|sp|B7UXY2|Y4364_PSEA8 RecName: Full=UPF0761 membrane protein PLES_43641
 gi|218773307|emb|CAW29119.1| probable ribonuclease [Pseudomonas aeruginosa LESB58]
          Length = 411

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 43/269 (15%), Positives = 95/269 (35%), Gaps = 8/269 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MRE+F    +        FV +     A+ ++ + L +V P +    ++   + A   + 
Sbjct: 1   MREHFNDGVEFARFLAHRFVTDKAPNSAAALTYTTLFAVVPMMTVMFSMLSLIPAFHGMG 60

Query: 61  T-VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +   +F  +     + +   +       A+ L  +  +  A  +   +  +  + N  
Sbjct: 61  ESIQTFIFRNFVPSAGEAVETYLKSF-TTQARHLTWVGVVFLAVTAFTMLVTIEKAFNEI 119

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +RV + R      L+ +  + L  + L     V   I               + L     
Sbjct: 120 WRVRQPRRGVGRFLLYWAILSLGPLLLGAGFAVTTYITSLS------LLHGPDALPGAET 173

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                 +         ++  +P A+  +   L G +FT + +     LF  Y+  F  Y 
Sbjct: 174 LLGLMPLAFSVAAFTLLYSAVPNARVPVRHALMGGVFTAVLFEAAKTLFGLYVSLFPGYQ 233

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAEL 268
            +Y   A++   L+++Y+  +  + GA L
Sbjct: 234 LIYGAFATVPIFLLWIYLSWMIVLFGAVL 262


>gi|84684451|ref|ZP_01012352.1| putative ribonuclease protein [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84667430|gb|EAQ13899.1| putative ribonuclease protein [Rhodobacterales bacterium HTCC2654]
          Length = 316

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 62/273 (22%), Positives = 112/273 (41%), Gaps = 8/273 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
            F I+      F E     +A+ ++  ALLS+FP I     +AG       +   +    
Sbjct: 19  WFAILKRVWTRFNENRLTLIAAGVAFFALLSLFPAITATIAVAGLFFDPAEITDPLQEFA 78

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAA---YFSSNGVEALRISLNRAYRVVE 124
              P+  A  I D+   V      GL   + L      Y +S GVE L + LN AY   +
Sbjct: 79  AVLPDGAASIILDQATSVTGSDESGLGLAAILGLLLALYSASKGVENLMVGLNVAYAEKD 138

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R     +L  F   +   + ++    V V +P+ L  +    P  G +  ++       
Sbjct: 139 ERGLIRAKLTVFALTVFLVIGVIFSLGVMVVLPIVLNVL----PLGGVVETVVRIVPWLV 194

Query: 185 TMLALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            ++        +  + P  + ++ + ILPG +   + W   +V F+ Y   F +Y   + 
Sbjct: 195 LLIFTIGAFSILFRYGPDRRSARWVYILPGAVLACLLWGAASVGFSIYADNFGSYQESFG 254

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            LA  +  L++L++  +  +LGA+LNA +   +
Sbjct: 255 TLAGAIVLLMWLWISALVVLLGAKLNAEIEAQH 287


>gi|258508049|ref|YP_003170800.1| ribonuclease BN-like family protein [Lactobacillus rhamnosus GG]
 gi|257147976|emb|CAR86949.1| Ribonuclease BN-like family enzyme [Lactobacillus rhamnosus GG]
 gi|259649370|dbj|BAI41532.1| ribonuclease BN [Lactobacillus rhamnosus GG]
          Length = 334

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 69/273 (25%), Positives = 124/273 (45%), Gaps = 2/273 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
             +  I  AI    + +    A+ ++   LLS+FP I+F AN   +LG      ++   +
Sbjct: 38  KFWVFIKLAINRISDSNIGQSAAALAYYTLLSLFPLILFVANALPYLGLK--YSSLATYL 95

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
             A P  + + +   I  +L   + GL  I A+A  + +S GV  L++  N+ Y V   +
Sbjct: 96  TQAVPANVMEWLDPIIANLLDSSSGGLLGIGAIATLWAASLGVTGLKMGFNQVYGVEATQ 155

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           ++ I RL+S        + +  +   F      L ++        + L      R   T+
Sbjct: 156 NFIIQRLLSMLMTFTLIIVMGAILIAFAFGRQFLEWLIPLLRLDTSWLRTFNTLRWPITV 215

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
            ALFI ++F+  FLP  K K+ ++LPG  FT I W++ A  F+ Y+  F T    Y  + 
Sbjct: 216 TALFIIIMFLDYFLPNVKIKMWTVLPGTAFTVIGWLLIAQAFSLYMHYFGTRYLSYGTIG 275

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           + +  +++L    +  + GA +NA    Y+  +
Sbjct: 276 TFIAIMLWLNFSALVLLWGAVINALTAEYFIGR 308


>gi|199598315|ref|ZP_03211735.1| Ribonuclease BN-like family enzyme [Lactobacillus rhamnosus HN001]
 gi|199590768|gb|EDY98854.1| Ribonuclease BN-like family enzyme [Lactobacillus rhamnosus HN001]
          Length = 334

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 69/273 (25%), Positives = 125/273 (45%), Gaps = 2/273 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
             +  I  AI    + +    A+ ++   LLS+FP I+F AN   +LG      ++   +
Sbjct: 38  KFWVFIKLAINRISDSNIGQSAAALAYYTLLSLFPLILFVANALPYLGLK--YSSLATYL 95

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
             A P  + + +   I  +L   + GL  I A+A  + +S GV  L++  N+ Y V   +
Sbjct: 96  TQAVPANVMEWLDPIIANLLDSSSGGLLGIGAIATLWAASLGVTGLKMGFNQVYGVEATQ 155

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           ++ I RL+S        + +  +  VF      L ++        + L      R   T+
Sbjct: 156 NFIIQRLLSMLMTFTLIIVMGAILIVFAFGRQFLEWLIPLLRLDTSWLRTFNTLRWPITV 215

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
            ALF+ ++F+  FLP  K K+ ++LPG  FT I W++ A  F+ Y+  F T    Y  + 
Sbjct: 216 TALFVIIMFLDYFLPNVKIKMWTVLPGTAFTVIGWLLIAQAFSLYMHYFGTRYLSYGTIG 275

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           + +  +++L    +  + GA +NA    Y+  +
Sbjct: 276 TFIAIMLWLNFSALVLLWGAVINALTAEYFIGR 308


>gi|186476333|ref|YP_001857803.1| ribonuclease BN [Burkholderia phymatum STM815]
 gi|184192792|gb|ACC70757.1| ribonuclease BN [Burkholderia phymatum STM815]
          Length = 439

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 42/277 (15%), Positives = 97/277 (35%), Gaps = 5/277 (1%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH-QFV 59
           +R     +  +   A +   E+    +A  ++ + +LS+ P       L        QF 
Sbjct: 5   LRLDLDTLKRLAEFAAKRSGEDRIPQVAGSLTFTTMLSLVPLATVAFALFTAFPIFAQFQ 64

Query: 60  PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
            ++   +                L   A  AKGL T+  +     S   +  +  + N  
Sbjct: 65  VSLQTFLAEHLMPDQVSSQIFRYLNQFASKAKGLTTLGMIILFVTSVMTMMTVESAFNVI 124

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +RV + R +    L  +  + L  + + +   +   +                +   +  
Sbjct: 125 WRVRKARPFAQRVLAYWAILTLGPILIGVSLSISSYLFTQSMTYTAAQRITPLIEWALAG 184

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
             +  T+L        +++FLP  + +    + G +   I++ +    F  YI    TY+
Sbjct: 185 ATLPLTVL----AFTMLYVFLPNCRVEWRDAIVGGVTAAIAFELAKRGFGFYIRRIPTYT 240

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            +Y   A +   L+++Y+     + GA + +++    
Sbjct: 241 AVYGAFAVVPLFLLWMYLSWFITLAGAMIASALPAIR 277


>gi|206974201|ref|ZP_03235118.1| YihY family protein [Bacillus cereus H3081.97]
 gi|206747441|gb|EDZ58831.1| YihY family protein [Bacillus cereus H3081.97]
          Length = 289

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 72/270 (26%), Positives = 127/270 (47%), Gaps = 2/270 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
             +    D  +  + +D   +A+ ++   LL++FP +VF   L GF+       +V++++
Sbjct: 12  RTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIDLQ--TESVLNLL 69

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               PE     I   + +V+     GL +   L+  +F+SNGV A+  + NRAY V E R
Sbjct: 70  EPYVPEDAMSLIEVNVDKVVNQQNGGLLSFGLLSMLWFASNGVNAVMNAFNRAYDVTETR 129

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+  TR +S  + L     +V    V V   +  A V K      +   +    R+ A+ 
Sbjct: 130 SFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIGAAVFKAIGLSDSFSYVWSITRLVASF 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             LF    F++ F P  K K   ++ G  F  + W+V +  F +Y+  F+ Y+ +Y GL 
Sbjct: 190 FVLFALFSFLYTFAPDRKLKRREVISGATFATVGWIVVSYSFAYYVDKFANYANIYGGLG 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            I+  +++ Y+ G   +LG E+N  +  Y 
Sbjct: 250 GIIILMLWFYLTGWVILLGGEINGLLHHYR 279


>gi|158426274|ref|YP_001527566.1| ribonuclease BN [Azorhizobium caulinodans ORS 571]
 gi|158333163|dbj|BAF90648.1| ribonuclease BN [Azorhizobium caulinodans ORS 571]
          Length = 324

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 108/276 (39%), Positives = 163/276 (59%), Gaps = 1/276 (0%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
               + ++ DA+  F+ +DGWA+ASHI+LS L+S+FPF++F   LAGFL         I 
Sbjct: 30  LRRTYRVVMDAVWTFLADDGWAIASHIALSILMSLFPFLIFLTALAGFLDLRPLANEAIQ 89

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
           ++   WP+ +A+PI  EI  V+      + T+    A YFSSNG+E+LRI LNRAY + E
Sbjct: 90  LILETWPDAVAEPIAREIHNVVNQVRADVLTVGVALAIYFSSNGIESLRIGLNRAYGMKE 149

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R+WY  R+ S  +VL+ +  ++ +SF+ +  PL    +    PAL  +  ++   R  +
Sbjct: 150 HRAWYRLRVSSVLFVLVGAAGMLALSFLVILGPLIWQTMVNNVPALKPISGVVTFARFAS 209

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF-STYSTMYA 243
           T L L I L+  HL+LPA + +++ +LPG+  T   W+V A +F  Y+  F S Y T YA
Sbjct: 210 TALILIIALLMAHLWLPAGRRRLLDVLPGIGVTLTLWLVAATVFGIYLGEFSSNYVTTYA 269

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           GLAS+M  LVFLY+    FI G ELNA+++     +
Sbjct: 270 GLASVMIALVFLYLTATAFIFGGELNAAILRDRRAR 305


>gi|146281873|ref|YP_001172026.1| ribonuclease BN, putative [Pseudomonas stutzeri A1501]
 gi|145570078|gb|ABP79184.1| ribonuclease BN, putative [Pseudomonas stutzeri A1501]
          Length = 265

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 66/257 (25%), Positives = 117/257 (45%), Gaps = 1/257 (0%)

Query: 24  GWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEIL 83
               AS ++   L ++FPF+VF   L GFL    F   +      A P V  + I   I 
Sbjct: 1   MSTYASALAYRGLFAMFPFLVFLIALLGFLDLQNFFDWLRMQAELALPPVAMEQINPVID 60

Query: 84  QVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLAS 143
           Q+    A GL +   L A + +S G  +L  +LNRAY V E R  +   +++  Y    +
Sbjct: 61  QLQEQQA-GLLSFGILVALWTASIGFRSLMNALNRAYDVEEGRPTWKLIILALAYTAGVA 119

Query: 144 VTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAA 203
           V L+  + + V  P A+ ++         ++++    R    +L L + +  ++   P  
Sbjct: 120 VLLLFTAGLMVIGPQAMEWLAGQVGMRELVVVLWTWLRWPVIVLMLMLVVALLYYVAPDV 179

Query: 204 KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFI 263
           + +   I PG +   + W++ +V F  Y+  F+ Y+  Y  + +I+  L++LY+     +
Sbjct: 180 EQEFRFITPGSVLAVLVWILASVAFGVYVQNFADYNATYGSIGAIIVLLLYLYISAAVLL 239

Query: 264 LGAELNASMIIYYWRKK 280
            GAELNA +       K
Sbjct: 240 FGAELNAVIEHASVEGK 256


>gi|229551895|ref|ZP_04440620.1| ribonuclease BN [Lactobacillus rhamnosus LMS2-1]
 gi|258539317|ref|YP_003173816.1| ribonuclease BN-like family enzyme [Lactobacillus rhamnosus Lc 705]
 gi|229314739|gb|EEN80712.1| ribonuclease BN [Lactobacillus rhamnosus LMS2-1]
 gi|257150993|emb|CAR89965.1| Ribonuclease BN-like family enzyme [Lactobacillus rhamnosus Lc 705]
          Length = 334

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 69/273 (25%), Positives = 124/273 (45%), Gaps = 2/273 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
             +  I  AI    + +    A+ ++   LLS+FP I+F AN   +LG      ++   +
Sbjct: 38  KFWVFIKLAINRISDSNIGQSAAALAYYTLLSLFPLILFVANALPYLGLK--YSSLATYL 95

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
             A P  + + +   I  +L   + GL  I A+A  + +S GV  L++  N+ Y V   +
Sbjct: 96  TQAVPANVMEWLDPIIANLLDSSSGGLLGIGAIATLWAASLGVTGLKMGFNQVYGVEATQ 155

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           ++ I RL+S        + +  +   F      L ++        + L      R   T+
Sbjct: 156 NFIIQRLLSMLMTFTLIIVMGAILIAFAFGRQFLEWLIPLLRLDTSWLRTFNTLRWPITV 215

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
            ALFI ++F+  FLP  K K+ ++LPG  FT I W++ A  F+ Y+  F T    Y  + 
Sbjct: 216 TALFIIIMFLDYFLPNVKIKMWTVLPGTAFTVIGWLLIAQAFSLYMHYFGTRYLSYGTIG 275

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           + +  +++L    +  + GA +NA    Y+  +
Sbjct: 276 TFIAIMLWLNFSALVLLWGAVINALTAEYFIGR 308


>gi|307609441|emb|CBW98931.1| hypothetical protein LPW_07171 [Legionella pneumophila 130b]
          Length = 412

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 49/271 (18%), Positives = 113/271 (41%), Gaps = 11/271 (4%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVIDVVFG 68
             +   I+HF+++D   +AS ++ ++LL+V P +  G  +       Q     V + +F 
Sbjct: 16  RFVRFVIQHFIQDDCTYIASALAFTSLLAVVPLMSVGLAIFSSFPVFQGLAEPVQNFIFD 75

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            +     K +   + Q  +  +K L     +   + +   +  +  ++N+ +RV   R  
Sbjct: 76  NFVPATGKIVQSYLQQFTSQVSK-LSIWGIVFLIFTALLVMFTIERAMNKIWRVSSSRHG 134

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
               L+ +  + LA V L +       +           P         +    Y+    
Sbjct: 135 VSAFLLYWAIISLAPVLLGLSLAASSYLFSMPILADHRAP---------YTILHYSPFFL 185

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
             IG  F+++ +P    KI     G +   I +      F +Y++ ++TY+ +Y   A++
Sbjct: 186 SLIGFTFLYVVVPNCPVKIRHAFWGGLVAAILFESAKHAFAYYLIRYNTYALLYGAFATV 245

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
               +++Y + +  +LGAE++ +  +++ R+
Sbjct: 246 PIFFIWVYWVWIITLLGAEISYAFSVHHQRR 276


>gi|225181231|ref|ZP_03734676.1| ribonuclease BN [Dethiobacter alkaliphilus AHT 1]
 gi|225168011|gb|EEG76817.1| ribonuclease BN [Dethiobacter alkaliphilus AHT 1]
          Length = 281

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 58/271 (21%), Positives = 119/271 (43%), Gaps = 2/271 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +   I        E +  A  + +S   +LS+FPF++F   L  +    Q     +D + 
Sbjct: 4   ILSFIKQLYLRIQENETTARGAQLSYFFILSIFPFLIFLITLIDYTPLSQ--QHTLDQLA 61

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P+     +   + +V A     L ++  L   + +S G  AL  SLN+AY + E RS
Sbjct: 62  LLLPDNAFAIVEQIVSEVEAADNFTLLSLGILGTIWTASRGTAALIKSLNKAYDITESRS 121

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           +++   I     L  ++ ++      V   +      ++    G    +    R    +L
Sbjct: 122 FFVLNTIGIAATLALALLILFTLSFLVFGQVIGELAFQYLGLEGLFQALWPVLRFSIPLL 181

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            +F+    + L+ P  + ++  + PG IF+ ++W++ +  F  Y+  F  +S  Y  +  
Sbjct: 182 IIFVSFTLLFLYSPNCRLRLRHVYPGAIFSTLAWIIASQAFAFYVNNFGNFSRTYGSIGG 241

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           I+  +++LY+  V  +LG E+NA++   + +
Sbjct: 242 IIVFMIWLYLSSVVVLLGGEINATLYNSFCK 272


>gi|226945729|ref|YP_002800802.1| Ribonuclease BN-like protein [Azotobacter vinelandii DJ]
 gi|259552132|sp|C1DRV2|Y3681_AZOVD RecName: Full=UPF0761 membrane protein Avin_36810
 gi|226720656|gb|ACO79827.1| Ribonuclease BN-like protein [Azotobacter vinelandii DJ]
          Length = 408

 Score =  142 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 45/281 (16%), Positives = 99/281 (35%), Gaps = 8/281 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV- 59
           MR+ F    D      E F+ + G   A+ ++ +AL +V P +     +   +   Q + 
Sbjct: 1   MRQRFVDSLDFWRYLFERFLADQGPKSAAALTYTALFAVVPIMTLIFVVLSVVPDFQGIG 60

Query: 60  PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +   +F  +       + D +   +      L  +        +   +  +  + N  
Sbjct: 61  EQIQGFIFRNFVPSSGAVLQDYLRTFIEQARH-LTWLGVGVLMVTALLMLMTVEHTFNTI 119

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +RV   R    + L+ +  + L  + L     +   I         +       L     
Sbjct: 120 WRVRRPRRGLSSFLLHWAILSLGPLLLGTGFALSTYITSLSLVSDPY------ALAGARM 173

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                 +L        +++ +P     +   L G +F  + +     LF  Y+  F TY 
Sbjct: 174 LLKVMPLLFSTAAFTLLYVAVPNTAVPLRHALLGGLFAAVLFEAAKGLFGLYVALFPTYQ 233

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            +Y   A++   L+++Y+  +  +LGAEL  ++      ++
Sbjct: 234 LIYGAFAAVPLFLLWMYLSWMIVLLGAELVCNLSASRRWRR 274


>gi|124266615|ref|YP_001020619.1| putative ribonuclease BN transmembrane protein [Methylibium
           petroleiphilum PM1]
 gi|288559203|sp|A2SFP5|Y1422_METPP RecName: Full=UPF0761 membrane protein Mpe_A1422
 gi|124259390|gb|ABM94384.1| putative ribonuclease BN transmembrane protein [Methylibium
           petroleiphilum PM1]
          Length = 416

 Score =  142 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 47/267 (17%), Positives = 94/267 (35%), Gaps = 9/267 (3%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI-- 63
               D +    + F E+     AS ++ +  +++ P       +             +  
Sbjct: 32  WPWLDTLKTLRQRFREDRLGLTASSLTFTTTIALVPLATVTLAIFSAFPMFGQFQGALEK 91

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +    P+ IAKP+   + Q  A  A  L T+  +     +   +  +  +LN  +RV 
Sbjct: 92  YFIQSLVPDGIAKPVLGALTQF-AGKAHRLGTVGLVVLVLTALALMLTIDRTLNAIWRVR 150

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R      L+ +    L  + L +   +      A   V    P        +      
Sbjct: 151 KPRPIAQRVLVYWAAATLGPLLLGVSLTLTSYAISASRGVVGAMPGS------LSVLLNA 204

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
                L   +  +  ++P  + +    L G +F    + +       Y+    TYST+Y 
Sbjct: 205 LEFGLLAAAMAGLFHYVPNTEVRWRHALAGGLFVSAGFELAKKGLAWYLAQVPTYSTIYG 264

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNA 270
             A++   L++LY+  V  +LGA + A
Sbjct: 265 AFATVPIFLIWLYLGWVIVLLGAVIAA 291


>gi|325103819|ref|YP_004273473.1| ribonuclease BN [Pedobacter saltans DSM 12145]
 gi|324972667|gb|ADY51651.1| ribonuclease BN [Pedobacter saltans DSM 12145]
          Length = 332

 Score =  142 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 58/268 (21%), Positives = 122/268 (45%), Gaps = 2/268 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           ++ +     +   +E     AS ++ + L++VFP I+F   L  ++    F   ++ ++ 
Sbjct: 34  LYTVATFFFQEIGKESLVNKASSLAYNFLMAVFPAIIFLFTLIPYIPIKNFQNQLMAIIA 93

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              PE   K   D +  ++      L +I  L A +F++NG+  L  + N++  +VE R+
Sbjct: 94  LLLPENAYKAFEDTLEDIVKNQNGKLLSIGFLLALFFATNGIHTLMQAFNKSSLIVETRT 153

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGN--LLLIIWNGRIYAT 185
           W   RL++    +L   ++++   + V     L   R+      N   + +I  GR    
Sbjct: 154 WLKQRLVAMNLTVLTIFSIILGVSITVITEFILNTFREELNFENNKFWIFLITIGRWIII 213

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +   F     ++ + PA   K     PG     +  ++  + FT +I  F  Y+ +Y  +
Sbjct: 214 VCVYFFTTSLLYRYGPANAKKWKLFSPGAWLATVLAILTTLGFTFFINNFGAYNKLYGSI 273

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMI 273
            +++  +++LY+  +  ++G ELNAS+ 
Sbjct: 274 GTLLVVMIWLYLNSLILLIGFELNASLE 301


>gi|54293627|ref|YP_126042.1| hypothetical protein lpl0680 [Legionella pneumophila str. Lens]
 gi|53753459|emb|CAH14914.1| hypothetical protein lpl0680 [Legionella pneumophila str. Lens]
          Length = 412

 Score =  142 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 49/271 (18%), Positives = 113/271 (41%), Gaps = 11/271 (4%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVIDVVFG 68
             +   I+HF+++D   +AS ++ ++LL+V P +  G  +       Q     V + +F 
Sbjct: 16  RFVRFVIQHFIQDDCTYIASALAFTSLLAVVPLMSVGLAIFSSFPVFQGLAEPVQNFIFD 75

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            +     K +   + Q  +  +K L     +   + +   +  +  ++N+ +RV   R  
Sbjct: 76  NFVPATGKIVQSYLQQFTSQVSK-LSIWGIVFLIFTALLVMFTIERAMNKIWRVSSSRQG 134

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
               L+ +  + LA V L +       +           P         +    Y+    
Sbjct: 135 VSAFLLYWAIISLAPVLLGLSLAASSYLFSMPILADHRAP---------YTILHYSPFFL 185

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
             IG  F+++ +P    KI     G +   I +      F +Y++ ++TY+ +Y   A++
Sbjct: 186 SLIGFTFLYVVVPNCPVKIRHAFWGGLVAAILFESAKHAFAYYLIRYNTYALLYGAFATV 245

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
               +++Y + +  +LGAE++ +  +++ R+
Sbjct: 246 PIFFIWVYWVWIITLLGAEISYAFSVHHQRR 276


>gi|52840880|ref|YP_094679.1| ribonuclease BN [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|81378036|sp|Q5ZXT8|Y643_LEGPH RecName: Full=UPF0761 membrane protein lpg0643
 gi|52627991|gb|AAU26732.1| ribonuclease BN [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
          Length = 412

 Score =  142 bits (359), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 49/271 (18%), Positives = 113/271 (41%), Gaps = 11/271 (4%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVIDVVFG 68
             +   I+HF+++D   +AS ++ ++LL+V P +  G  +       Q     V + +F 
Sbjct: 16  RFVRFVIQHFIQDDCTYIASALAFTSLLAVVPLMSVGLAIFSSFPVFQGLAEPVQNFIFD 75

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
            +     K +   + Q  +  +K L     +   + +   +  +  ++N+ +RV   R  
Sbjct: 76  NFVPATGKIVQSYLQQFTSQVSK-LSIWGIVFLIFTALLVMFTIERAMNKIWRVSSSRHG 134

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
               L+ +  + LA V L +       +           P         +    Y+    
Sbjct: 135 VSAFLLYWAIISLAPVLLGLSLAASSYLFSMPILADHRAP---------YTILHYSPFFL 185

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
             IG  F+++ +P    KI     G +   I +      F +Y++ ++TY+ +Y   A++
Sbjct: 186 SLIGFTFLYVVVPNCPVKIRHAFWGGLVAAILFESAKHAFAYYLIRYNTYALLYGAFATV 245

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
               +++Y + +  +LGAE++ +  +++ R+
Sbjct: 246 PIFFIWVYWVWIITLLGAEISYAFSVHHQRR 276


>gi|297531287|ref|YP_003672562.1| ribonuclease BN [Geobacillus sp. C56-T3]
 gi|297254539|gb|ADI27985.1| ribonuclease BN [Geobacillus sp. C56-T3]
          Length = 277

 Score =  142 bits (359), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 64/272 (23%), Positives = 128/272 (47%), Gaps = 2/272 (0%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
              I + +  F E++   +++ ++   LLS+FPF++F   L  +L        V+ +V  
Sbjct: 5   LAFIRELVRRFTEDEIPRLSAELAYYFLLSLFPFLLFLMTLLAYLPIPH--EDVLALVRQ 62

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
             P+     I   + +++     GL + S +AA + +SNG+ A+  + NRAY V E R +
Sbjct: 63  YAPKEALHLIETNVHRLIDEQNGGLLSFSIIAAIWSASNGMSAIMRAFNRAYDVQEDRPF 122

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +I R +S    L   + +++   + V   +   ++          L +    R   + L 
Sbjct: 123 WIVRGLSIVLTLGMIMVIIVALVLPVFGRIIGLFLFSALGLSQQFLEVWNAFRWVTSSLL 182

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LF     ++ F P  + + ++++ G +F    W+  ++ F +Y+  F+ Y+ MY  L  +
Sbjct: 183 LFAVFTALYYFAPNKQLRCVNVVRGALFATAGWIAASLAFAYYVNNFADYTAMYGSLGGM 242

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +  +V+ Y+ G+  +LG ELNA        K+
Sbjct: 243 IVLMVWFYLSGMILVLGGELNAMFDCEREGKR 274


>gi|262199043|ref|YP_003270252.1| ribonuclease BN [Haliangium ochraceum DSM 14365]
 gi|262082390|gb|ACY18359.1| ribonuclease BN [Haliangium ochraceum DSM 14365]
          Length = 499

 Score =  142 bits (359), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 45/267 (16%), Positives = 97/267 (36%), Gaps = 5/267 (1%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG-AHQFV 59
           +R       + +   I    +E+    A+ ++   LLS+ P +  G  L    G   +  
Sbjct: 43  IRALSVRQLEALILTIHSLFDEELLRRAASLTYYTLLSLVPLLAVGFALFEAFGGLSKLK 102

Query: 60  PTVIDVVFGAWPEVIAKPITDEILQVLAV-PAKGLFTISALAAAYFSSNGVEALRISLNR 118
             + +++           I   + Q +    A  +  +  L   Y +   +  +  + NR
Sbjct: 103 EPLKELIVDTVAVGRQDEIGTWLNQFIDNVNAGAIAGVGVLVLFYSAIGLLTNIESAFNR 162

Query: 119 AYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIW 178
            + +   R  ++   I +  V LA   L +       +  +             L  ++ 
Sbjct: 163 IWGIERDRPMHMRFAIYWCIVTLAPPLLGVSISFSARLQSSSFASSVLDWLPFGLGNLVV 222

Query: 179 NGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTY 238
                AT+    +  +   + +P  K K+   L G I T + W V   L+  +I     Y
Sbjct: 223 VLSSTATV---SLAFVLSFIIVPNTKVKVKYALLGGITTGVLWNVTKALYIWFIAGSVKY 279

Query: 239 STMYAGLASIMTCLVFLYMLGVFFILG 265
           S +Y  L+++   +++LY+  +  + G
Sbjct: 280 SAIYGALSALPLLMMWLYLSWIILLFG 306


>gi|333030451|ref|ZP_08458512.1| ribonuclease BN [Bacteroides coprosuis DSM 18011]
 gi|332741048|gb|EGJ71530.1| ribonuclease BN [Bacteroides coprosuis DSM 18011]
          Length = 439

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 45/276 (16%), Positives = 98/276 (35%), Gaps = 4/276 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +     +   IY  I+ FV++   A AS ++ S LL++ P +     +A   G  + + T
Sbjct: 28  KFSLYNIIKTIYVTIKQFVDDRIAAKASALTYSTLLAIVPMLAILFAIARGFGFDKLMET 87

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
            +   FG   E     +T     +          +      +   N +  + ++ N  ++
Sbjct: 88  QLFANFGGQTETTEAILTFVDSYLEHAKGGIFIGVGLAMLLWTVLNLINNIEVTFNHIWQ 147

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V + R+ Y      F   LL  + +V  S V + +    A +  +      L  +     
Sbjct: 148 VKKSRNMYRKITDYFSMFLLMPILIVFSSGVTLFMSTVFAKMEDYIL----LGSLSKFLI 203

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                   ++    +++F+P    +    LP  I     +      +    +  S Y+ +
Sbjct: 204 KLIPFAITWLMFTGLYVFMPNTNVRFKHALPAGILAGTIYQFFQFFYISGQIWVSKYNAI 263

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           Y   A++   L++L       + G +L  +     +
Sbjct: 264 YGSFAALPLFLLWLQTSWTICLFGVQLTYTSQNIRF 299


>gi|187924749|ref|YP_001896391.1| ribonuclease BN [Burkholderia phytofirmans PsJN]
 gi|187715943|gb|ACD17167.1| ribonuclease BN [Burkholderia phytofirmans PsJN]
          Length = 437

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 38/273 (13%), Positives = 95/273 (34%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A +   E+    +A  ++ + +LS+ P       L         F  ++ 
Sbjct: 9   LDTLKRLAQFAAQRSSEDRIPQVAGSLTFTTMLSLVPLATVAFALFTAFPIFASFQMSLQ 68

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +                L   A  AKGL TI  +     +   +  +  + N  +RV 
Sbjct: 69  IFLADHLMPAQLNSQIFNYLNQFASKAKGLTTIGMIFLFVTAVMTMMTVESAFNVIWRVR 128

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R      L+ +  + L  + + +   +   +                +   +    + 
Sbjct: 129 KARPIAQRILVYWAIITLGPILIGVSLSISSYLFTQSMTFTAAQRMTPVIEWALTGAALP 188

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T     +    ++++LP  + +    + G +   I++ +    F +Y+    TY+ +Y 
Sbjct: 189 LT----AVAFTILYVYLPNCRVEWRDAVIGGVTAAIAFELAKRGFGYYVRRIPTYTAVYG 244

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   LV++Y+     + GA + +++    
Sbjct: 245 AFAAVPLFLVWMYLCWFITLAGAMIASALPAIR 277


>gi|152998866|ref|YP_001364547.1| ribonuclease BN [Shewanella baltica OS185]
 gi|166199584|sp|A6WI45|Y314_SHEB8 RecName: Full=UPF0761 membrane protein Shew185_0314
 gi|151363484|gb|ABS06484.1| putative ribonuclease BN [Shewanella baltica OS185]
          Length = 323

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 51/276 (18%), Positives = 107/276 (38%), Gaps = 8/276 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +R  F  ++  +       VE+     A H++   LLS+ P +    ++       + + 
Sbjct: 10  IRVLFLGIWHFLLHLRRRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFKGIR 69

Query: 61  -TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +   V+  +       +   I + +   +KG   +   A    +   + A+  SLN  
Sbjct: 70  GQIEGFVYENFLPAAGDTVQVYINEFVGNASKG-TAVGIAALVVVAIMLISAIDKSLNNI 128

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +R  E RS  +   + +  + L  V +         +     +  +    +  + +    
Sbjct: 129 WRTKEKRSVVVAFSMYWMVLTLGPVLVGASLVASSYVISLKVFEAEALSGMLPIFIAR-- 186

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                 ML      + +++ +P  K K +  L G I   + + +G   F  Y+  F +Y 
Sbjct: 187 ----LPMLFSVAAFLLLYMVVPNQKVKFLHALLGAIVAALLFELGKKGFALYVTQFPSYE 242

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            +Y  LA+I    V++Y+  +  +LGAE+ A+M  Y
Sbjct: 243 AIYGALATIPIVFVWVYLSWMIVLLGAEITAAMPEY 278


>gi|160900398|ref|YP_001565980.1| ribonuclease BN [Delftia acidovorans SPH-1]
 gi|160365982|gb|ABX37595.1| ribonuclease BN [Delftia acidovorans SPH-1]
          Length = 448

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 51/260 (19%), Positives = 99/260 (38%), Gaps = 9/260 (3%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI--DVVFGAWPEVI 74
           E F E+     AS ++ + +L++ PF      L         V  V+   ++    PE I
Sbjct: 61  ERFREDRLGVTASSLTFTTVLALVPFFTVALALFTAFPIFSRVQIVLERWLIDSLIPETI 120

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
           A+ +   + Q  A  A  L           +   +  +  +LN  +RV ++R      LI
Sbjct: 121 ARQVLGYLTQF-ASKASQLGMAGFSILVITAVALILTIDRTLNNIWRVRQLRPLGQRVLI 179

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLI 194
            +  + L  + L +   +   +  A   +    P        +         LAL  G+ 
Sbjct: 180 YWAAITLGPLVLGLSLVLSSYVMSASRGLVNALPEG------LRFIFDSIEYLALAAGMA 233

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++ ++P    +      G +F      +       Y+ +  TYS +Y   A++   L++
Sbjct: 234 GLYHYVPNTAVRWRHAWVGGLFVATCMELAKKALGLYLASVPTYSVIYGTFATLPILLIW 293

Query: 255 LYMLGVFFILGAELNASMII 274
           +YM  +  +LGA + A + I
Sbjct: 294 IYMAWIIVLLGAVVTAYLPI 313


>gi|253699237|ref|YP_003020426.1| ribonuclease BN [Geobacter sp. M21]
 gi|251774087|gb|ACT16668.1| ribonuclease BN [Geobacter sp. M21]
          Length = 446

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 39/279 (13%), Positives = 109/279 (39%), Gaps = 5/279 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +     +         +F+  +    A+ +S + +LS+ P +    ++   LGA      
Sbjct: 27  KGRMVRLLQFFTFTFSNFMANNSLLRATALSFTTVLSLVPLLALAFSVLKGLGAQN---R 83

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           +  ++         + +   +  +       +  I   A  + + + + ++  + N A+ 
Sbjct: 84  LAPLILKQVTAGSEEVVNRVVSYIGNTNMGSVGAIGLAALIFTAISMLASVEEAFNVAWG 143

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E RS Y         ++ A + L+  + +   +     ++  +      L  +     
Sbjct: 144 VQETRSLYRKFSDYLSVLVSAPLLLLAATSITTTLQ--SKWLIGWLLERTYLGDLFLFML 201

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
            +   L++++ +  +++F+P  + +  S L G +     W      + H+ V    Y+ +
Sbjct: 202 GFTPYLSVWVAIFLLYIFIPNTRVRYSSALIGAVLAGTLWQFAQWAYIHFQVGAGNYNAI 261

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           Y  LA++   +V++Y+  +  + G E+ A+     + ++
Sbjct: 262 YGTLAALPILMVWIYVSWIIVLFGMEVVAAHQNRAFFRR 300


>gi|15596148|ref|NP_249642.1| ribonuclease [Pseudomonas aeruginosa PAO1]
 gi|32699648|sp|Q9I507|Y951_PSEAE RecName: Full=UPF0761 membrane protein PA0951
 gi|9946857|gb|AAG04340.1|AE004529_6 probable ribonuclease [Pseudomonas aeruginosa PAO1]
          Length = 411

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 43/269 (15%), Positives = 95/269 (35%), Gaps = 8/269 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MRE+F    +        FV +     A+ ++ + L +V P +    ++   + A   + 
Sbjct: 1   MREHFNDGVEFARFLAHRFVTDKAPNSAAALTYTTLFAVVPMMTVMFSMLSLIPAFHGMG 60

Query: 61  T-VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +   +F  +     + +   +       A+ L  +  +  A  +   +  +  + N  
Sbjct: 61  ESIQTFIFRNFVPSAGEAVETYLKSF-TTQARHLTWVGVVFLAVTAFTMLVTIEKAFNEI 119

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +RV + R      L+ +  + L  + L     V   I               + L     
Sbjct: 120 WRVRQPRRGVGRFLLYWAILSLGPLLLGAGFAVTTYITSLS------LLHGPDALPGAET 173

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                 +         ++  +P A+  +   L G +FT + +     LF  Y+  F  Y 
Sbjct: 174 LLGLMPLAFSVAAFTLLYSAVPNARVPVRHALMGGVFTAVLFEAAKTLFGLYVSLFPGYQ 233

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAEL 268
            +Y   A++   L+++Y+  +  + GA L
Sbjct: 234 LIYGAFATVPIFLLWIYLSWMIVLFGAVL 262


>gi|89093622|ref|ZP_01166569.1| probable ribonuclease [Oceanospirillum sp. MED92]
 gi|89082018|gb|EAR61243.1| probable ribonuclease [Oceanospirillum sp. MED92]
          Length = 420

 Score =  142 bits (358), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 45/269 (16%), Positives = 106/269 (39%), Gaps = 12/269 (4%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV-PTVIDVVFGA 69
            I      F++  G   A+ ++ + L +V P +     +   + + Q V   +   VF  
Sbjct: 12  FIRYLFRQFLKNQGILNAAALTYTTLFAVVPLMTVSYAMLAAVPSFQGVGQELQGWVFDN 71

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           +     + + D + +  +  A+ L  +     A  S   ++ +  + NR +RV E R   
Sbjct: 72  FVPATGQVVQDYLNEF-SSQARKLTAVGVALLAVTSIMMMKNIEAAFNRIWRVTEPRKGL 130

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY--ATML 187
            + L+ +  + L  + + +   +   I           P +     ++   R+      +
Sbjct: 131 SSFLLYWAILSLGPILIGLGLVLTSYIASL--------PFINEATEVVGRARLLSLLPTI 182

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
                   +++ +P  +    S L G +   + +      FT ++  F +Y  +Y   A+
Sbjct: 183 LSAAAFTLMYIAVPNCRVPFKSALLGGVVVALLFETAKRSFTAFVTQFPSYELIYGAFAA 242

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYY 276
           +   L+++++  V  ++GAEL  +M +Y 
Sbjct: 243 VPLFLLWIFISWVIILMGAELTRTMAVYR 271


>gi|295677064|ref|YP_003605588.1| ribonuclease BN [Burkholderia sp. CCGE1002]
 gi|295436907|gb|ADG16077.1| ribonuclease BN [Burkholderia sp. CCGE1002]
          Length = 435

 Score =  142 bits (358), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 38/273 (13%), Positives = 98/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A +   E+    +A  ++ + +L++ P       L         F  ++ 
Sbjct: 8   LDTLKRLAQFAAQRIGEDRIPQVAGSLTFTTMLALVPLATVAFALFTAFPIFSSFQASLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL TI  +     +   +  +  + N  +RV 
Sbjct: 68  FFLADHLMPAQLNDQIFKYLNQFASKAKGLTTIGMIILFVTAVMTMMTVESAFNVIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R      L+ +  + L  + + +   +   +                +   + +  + 
Sbjct: 128 KARPVAQRILVYWAIITLGPILIGVSLSISSYLFTQSMSFSAAQRITPLIEWALASATLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            TML        ++++LP  + +    + G +   +++ +    F +Y+    TY+ +Y 
Sbjct: 188 FTML----AFTILYVYLPNCRVEWRDAVVGGVIAAVAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   LV++Y+     + GA + +++    
Sbjct: 244 AFAAVPLFLVWMYLCWFITLTGAMIASALPAIR 276


>gi|56964680|ref|YP_176411.1| hypothetical protein ABC2916 [Bacillus clausii KSM-K16]
 gi|56910923|dbj|BAD65450.1| conserved hypothetical protein [Bacillus clausii KSM-K16]
          Length = 276

 Score =  142 bits (358), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 61/268 (22%), Positives = 121/268 (45%), Gaps = 2/268 (0%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
                I     +    +A+ ++   +LS+FP ++F      F   +     V +++   +
Sbjct: 9   FTKKLIAQLKSDPIPDLAATLAFYFILSIFPLMIFVLAGVSFFEINN--DEVQNLINAYF 66

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P  I    +  +L  +  P  GL +I  L   + +SNG+ A   S+NRAY + E R +  
Sbjct: 67  PGEIGDTFSRIVLNTIGEPQAGLLSIGILGTLWSASNGINAFIRSVNRAYNIEETRHFLK 126

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            R I+ G  +   + ++I   + V     L  +  F      ++ ++ N R  A    + 
Sbjct: 127 LRSIAIGLTVGMVLLIIITLALPVFGNQILNLLEAFLLLPTEVVAMLDNFRWIAAFAIMI 186

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           + L+ ++   P AK +    L G IF  I W + +  F+ Y+  ++ Y + Y  LA ++ 
Sbjct: 187 VALMALYWIAPNAKQRFRDGLIGAIFATIGWQLISFFFSLYVSNYANYESTYGPLAGVII 246

Query: 251 CLVFLYMLGVFFILGAELNASMIIYYWR 278
            + + ++ G+  I+GAE+NA++     +
Sbjct: 247 LMFWFFLTGIILIVGAEINATLHHLRKK 274


>gi|332142905|ref|YP_004428643.1| hypothetical protein MADE_1017605 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|332143050|ref|YP_004428788.1| hypothetical protein MADE_1018330 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|288559237|sp|B4RYA6|Y3526_ALTMD RecName: Full=UPF0761 membrane protein MADE_03526
 gi|327552927|gb|AEA99645.1| hypothetical protein MADE_1017605 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327553072|gb|AEA99790.1| hypothetical protein MADE_1018330 [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 294

 Score =  142 bits (358), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 49/274 (17%), Positives = 103/274 (37%), Gaps = 8/274 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVIDVV 66
           + D+    I+   E++    A H++   LLS+ PFI+    +     A   V   +   V
Sbjct: 17  LRDLFGIFIKRCKEDNITISAGHLAYVTLLSLVPFIMVTFTIMSAFPAFASVRSKLEHFV 76

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
           F  +    +  +   +   +   ++ +  I  L+    +   +  +  +LNR +R    R
Sbjct: 77  FSNFVPTASDVVHKYMTDFVGNASQ-MSAIGILSLLVVALMLISNVDKTLNRIWRTQSDR 135

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
               T  I +  + L  + +     V   +    A+  ++ P LG               
Sbjct: 136 PIVYTFAIYWMVITLGPMLIGSSVVVSSYLTGLAAFTEEYTPGLGTF------LLSLVPS 189

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
            A  +    +++ +P  +        G I   I++ +    F  Y+  F +Y  +Y  LA
Sbjct: 190 GAALLAFAILYMVVPNRRVYARHAFVGAIVATIAFEITKSGFALYVTNFPSYELIYGALA 249

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            +    +++Y+  +  + GAE   S+   +  KK
Sbjct: 250 VVPILFLWVYLSWIIVLFGAEFTCSLGEAFENKK 283


>gi|300114145|ref|YP_003760720.1| ribonuclease BN [Nitrosococcus watsonii C-113]
 gi|299540082|gb|ADJ28399.1| ribonuclease BN [Nitrosococcus watsonii C-113]
          Length = 455

 Score =  142 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 46/267 (17%), Positives = 99/267 (37%), Gaps = 2/267 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R +       +Y     F + D    A+ +  + LLS+ P +    ++    G H  +  
Sbjct: 28  RAFLRQKAKFVYAVSREFFKGDLTLQATSLVYTTLLSLAPLLAVSFSVLKAFGIHNEIEP 87

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           V+            +  T  I  V  +    L ++      Y   + ++ +  + N  +R
Sbjct: 88  VLHHFLLPLGPRGEEITTKIIQYVENLKVGVLGSVGVGLLFYTVISLIQKVEGAFNHVWR 147

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           +   R +          +L+  V +        ++        +       L   +    
Sbjct: 148 IKAERPFARRFSDYLSVLLIGPVLVFSAVGATASVMQTS--FIQTLLDFELLGKTLVVMS 205

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                L +  G  F++LFLP  K ++ S L G     I W    +LF  ++ T + Y  +
Sbjct: 206 KLLPYLLVIAGFTFIYLFLPNTKVRLGSALVGGAVAGILWETIGILFAFFVTTSTKYDAI 265

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAEL 268
           Y+  A ++  +++LY+  +  ++GA++
Sbjct: 266 YSSFAIVILFMIWLYISWLVLLVGAQV 292


>gi|126172568|ref|YP_001048717.1| ribonuclease BN [Shewanella baltica OS155]
 gi|160873444|ref|YP_001552760.1| ribonuclease BN [Shewanella baltica OS195]
 gi|166199583|sp|A3CZD5|Y315_SHEB5 RecName: Full=UPF0761 membrane protein Sbal_0315
 gi|189039572|sp|A9KXA4|Y319_SHEB9 RecName: Full=UPF0761 membrane protein Sbal195_0319
 gi|125995773|gb|ABN59848.1| tRNA-processing RNAse BN [Shewanella baltica OS155]
 gi|160858966|gb|ABX47500.1| ribonuclease BN [Shewanella baltica OS195]
 gi|315265673|gb|ADT92526.1| ribonuclease BN [Shewanella baltica OS678]
          Length = 323

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 51/276 (18%), Positives = 107/276 (38%), Gaps = 8/276 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +R  F  ++  +       VE+     A H++   LLS+ P +    ++       + + 
Sbjct: 10  IRVLFLGIWHFLLHLRRRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFKGIR 69

Query: 61  -TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +   V+  +       +   I + +   +KG   +   A    +   + A+  SLN  
Sbjct: 70  GQIEGFVYENFLPAAGDTVQVYINEFVGNASKG-TAVGIAALVVVAIMLISAIDKSLNNI 128

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +R  E RS  +   + +  + L  V +         +     +  +    +  + +    
Sbjct: 129 WRTKEKRSVVVAFSMYWMVLTLGPVLVGASLVASSYVISLKVFEAEALSGMLPIFIAR-- 186

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                 ML      + +++ +P  K K +  L G I   + + +G   F  Y+  F +Y 
Sbjct: 187 ----LPMLFSVAAFLLLYMVVPNQKVKFLHALLGAIVAALLFELGKKGFALYVTQFPSYE 242

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            +Y  LA+I    V++Y+  +  +LGAE+ A+M  Y
Sbjct: 243 AIYGALATIPIVFVWVYLSWMIVLLGAEITAAMPEY 278


>gi|217971528|ref|YP_002356279.1| ribonuclease BN [Shewanella baltica OS223]
 gi|254789781|sp|B8E4B5|Y320_SHEB2 RecName: Full=UPF0761 membrane protein Sbal223_0320
 gi|217496663|gb|ACK44856.1| ribonuclease BN [Shewanella baltica OS223]
          Length = 323

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 51/276 (18%), Positives = 107/276 (38%), Gaps = 8/276 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +R  F  ++  +       VE+     A H++   LLS+ P +    ++       + + 
Sbjct: 10  IRVLFLGIWHFLLHLRRRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFKGIR 69

Query: 61  -TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +   V+  +       +   I + +   +KG   +   A    +   + A+  SLN  
Sbjct: 70  GQIEGFVYENFLPAAGDTVQVYINEFVGNASKG-TAVGISALVVVAIMLISAIDKSLNNI 128

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +R  E RS  +   + +  + L  V +         +     +  +    +  + +    
Sbjct: 129 WRTKEKRSVVVAFSMYWMVLTLGPVLVGASLVASSYVISLKVFEAEALSGMLPIFIAR-- 186

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                 ML      + +++ +P  K K +  L G I   + + +G   F  Y+  F +Y 
Sbjct: 187 ----LPMLFSVAAFLLLYMVVPNQKVKFLHALLGAIVAALLFELGKKGFALYVTQFPSYE 242

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            +Y  LA+I    V++Y+  +  +LGAE+ A+M  Y
Sbjct: 243 AIYGALATIPIVFVWVYLSWMIVLLGAEITAAMPEY 278


>gi|138894066|ref|YP_001124519.1| ribonuclease BN [Geobacillus thermodenitrificans NG80-2]
 gi|134265579|gb|ABO65774.1| Ribonuclease BN [Geobacillus thermodenitrificans NG80-2]
          Length = 273

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 60/270 (22%), Positives = 125/270 (46%), Gaps = 2/270 (0%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
            + +    F E++   +++ ++   LLS+FPF++F   L  +L        V+ +V    
Sbjct: 3   FVRELARRFTEDEIPRLSAELAYYFLLSLFPFLLFLMTLLAYLPIPH--EDVLALVRQYA 60

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+     I   +  ++ V    L ++S + A + +SNG+ A+  + NRAY V E R +++
Sbjct: 61  PKEALHLIETNVHHLMDVQNGKLLSLSIIGAVWSASNGMRAIMRAFNRAYDVEENRPFWV 120

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            R +S    L     +++   + V       ++          L +    R   + L LF
Sbjct: 121 ARGLSVALTLGMIAVIIVALVLPVFGRTIGLFLFSALGLSEQFLTVWNAFRWTTSSLLLF 180

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
                ++ F P  + + ++++ G +F    W+  ++ F +Y+  F+ Y+ MY  L  ++ 
Sbjct: 181 AVFTALYYFAPNKQLRCVNVVRGALFATAGWIATSLAFAYYVNHFANYTAMYGSLGGLIV 240

Query: 251 CLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            +++LY+ G+  +LG E+NA        +K
Sbjct: 241 LMIWLYLSGMILVLGGEMNAIFDCEREGRK 270


>gi|224370355|ref|YP_002604519.1| predicted tRNA processing ribonuclease Rbn (RNase BN)
           [Desulfobacterium autotrophicum HRM2]
 gi|223693072|gb|ACN16355.1| predicted tRNA processing ribonuclease Rbn (RNase BN)
           [Desulfobacterium autotrophicum HRM2]
          Length = 436

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 44/276 (15%), Positives = 106/276 (38%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           ++ +   VF  +  A++ F +++    AS ++   LLS+ P +     +A   G    + 
Sbjct: 22  LKAFATRVFLTVVAAVKGFQKDNCMLRASALTFYTLLSIVPVMAMAFGIAKGFGFETMLR 81

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
             I +      E   + I      +       +  +  +  A+     +  +  + N  +
Sbjct: 82  KEILLRLAGHEEAAQRIIDFSGTLLAETKGGVMAAVGVIFLAWAVVKMLGHMEDAFNTIW 141

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
            + + R+         G + +A + L++     V I   L    +    +  +   ++  
Sbjct: 142 WIKKGRTLVRKFSDYLGLLFVAPLLLILSGSTTVFILTRLKVFFEATGGVVFVEPFVFFF 201

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                   ++I   F+++F+P  K  I + + G +     + +G +++  + V  S Y+ 
Sbjct: 202 VKLLPFFTIWILFFFLYMFMPNKKVDIRAAVMGALIAGGVYQMGQMIYFRFQVGVSHYNA 261

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           +Y   A++   L++L    V  +LGAE+        
Sbjct: 262 IYGSFAALPLFLIWLQASWVLLLLGAEIAFVWEGRR 297


>gi|226945350|ref|YP_002800423.1| Ribonuclease BN protein [Azotobacter vinelandii DJ]
 gi|226720277|gb|ACO79448.1| Ribonuclease BN protein [Azotobacter vinelandii DJ]
          Length = 289

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 58/271 (21%), Positives = 123/271 (45%), Gaps = 1/271 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           +++  A++ F++++    AS ++   L S+FPF++F   L GFL   +F   +       
Sbjct: 13  EVLKCAVKDFMDDEMPTYASALAFQMLFSLFPFLLFLIALIGFLDLQKFFDWLQQQAALL 72

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P      +   I Q       GLF++  +AA + +S GV +   ++N+AY V E R  +
Sbjct: 73  LPAQAMDTVNSVIAQFQQE-RAGLFSLGIVAALWTASAGVRSTMQAMNKAYDVAESRPAW 131

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
               +S  Y +  ++ L+  + + +  P  + ++  +      ++ +    R    +L L
Sbjct: 132 KRIPLSVLYTVGIALMLLSAAGLMLIGPEVMTWLAGWVGLEQLIVTLWTWLRWPVAILLL 191

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + +  ++   P  + +   I PG +   + W+  ++ F  Y+  F  Y   Y  + +I+
Sbjct: 192 ILVVAVIYYVAPDVEQRFRFITPGSVLAVLVWIATSLGFGFYVGNFGNYDATYGSVGAII 251

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             L++ ++     + GAELNA +   +   K
Sbjct: 252 VMLLYFFISAAVLLFGAELNAVIEHRHPEGK 282


>gi|307942625|ref|ZP_07657973.1| YihY family protein [Roseibium sp. TrichSKD4]
 gi|307774264|gb|EFO33477.1| YihY family protein [Roseibium sp. TrichSKD4]
          Length = 284

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 124/275 (45%), Positives = 167/275 (60%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV 62
                 + ++ DA+ HFV +DG+AMASH++LSALL+VFP ++F A LAGF+G H      
Sbjct: 5   RTITTTYLVLKDALGHFVNDDGYAMASHVALSALLAVFPLLIFIAALAGFMGFHDAADRA 64

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
            ++VF AWPE +AKP+ DEI +VL VP   L T   + A +F+SNGVEA+R +LNRAYR 
Sbjct: 65  SNLVFDAWPENVAKPLVDEIHRVLTVPRGDLLTFGVVGALWFASNGVEAMRSALNRAYRQ 124

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E RS    RL S G V+L +V L+  +F+ V  PL +  V  + PA    L+ I   R 
Sbjct: 125 QEKRSIVFLRLQSLGLVILGAVVLIAYTFLVVLAPLVIKTVVNWIPAAEEFLVTIDVARY 184

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
                 L IGL+  H  LP+   K   +LPGV+ T + W+V   +F  Y+  F+TY T Y
Sbjct: 185 SVAGSLLTIGLLLTHWILPSGSRKFRELLPGVVATLVMWMVAGAVFGAYLAKFATYVTTY 244

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
            GLA IM+ +VFLY+  + FILG ELNASMI    
Sbjct: 245 GGLAGIMSAVVFLYICSLGFILGGELNASMIRLRR 279


>gi|114763244|ref|ZP_01442668.1| Ribonuclease BN [Pelagibaca bermudensis HTCC2601]
 gi|114544042|gb|EAU47052.1| Ribonuclease BN [Roseovarius sp. HTCC2601]
          Length = 313

 Score =  142 bits (357), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 58/266 (21%), Positives = 106/266 (39%), Gaps = 8/266 (3%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
              +   E+    +A+ ++   LL++FP I     +AG       V   I  +    P+ 
Sbjct: 25  RVKDGIGEDRLSLIAAGVAFFGLLAIFPAITALMAVAGLFLTPADVTDQIQQISAMLPDR 84

Query: 74  IAKPITDEILQVLAV---PAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
            A+ + D+   V             +    A Y +S GV  L   LN AY   E R +  
Sbjct: 85  AAEIVIDQAKSVAGSDQGGLGLAALLGLGLALYSASAGVGNLVAGLNVAYGERESRGFVK 144

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            +L +     L  V LV+     + +P  LA +    P  G   L++   R    +    
Sbjct: 145 LKLTTMALTFLLIVGLVLAFAGVLILPGVLAVI----PLGGTAELLVSGLRWVLLLGFTV 200

Query: 191 IGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           + +  ++ F P  +  +   + PG     + W+V +V F+ Y   F +Y   +  LA ++
Sbjct: 201 LAVALIYHFGPDRRPARWRWVTPGAAIACLLWIVTSVGFSIYAENFGSYQETFGSLAGVV 260

Query: 250 TCLVFLYMLGVFFILGAELNASMIIY 275
             L +L++     +LG ++NA +   
Sbjct: 261 ILLFWLWISAFVVLLGGKINAELEHQ 286


>gi|261418745|ref|YP_003252427.1| ribonuclease BN [Geobacillus sp. Y412MC61]
 gi|319765561|ref|YP_004131062.1| ribonuclease BN [Geobacillus sp. Y412MC52]
 gi|261375202|gb|ACX77945.1| ribonuclease BN [Geobacillus sp. Y412MC61]
 gi|317110427|gb|ADU92919.1| ribonuclease BN [Geobacillus sp. Y412MC52]
          Length = 277

 Score =  142 bits (357), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 64/272 (23%), Positives = 128/272 (47%), Gaps = 2/272 (0%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
              I + +  F E++   +++ ++   LLS+FPF++F   L  +L        V+ +V  
Sbjct: 5   LAFIRELVRRFTEDEIPRLSAELAYYFLLSLFPFLLFLMTLLAYLPIPH--EDVLALVRQ 62

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
             P+     I   + +++     GL + S +AA + +SNG+ A+  + NRAY V E R +
Sbjct: 63  YAPKEALHLIETNVYRLMNEQNGGLLSFSIIAAIWSASNGMSAIMRAFNRAYDVQEDRPF 122

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +I R +S    L   + +++   + V   +   ++          L +    R   + L 
Sbjct: 123 WIVRGLSIVLTLGMIMVIIVALVLPVFGRIIGLFLFSALGLSQQFLEVWNAFRWVTSSLL 182

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LF     ++ F P  + + ++++ G +F    W+  ++ F +Y+  F+ Y+ MY  L  +
Sbjct: 183 LFAVFTALYYFAPNKQLRCVNVVRGALFATAGWIAASLAFAYYVNNFADYTAMYGSLGGM 242

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +  +V+ Y+ G+  +LG ELNA        K+
Sbjct: 243 IVLMVWFYLSGMILVLGGELNAMFDCEREGKR 274


>gi|152965485|ref|YP_001361269.1| ribonuclease BN [Kineococcus radiotolerans SRS30216]
 gi|151360002|gb|ABS03005.1| putative ribonuclease BN [Kineococcus radiotolerans SRS30216]
          Length = 317

 Score =  142 bits (357), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 51/269 (18%), Positives = 113/269 (42%), Gaps = 10/269 (3%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
              +   A     ++    +A+ ++  A L++FP +     + G  G    + + I+ + 
Sbjct: 22  WLAVTKRAWAEAKDDQVPLLAAGVAFKAFLAIFPALTAAFLIWGIFGDTAQITSQINGIT 81

Query: 68  GAWPEVIAKPITDEILQVLAVPAKG--LFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
              PE     +T ++  V    +       ++ + A + +S+GV+ L  + N AY   E 
Sbjct: 82  A-IPEEARNLVTSQVQNVANGKSTAGITAIVAVVLALWSASSGVQNLMAATNTAYDEKET 140

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R +   +  +    L A V +++   +    P+ +  +     A G + L++   R    
Sbjct: 141 RGFVKLKGTALLLTLGAIVFMLLAIALIGVAPVLVKAL----GASGLVSLVVNVLRWVLL 196

Query: 186 MLALFIGLIFVHLFLPAAKSKI-MSILPGVIFTWISWVVGAVLFTHYIVTFS--TYSTMY 242
           +  L + L  V+   P   +     +  G     + W++ +  F+ Y+ T    +Y+  Y
Sbjct: 197 LGLLLVALAVVYRVAPDRDAPRAKWVSVGAGVATVLWLIVSAGFSIYVSTAGQSSYAKNY 256

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNAS 271
             +A ++  L++L++     +LGAE+NA 
Sbjct: 257 GSMAGVVVLLMWLWLTSYAILLGAEVNAE 285


>gi|254476019|ref|ZP_05089405.1| ribonuclease BN [Ruegeria sp. R11]
 gi|214030262|gb|EEB71097.1| ribonuclease BN [Ruegeria sp. R11]
          Length = 309

 Score =  142 bits (357), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 56/278 (20%), Positives = 106/278 (38%), Gaps = 8/278 (2%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV 62
                   +++ A +      G  +A+ ++   LLSVFP +     L G       +   
Sbjct: 35  RRLPRWARLMWHAWQRMDRAKGGLLAAGVAFYGLLSVFPGMTAAVALFGMFADPTVITEQ 94

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLNRA 119
              +    P   A  +  +++ V       L   + L    A + +S    +L   LN  
Sbjct: 95  SAWLTRLLPPSAADLLNGQLVDVAMERPDRLGWAAILSISIAFWSASRAANSLMQGLNVI 154

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           Y   E R   +  +        A V  + +  V  AIP ALA     F     L  I   
Sbjct: 155 YNRAERRGMVMLYIRQLIITFAAIVGALFLVLVVAAIPAALAL----FGDSPLLSDIAQV 210

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTY 238
            R     ++  +G+  ++ F P  +  +   I PG   +   WV G++ F++Y+  F +Y
Sbjct: 211 VRWPLMFVSGMVGISLLYRFGPDRRGEEWHRITPGAFVSCSLWVAGSIGFSYYVRVFGSY 270

Query: 239 STMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           S  +  L+ ++  L ++++     + GA ++A    + 
Sbjct: 271 SETFGTLSGVVLLLTWMWLSAFVVLYGAGIDAERPEHR 308


>gi|320108330|ref|YP_004183920.1| ribonuclease BN [Terriglobus saanensis SP1PR4]
 gi|319926851|gb|ADV83926.1| ribonuclease BN [Terriglobus saanensis SP1PR4]
          Length = 324

 Score =  141 bits (356), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 55/272 (20%), Positives = 110/272 (40%), Gaps = 3/272 (1%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQF--VPTVIDVVFG 68
           +        +E++ +  AS ++     ++FP ++  +++ G            ++D +  
Sbjct: 36  VAKRTWTAVIEDNLFGRASQLAYYFFFALFPTLIAMSSVMGLAAKSATHIYVQLLDKIAS 95

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
             P      + D   Q     +    T+  L A + +S GV A++ +LN  Y+V E RS+
Sbjct: 96  LVPPAAFGIVMDTFHQTTQASSTRKVTLGLLTALWSASVGVSAIQDTLNAVYKVKETRSY 155

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +  R  +    +  S+ L       +   +    VR  F     + +           L 
Sbjct: 156 WRARGEAMVLTIAVSLVLTAALGALLGGSIGAELVRYKFSGAIAVSIATRTVAWIVATLL 215

Query: 189 LFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
           + +    ++ F P   K K     PG     + WV+G++    Y+  F +YS  Y  L +
Sbjct: 216 MVLIFALLYFFSPDVQKRKWHWFSPGSAIGLLGWVLGSLGLRLYLHWFDSYSVTYGSLGA 275

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           ++  L + Y+ G+  +LGAE+N+ +      K
Sbjct: 276 VIILLTWFYVAGLMLLLGAEVNSEIEAAVAEK 307


>gi|167587384|ref|ZP_02379772.1| Ribonuclease BN [Burkholderia ubonensis Bu]
          Length = 442

 Score =  141 bits (356), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 38/273 (13%), Positives = 96/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVI 63
              +  +   A +   E+    +A  ++ + +L++ P +     L            ++ 
Sbjct: 8   LDTIKRLARFAAKRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFASFQISLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL T   +     S   +  +  + N  +RV 
Sbjct: 68  GFLADHLMPAQFNIQIFKYLNQFASKAKGLTTAGLIVLVVTSVMTMMTIESAFNLIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  +  + L  +   +   +   +           P    +  ++    + 
Sbjct: 128 KPRPFAQRVLAYWALITLGPLLFGVSLSISSYLFTQSLAFTGAAPTTSVVEWLLTFASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP         + G +F  I++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTVL----AFTLLYVYLPNCTVAWRDAVVGGLFAAIAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     +LG  + +++    
Sbjct: 244 AFAALPVFLLWVYLSWFIALLGGMVTSALPAIR 276


>gi|56418955|ref|YP_146273.1| transporter [Geobacillus kaustophilus HTA426]
 gi|56378797|dbj|BAD74705.1| transporter [Geobacillus kaustophilus HTA426]
          Length = 277

 Score =  141 bits (356), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 65/272 (23%), Positives = 127/272 (46%), Gaps = 2/272 (0%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
              I +    F E++   +++ ++   LLS+FPF++F   L  +L        V+ +V  
Sbjct: 5   LAFIRELARRFTEDEIPRLSAELAYYFLLSLFPFLLFLMTLLAYLPIPH--EDVLALVRQ 62

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
             P+     I   + +++     GL + S +AA + +SNG+ A+  + NRAY V E R +
Sbjct: 63  YAPKEALHLIETNVYRLMNEQNGGLLSFSIIAAIWSASNGMSAIMRAFNRAYDVQEDRPF 122

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
           +I R +S    L   V +++   + V   +   ++          L +    R   + L 
Sbjct: 123 WIVRGLSIVLTLGMIVVIIVALVLPVFGRIIGLFLFSALGLSQQFLEVWNAFRWVTSSLL 182

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           LF     ++ F P  + + ++++ G +F    W+  ++ F +Y+  F+ Y+ MY  L  +
Sbjct: 183 LFAVFTALYYFAPNKQLRCVNVVRGALFATAGWIAASLAFAYYVNNFADYTAMYGSLGGM 242

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +  +V+ Y+ G+  +LG ELNA        K+
Sbjct: 243 IVLMVWFYLSGMILVLGGELNAMFDCEREGKR 274


>gi|196250266|ref|ZP_03148959.1| ribonuclease BN [Geobacillus sp. G11MC16]
 gi|196210155|gb|EDY04921.1| ribonuclease BN [Geobacillus sp. G11MC16]
          Length = 277

 Score =  141 bits (356), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 60/270 (22%), Positives = 125/270 (46%), Gaps = 2/270 (0%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
            + +    F E++   +++ ++   LLS+FPF++F   L  +L        V+ +V    
Sbjct: 7   FVRELARRFTEDEIPRLSAELAYYFLLSLFPFLLFLMTLLAYLPIPH--EDVLALVRQYA 64

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P+     I   +  ++ V    L ++S + A + +SNG+ A+  + NRAY V E R +++
Sbjct: 65  PKEALHLIETNVHHLMDVQNGKLLSLSIIGAVWSASNGMRAIMRAFNRAYDVEENRPFWV 124

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            R +S    L     +++   + V       ++          L +    R   + L LF
Sbjct: 125 ARGLSVALTLGMIAVIIVALVLPVFGRTIGLFLFSALGLSEQFLTVWNAFRWTTSSLLLF 184

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
                ++ F P  + + ++++ G +F    W+  ++ F +Y+  F+ Y+ MY  L  ++ 
Sbjct: 185 AVFTALYYFAPNKQLRCVNVVRGALFATAGWIATSLAFAYYVNHFANYTAMYGSLGGLIV 244

Query: 251 CLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            +++LY+ G+  +LG E+NA        +K
Sbjct: 245 LMIWLYLSGMILVLGGEMNAIFDCEREGRK 274


>gi|163750691|ref|ZP_02157927.1| ribonuclease BN [Shewanella benthica KT99]
 gi|161329535|gb|EDQ00527.1| ribonuclease BN [Shewanella benthica KT99]
          Length = 314

 Score =  141 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 43/266 (16%), Positives = 98/266 (36%), Gaps = 8/266 (3%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVIDVVFGAWPEVIA 75
           +   E+     A H++   LLS+ P +    ++         +   +   ++  +     
Sbjct: 6   QRLAEDQINIRAGHLAYVTLLSLVPMVTVTMSMLSAFPVFSDIRGQIESFIYDNFLPAAG 65

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
             +   I + +   +KG   +   A    +   +  +  SLN  +R  E RS  ++  + 
Sbjct: 66  DSVQVYINEFVDNASKG-TAVGIAALMVVAIMLISNIDKSLNSIWRTTEKRSIAVSFSMY 124

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIF 195
           +  + L  V +         +     +         ++   +        +       + 
Sbjct: 125 WMVLTLGPVLMGASLVATSYVVSLKVFSGA------DISGFVPLLVERLPLFFSVATFLL 178

Query: 196 VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFL 255
           +++ +P  K K    L G +   + +  G   F  Y+  F +Y  +Y  LA I    V++
Sbjct: 179 IYMVVPNTKVKFFHALLGAVAAALLFEFGKKGFAFYLTEFPSYEAIYGALAVIPILFVWV 238

Query: 256 YMLGVFFILGAELNASMIIYYWRKKP 281
           Y+  +  ++GAE+ A++  Y  +K P
Sbjct: 239 YLSWIIVLIGAEITAALPEYLDKKLP 264


>gi|188994855|ref|YP_001929107.1| putative ribonuclease BN [Porphyromonas gingivalis ATCC 33277]
 gi|188594535|dbj|BAG33510.1| putative ribonuclease BN [Porphyromonas gingivalis ATCC 33277]
          Length = 475

 Score =  141 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 42/275 (15%), Positives = 101/275 (36%), Gaps = 3/275 (1%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV 62
                 F  ++  I +F++ D    AS ++   +LS+ P +     +A   G  Q V   
Sbjct: 63  RLMINSFKSVFLTIRYFIQNDLATQASALTYRTILSIVPMLAVLIGIAKGFGIQQVVHDW 122

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
           +        + + + +      +  V       +  +   Y   + +  +  +    ++ 
Sbjct: 123 LKEYLPGHQQELEQALGYVENYLAQVQGGIFVGVGLIVLLYTVFSLIATVEDTFTDIWQT 182

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            + R+W    +   G   L  + +   S + + +          +   G +L +I N   
Sbjct: 183 NKRRTWKRRVIDYMGAFFLLPILITASSGLTLMMTTIKGTYFSEYILFGPMLELILNLIP 242

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
           Y  ++ LF G   +++ LP    +        +   I + +   L+   I+  S Y+ +Y
Sbjct: 243 YVIIVLLFTG---MYIVLPTVNVRFWPAFISGVLAGIVFQIFQALYISGILWISKYNAIY 299

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
              A++   L+++ +     + GA+L+ S+     
Sbjct: 300 GSFAAVPLLLLWIQLSWTIVLFGAQLSFSIQNVRK 334


>gi|269925355|ref|YP_003321978.1| ribonuclease BN [Thermobaculum terrenum ATCC BAA-798]
 gi|269789015|gb|ACZ41156.1| ribonuclease BN [Thermobaculum terrenum ATCC BAA-798]
          Length = 319

 Score =  141 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 51/281 (18%), Positives = 111/281 (39%), Gaps = 13/281 (4%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFL----GAHQFVPTVI 63
           + D++    +   E+     A+ ++   + ++FPF+ F  ++ G      G       + 
Sbjct: 28  IADLLKQVWKEASEDHLGDFAASLTYHGIFAIFPFLTFLISMLGIFDKVLGVFDTSQLIK 87

Query: 64  DVV-----FGAWPEVIAKPITDEILQVLAVPAKGLFTIS----ALAAAYFSSNGVEALRI 114
           D +       A P  +   +  +I +++     G FT       L A +  S    ++  
Sbjct: 88  DFLSRPQVRQAIPVEVIDFVQQQIDRLIGNIRPGTFTTGAIVSVLLALWGVSGAFRSIME 147

Query: 115 SLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL 174
           SLN  Y + + R  +   LIS    ++A + L+    + V  P    ++ +         
Sbjct: 148 SLNVVYEIKDSRPIWKKYLISIMLSVIAVLLLLSAGILAVFGPKIADWLARTTGLGTLFA 207

Query: 175 LIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVT 234
                 +    +L   +    ++ + P  K  +  + PG I   + W+V  ++F+ Y+  
Sbjct: 208 WSWKIAQWPLLILIALLAFALIYHYGPDIKQPLRLVTPGSILALLGWLVFTLIFSLYVNN 267

Query: 235 FSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           F  Y+  Y  LA  +  ++++Y      ++G E+N  +  Y
Sbjct: 268 FGNYNKTYGTLAGAILLMLYMYYSSYILLMGGEVNHVVETY 308


>gi|329113280|ref|ZP_08242063.1| Putative ribonuclease-like protein YfkH [Acetobacter pomorum DM001]
 gi|326697421|gb|EGE49079.1| Putative ribonuclease-like protein YfkH [Acetobacter pomorum DM001]
          Length = 356

 Score =  141 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 56/273 (20%), Positives = 119/273 (43%), Gaps = 9/273 (3%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           I+   ++  +      +A+  +    LS+FP I    ++ G     Q V   ++V+    
Sbjct: 74  ILQRTVKSLISGPTTLVAAGCAFYTTLSLFPAISSLISIYGLAFDVQTVAPQMEVLRNLL 133

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLNRAYRVVEMRS 127
           P      + D +  ++A P   L     +    A + +S    ++  +LN AY   E R+
Sbjct: 134 PPNAFTLLYDRVQTLVAEPPSSLTFNLIISVSVALWSASAATRSIISALNIAYNTRENRN 193

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           ++I ++ +F   L   +  V+   + VA+PL L  +            I +  R    ++
Sbjct: 194 FFIFQITAFALTLCGILGAVLTLALMVAMPLLL-NLPALLHIPTPPGSIEFMARWSGPVV 252

Query: 188 ALF---IGLIFVHLFLPAAKS--KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
                 + L  ++ F P      +   +LPG + + ++W+  ++ F++Y+   ++YS  Y
Sbjct: 253 MFTFETLALSALYRFGPNRHISTQWRWVLPGAVCSTLTWIAASLGFSYYVAHIASYSATY 312

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
             L + +  +++ ++     ++GAELNA M  Y
Sbjct: 313 GPLGAFIAIMMWFFVTAWVVLMGAELNAEMESY 345


>gi|315121834|ref|YP_004062323.1| ribonuclease protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495236|gb|ADR51835.1| ribonuclease protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 284

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 225/280 (80%), Positives = 255/280 (91%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M++YF I+F+I+YDA+EHFVEEDGWAMASHISL+ALLSVFPFIVF ANLAGFLGAH+FVP
Sbjct: 1   MQKYFGIIFNIVYDAVEHFVEEDGWAMASHISLAALLSVFPFIVFCANLAGFLGAHEFVP 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           TVI V FGAWP+VIAKPITDEI QVLAVP KGLFTISALAA YFSSNG+EALR+SLNRAY
Sbjct: 61  TVISVFFGAWPDVIAKPITDEIFQVLAVPRKGLFTISALAAVYFSSNGIEALRVSLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RVVEMRSWYITRLIS GYVLLAS+TLVIMSF+FV +PLALAYV+  FP+LGN++ I+WNG
Sbjct: 121 RVVEMRSWYITRLISLGYVLLASITLVIMSFIFVVVPLALAYVKTLFPSLGNMVEIVWNG 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R+Y  +LALFIGLIFVHLFLPA K K+  +LPG+IFT ISW++GAVLFTHYIVTFSTYS 
Sbjct: 181 RLYGAVLALFIGLIFVHLFLPAGKRKVWIVLPGIIFTSISWLIGAVLFTHYIVTFSTYSA 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           MYAGLASI  CLVFLYMLGV FI+GAE+NAS II+YW K+
Sbjct: 241 MYAGLASITICLVFLYMLGVIFIIGAEINASTIIHYWEKR 280


>gi|110802092|ref|YP_697602.1| YihY family protein [Clostridium perfringens SM101]
 gi|110682593|gb|ABG85963.1| YihY family protein [Clostridium perfringens SM101]
          Length = 283

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 65/278 (23%), Positives = 134/278 (48%), Gaps = 2/278 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           + +       +   I+   ++D +A+ + ++   +LS  PF++F  NL GF   +    T
Sbjct: 6   KGFLRKTVIFLVMFIKKIGDDDIFALGAQLAYYMVLSFIPFLMFLMNLVGFSHLNS--DT 63

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           +++++    P      I   +++++     GL  IS   A + SS+G +A+   LN+AY 
Sbjct: 64  ILNLLSNVMPTEAFNLIQSTVIEIVDKEQTGLLWISIALAIWVSSSGFKAVIKGLNKAYG 123

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E RS+   +LIS  Y +L ++ ++   F+FV   +   +  K       +  I    R
Sbjct: 124 VKETRSYIKLKLISMIYTILLALIVIATLFLFVFGDVIGDFFIKVLEHPEVIYYIWNMLR 183

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
               +L + +  +F++   P  +   + ++PG + T + W+  + +F +Y+  FS YS +
Sbjct: 184 YVVVILIMVLFFMFLYNATPCVRLGWLEVIPGAVITTLGWISISYIFAYYVNNFSNYSRL 243

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           Y  L ++   + ++++  +  ILG E+NA +      K
Sbjct: 244 YGSLGAVFMFMTWMFITSMILILGGEINAVLAEKNRLK 281


>gi|323526753|ref|YP_004228906.1| ribonuclease BN [Burkholderia sp. CCGE1001]
 gi|323383755|gb|ADX55846.1| ribonuclease BN [Burkholderia sp. CCGE1001]
          Length = 436

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 37/273 (13%), Positives = 97/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A +   E+    +A  ++ + +L++ P       L         F  ++ 
Sbjct: 8   LDTLKRLAQFAAKRSGEDRIAQVAGSLTFTTMLALVPLATVAFALFTAFPLFSSFQESLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL TI  +         +  +  + N  +RV 
Sbjct: 68  FFLADHLMPAQLNSQIFKYLNQFASKAKGLTTIGMVLLFLTGVMTMMTIESAFNVIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R      L+ +  + L  + + +   +   +          F A   +  +I      
Sbjct: 128 KARPIAQRILVYWAIITLGPILIGVSLSISSYLFTQSM----TFSAAQRMTPVIEWALAG 183

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
             +    +    ++++LP  + +    + G +   I++ +    F +Y+    TY+ +Y 
Sbjct: 184 TALPLTALAFTILYVYLPNCRVEWRDAVIGGVTAAIAFELAKRGFGYYVRRMPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             +++   L+++Y+     + GA + +++    
Sbjct: 244 AFSAVPLFLLWMYLCWFITLAGAMIASALPAIR 276


>gi|23010564|ref|ZP_00051208.1| COG1295: Predicted membrane protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 310

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 107/277 (38%), Positives = 159/277 (57%), Gaps = 1/277 (0%)

Query: 4   YFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI 63
               VFD+   A + FV  DGWA+ASHI+LS L S+FPF++  A LAG  G+        
Sbjct: 13  RLRKVFDVAGLAAQRFVAHDGWAIASHIALSMLTSLFPFLILVAALAGLFGSKSLADEAG 72

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
            ++F A P  +AKPI  E+ ++L     G+ T+ AL A YFSS+GVE+LR+ LNRAY + 
Sbjct: 73  TLIFDAVPREVAKPIVGEVHRLLTEQRGGVLTLGALLALYFSSSGVESLRVGLNRAYGIR 132

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           EMR W++TRL S GYV+  +  ++  +F+ V  PL    +    P L  L L +  GRI 
Sbjct: 133 EMRPWWLTRLESIGYVVCGAFAMLAFAFLVVLGPLIWRQLVFVAPGLEPLGLTVAIGRIV 192

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST-YSTMY 242
            T + + + L+  H F+ A +   +S++PG+  T   W +  + F  Y+  FS  Y++ Y
Sbjct: 193 ITAVLIAMVLVIAHKFVAAGRRPFLSVMPGIAVTLGLWFLAGLGFGFYLDRFSNAYASTY 252

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            GLA+ M  LVFLY L   F+ G E+N ++I    ++
Sbjct: 253 GGLATAMIFLVFLYWLAAMFLFGGEVNGTVIAARRQR 289


>gi|209963912|ref|YP_002296827.1| tRNA-processing ribonuclease BN [Rhodospirillum centenum SW]
 gi|288559240|sp|B6IRC8|Y578_RHOCS RecName: Full=UPF0761 membrane protein RC1_0578
 gi|209957378|gb|ACI98014.1| tRNA-processing ribonuclease BN [Rhodospirillum centenum SW]
          Length = 444

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 52/270 (19%), Positives = 104/270 (38%), Gaps = 11/270 (4%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH-QFVPTVIDVVFGA 69
           ++  A+  F   +G+A+A+ ++ + LL++ P +     +     A+ +   T  +++F +
Sbjct: 24  VVRHAVPRFWNNNGFAIAASLTYTTLLALVPLLTVTFAIFSAFPAYGRLRDTARELIFDS 83

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
               ++  +     Q ++  A  L     +  +  S     ++  +LN  +R  E R   
Sbjct: 84  LAPSVSDEVQAYFDQFISN-AAALTGFGVIGLSLTSILLFFSVEAALNVIFRATEPRPLV 142

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           I  L  +  + +  + L     V   +   L    +           +   R     L  
Sbjct: 143 IRLLSFWAVLTIMPLLLGASLSVTSGVVADLQATGRD---------AVTVLRFMLPGLLE 193

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
                 + L +P  + +    L G I   +   V  V F  YI  F TY T+Y  L+ I 
Sbjct: 194 AAAFTLMFLMIPNREVQWFDALVGGIAAALLMEVSKVGFGLYIAAFPTYETIYGALSVIP 253

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             L +LY +    + GAE+ A++  +   K
Sbjct: 254 IFLFWLYTVWSVVLFGAEITATLPEWRAGK 283


>gi|258543569|ref|YP_003189002.1| t-RNA-processing ribonuclease BN [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634647|dbj|BAI00623.1| t-RNA-processing ribonuclease BN [Acetobacter pasteurianus IFO
           3283-01]
 gi|256637703|dbj|BAI03672.1| t-RNA-processing ribonuclease BN [Acetobacter pasteurianus IFO
           3283-03]
 gi|256640757|dbj|BAI06719.1| t-RNA-processing ribonuclease BN [Acetobacter pasteurianus IFO
           3283-07]
 gi|256643812|dbj|BAI09767.1| t-RNA-processing ribonuclease BN [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646867|dbj|BAI12815.1| t-RNA-processing ribonuclease BN [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649920|dbj|BAI15861.1| t-RNA-processing ribonuclease BN [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652910|dbj|BAI18844.1| t-RNA-processing ribonuclease BN [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655964|dbj|BAI21891.1| t-RNA-processing ribonuclease BN [Acetobacter pasteurianus IFO
           3283-12]
          Length = 356

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 56/273 (20%), Positives = 119/273 (43%), Gaps = 9/273 (3%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           I+   ++  +      +A+  +    LS+FP I    ++ G     Q V   ++V+    
Sbjct: 74  ILQRTVKSLISGPTTLVAAGCAFYTTLSLFPAISSLISIYGLAFDVQTVAPQMEVLRSLL 133

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLNRAYRVVEMRS 127
           P      + D +  ++A P   L     +    A + +S    ++  +LN AY   E R+
Sbjct: 134 PPNAFNLLYDRVQTLVAEPPSSLTFNLIISVSVALWSASAATRSIIAALNIAYNTRENRN 193

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           ++I ++ +F   L   +  V+   + VA+PL L  +            I +  R    ++
Sbjct: 194 FFIFQITAFALTLCGILGAVLTLALMVAMPLLL-NLPALLHIPTPPGSIEFMARWSGPVV 252

Query: 188 ALF---IGLIFVHLFLPAAKS--KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
                 + L  ++ F P      +   +LPG + + ++W+  ++ F++Y+   ++YS  Y
Sbjct: 253 MFTFETLALSALYRFGPNRHISTQWRWVLPGAVCSTLTWIAASLGFSYYVAHIASYSATY 312

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
             L + +  +++ ++     ++GAELNA M  Y
Sbjct: 313 GPLGAFIAIMMWFFVTAWVVLMGAELNAEMESY 345


>gi|302877777|ref|YP_003846341.1| ribonuclease BN [Gallionella capsiferriformans ES-2]
 gi|302580566|gb|ADL54577.1| ribonuclease BN [Gallionella capsiferriformans ES-2]
          Length = 400

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 51/275 (18%), Positives = 97/275 (35%), Gaps = 7/275 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH-QFVPTVIDVV 66
           +F  I      F ++    +AS ++ + LLSV P I     L         F   +   +
Sbjct: 6   LFSFIRFVAARFRQDRCVQIASSLTFTTLLSVVPLITIALTLFSAFPVFGDFSTQIKTYL 65

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            G      A  +    ++  A  A  L  +  L     +   +  +  + N  +RV   R
Sbjct: 66  LGNLMPETAGRVITHYMEQFAESAGRLSALGVLFLTVTAMLMMLTIDHAFNIIWRVSRPR 125

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           +     +I +  + LA V +     +   +        K  P  G  +           +
Sbjct: 126 TLLKRLVIYWAVLTLAPVLVGASLSLTSWLVGLSMGYAKNIPFFGVGM------LKALPV 179

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           +   +    +   +P     +   L G I     +     +F +YI  F TY  +Y   A
Sbjct: 180 IFTTLAFAMLFRLVPNRYVPLSHALIGGIVASALFETMNRVFGYYISHFPTYKLVYGAFA 239

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
           S+   L+++Y   +  +LGA + AS+  +   + P
Sbjct: 240 SVPIFLMWVYFSWLTILLGAVVAASLPHWRTTEAP 274


>gi|311695820|gb|ADP98693.1| ribonuclease BN [marine bacterium HP15]
          Length = 453

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 43/267 (16%), Positives = 100/267 (37%), Gaps = 5/267 (1%)

Query: 5   FCIVFDIIYDAI---EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +  ++ +   A       +       A  +  + LLS+ P +    ++   LG HQ +  
Sbjct: 29  WTWLYKVGRTAYAMARDVLSGQLTLHAMSLVYTTLLSIVPLLALSFSVLKALGVHQRMEP 88

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
            +   F              +  V  +    L ++      Y   + ++ +  S N  +R
Sbjct: 89  FLFQFFEPLGPQGIDLAEQILGFVDNMKVGVLGSVGLALLVYTVVSLLQKIERSFNMIWR 148

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V +MRS           +++  + +V    V   I    + + +    +     +I    
Sbjct: 149 VPDMRSMAQRFSNYLSVIMVGPLLMVSAIGVSATI--FSSTIVQKLIEIEPFGSVILVAS 206

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
            +     +     FV++F+P  + K+     G +   +SW    +LF  ++   + Y+ +
Sbjct: 207 RFTPFFLVVGAFTFVYVFMPNTRVKLRYAAIGGLVAGVSWQAAGMLFASFVAGSAKYAAI 266

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAEL 268
           Y+  A  +  L+++Y+  +  +LGA +
Sbjct: 267 YSSFAIGIILLIWIYLNWMILLLGASI 293


>gi|326330668|ref|ZP_08196972.1| ribonuclease BN [Nocardioidaceae bacterium Broad-1]
 gi|325951509|gb|EGD43545.1| ribonuclease BN [Nocardioidaceae bacterium Broad-1]
          Length = 328

 Score =  140 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 56/268 (20%), Positives = 117/268 (43%), Gaps = 8/268 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
              ++  A      +    +A+ ++  + L+VFP ++    L G +     V   +D + 
Sbjct: 26  WVQVVKRAWREAKSDQLPLLAAGVAFYSFLAVFPAMIAAVMLYGLVRDPGDVQREVDELS 85

Query: 68  GAWPEVIAKPITDEILQV---LAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
              P   A  +T ++  +    +        +S + A + +S GV ++  ++N AY   E
Sbjct: 86  QTLPSDAASVLTTQLEAITSTSSGSLGLGLLVSLVLALWSASGGVGSIMSAVNIAYDEEE 145

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R +   +L+S G  + A V +++   +    P  L  +    P    L       R   
Sbjct: 146 TRGFVKRKLLSLGLTVAAIVFVIVTISLVAVAPALLDNLVDAGPVRWGLEA----ARWVG 201

Query: 185 TMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            ++A+ I L  ++   P    +++  +  G +   + W+V +V F+ Y+  F +Y+  Y 
Sbjct: 202 LVVAMSIALAVLYKVAPDRDDAELRWVSVGAVVATVLWLVASVGFSLYVDNFGSYNKTYG 261

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNAS 271
            LA ++  L++L++     +LGAE+NA 
Sbjct: 262 ALAGVVVLLLWLWLTMYVVLLGAEINAE 289


>gi|192289850|ref|YP_001990455.1| ribonuclease BN [Rhodopseudomonas palustris TIE-1]
 gi|192283599|gb|ACE99979.1| ribonuclease BN [Rhodopseudomonas palustris TIE-1]
          Length = 317

 Score =  140 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 54/264 (20%), Positives = 108/264 (40%), Gaps = 8/264 (3%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVI 74
                 ++  + +A+ +    LL++FP I    +          +   +  +    P   
Sbjct: 46  TYRRIGDDRLFLVAAGVVFYWLLALFPAITALVSSYALFADAATIGDHLAQLSSIVPAGT 105

Query: 75  AKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
              I +++ +VLA     L     +    A + ++ GV+A+  +LN  Y V E R ++  
Sbjct: 106 YSVIEEQVGRVLANGEAKLGLAFLISLSLALWSANGGVKAIIDALNAVYDVEEQRGFFKL 165

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
              S    L A   ++    + +A P+ LA +         + + I  GR     L  F 
Sbjct: 166 NGFSLLLTLGALGAVLAAIGLVIAAPIVLARI----GLGNLVAVAIDYGRWPVLALMTFG 221

Query: 192 GLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           GL  ++   P         + PG I   +SW+ G+   ++Y+  F+ Y+  Y  L + + 
Sbjct: 222 GLSLLYRIAPNRPSPPWRWVAPGSIVAALSWLAGSAALSYYLANFADYNATYGSLGAAIG 281

Query: 251 CLVFLYMLGVFFILGAELNASMII 274
            +++++M  +  + G ELNA +  
Sbjct: 282 LMIWMWMTAIVVLAGGELNAEIEA 305


>gi|126736136|ref|ZP_01751879.1| ribonuclease BN, putative [Roseobacter sp. CCS2]
 gi|126714302|gb|EBA11170.1| ribonuclease BN, putative [Roseobacter sp. CCS2]
          Length = 315

 Score =  140 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 61/273 (22%), Positives = 114/273 (41%), Gaps = 8/273 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI     +   E+    +A+ ++   LL++FP I     + G L     +   +  + G 
Sbjct: 20  DIALRLKDEVSEDRVGLIAAGVAFYGLLALFPAITAILAIGGLLVEPNQIIEQLSALAGI 79

Query: 70  WPEVIAKPITDEILQVLAVP---AKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            PE     IT++   V             +    A Y +S G+ +L   +N AY  +E R
Sbjct: 80  VPEAAMTIITEQATAVAGSREGGLGLAALLGIGLAIYSASKGMGSLMDGMNVAYDEIEER 139

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            +   +L + G  LL  + L+I     +A+P+A+  +            +     I   +
Sbjct: 140 GFIRLKLETLGLTLLLIIGLLIGLSAMIAVPVAINAL----SLGVVTETLGTVVVIAVLL 195

Query: 187 LALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
               +GL  ++ + P+  + ++    PG I     W++G+  F  Y+  F +Y+  +  L
Sbjct: 196 GLTLVGLAVLYRYGPSRDAAEMQWATPGAIAACFLWLLGSAGFAFYVANFGSYNESFGAL 255

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
             ++  L++L++     ILGAELNA M      
Sbjct: 256 GGVVILLMWLWISAYVIILGAELNAEMEAQTRH 288


>gi|91784445|ref|YP_559651.1| ribonuclease BN [Burkholderia xenovorans LB400]
 gi|123062706|sp|Q13WE0|Y3061_BURXL RecName: Full=UPF0761 membrane protein Bxeno_A3061
 gi|91688399|gb|ABE31599.1| tRNA-processing RNAse BN [Burkholderia xenovorans LB400]
          Length = 436

 Score =  140 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 38/273 (13%), Positives = 95/273 (34%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A +   E+    +A  ++ + +LS+ P       L         F  ++ 
Sbjct: 8   LDTLKRLAQFAAQRSSEDRIPQVAGSLTFTTMLSLVPLATVAFALFTAFPIFASFQMSLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +                L   A  AKGL TI  +     +   +  +  + N  +RV 
Sbjct: 68  IFLADHLMPAQLNSQIFNYLNQFASKAKGLTTIGMIFLFVTAVMTMMTVESAFNVIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R      L+ +  + L  + + +   +   +                +  +I      
Sbjct: 128 KARPIAQRILVYWAIITLGPILIGVSLSISSYLFTQSMTFTAA----QRMTPVIEWALAG 183

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
           A +         ++++LP  + +    + G +   I++ +    F +Y+    TY+ +Y 
Sbjct: 184 AALPLTAAAFTILYVYLPNCRVEWRDAVIGGVTAAIAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     + GA + +++    
Sbjct: 244 AFAAVPLFLLWMYLCWFITLAGAMIASALPAIR 276


>gi|257126602|ref|YP_003164716.1| ribonuclease BN [Leptotrichia buccalis C-1013-b]
 gi|257050541|gb|ACV39725.1| ribonuclease BN [Leptotrichia buccalis C-1013-b]
          Length = 523

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 46/273 (16%), Positives = 110/273 (40%), Gaps = 6/273 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +++    +  IIY    ++ + +   +A  ++  +LL++FP +     +    G  +   
Sbjct: 9   IKKRIDEMKRIIYLIYRNYRDGETQILAISLTYYSLLAIFPVVALILGITKGFGLDKLFI 68

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
                ++     ++   I      +L+  +  L ++  +   Y +   +  L  S N+ +
Sbjct: 69  QKFFELWPGNNGILKVIIDVAQRLLLSTESSILTSVGIIILIYSAVKVLIMLENSFNKIW 128

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           ++ + RS     +     + L  +  V++S +          V + FP    L+ ++   
Sbjct: 129 KINKKRSMTRRVIDYVAIIFLGPIFFVLLSTLNSF---VADEVIRNFPNNPILINLVVGL 185

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
              AT + LF    ++   +P    KI   +   + T +      +LF     + + Y+ 
Sbjct: 186 LGPATYIILF---SYLFYIIPNTNVKIKPAVFAGVVTTVLTFGWKLLFLLLQSSITKYNI 242

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
           +Y  LA I   L+++  + V  +LGA++  S+ 
Sbjct: 243 IYGSLALIPIFLIWVQYVWVTILLGAQIAFSIQ 275


>gi|242279976|ref|YP_002992105.1| ribonuclease BN [Desulfovibrio salexigens DSM 2638]
 gi|242122870|gb|ACS80566.1| ribonuclease BN [Desulfovibrio salexigens DSM 2638]
          Length = 456

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 46/278 (16%), Positives = 114/278 (41%), Gaps = 4/278 (1%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV 62
           +    +  + Y     F+ +     AS ++ + +LS+ PF+    +L   +G      + 
Sbjct: 31  KILHTMARVGYLVTIGFLRDQCIIRASALTFTTMLSIVPFLAVAFSLMKGMGFQD--SSY 88

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
           I  +         + +   +  V     + L  I      +   + V  +  + N  ++V
Sbjct: 89  IQEMLLKVSAGREEVVGKILEYVDNTNVQTLGWIGVATLLFTVLSTVGTVEKAFNIIWKV 148

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
              R+++      F  + +  V +++ + V V+I      V + F ++  +  +      
Sbjct: 149 SHGRTFWRKFTDFFSVIFICPVAVIVATSVSVSIKK--QAVLQQFGSIYGITELESFLIS 206

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
            A ++ +++   F++ F+P  K +I S L G +     W +    + ++ +  + Y+ +Y
Sbjct: 207 LAPLVLIWLSFTFIYAFMPNTKVRITSALAGGVVAGTVWQMAQWAYINWQIGVTKYNAIY 266

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
              A +   LV+LY   V  +LG+E++ ++      ++
Sbjct: 267 GSFAQLPLFLVWLYASWVIVLLGSEISYAVQNVMLYRQ 304


>gi|255319771|ref|ZP_05360976.1| tRNA-processing ribonuclease BN [Acinetobacter radioresistens SK82]
 gi|255303090|gb|EET82302.1| tRNA-processing ribonuclease BN [Acinetobacter radioresistens SK82]
          Length = 434

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 40/273 (14%), Positives = 101/273 (36%), Gaps = 4/273 (1%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
              F  I   I  F  +    +A  ++ + L ++ P +     +   + A +     +  
Sbjct: 33  KTWFKFILFVIRRFEADRCRELAGSLTYTTLFAIVPMLTVFLVIISSIQALEPARQQLQQ 92

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           +  +     +    D++L      +  L  I  L     +   +  +  + NR +RV E 
Sbjct: 93  LIYSNFLPKSTIAFDKMLNAFTEKSSNLTVIGVLFLFVTTIMMLSTIETAFNRIWRVKET 152

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R   +  +  +  + L  + L     +  A+         F     +   ++       +
Sbjct: 153 RGGIVGFMRYWTIISLGPIVLGSAFVISSALASLSILSNNFAGYEMDGAFLLS----LLS 208

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +     G   ++  +P     +++     +F+ I + +   LF   +  F++Y  +Y   
Sbjct: 209 IALTIAGFFIIYWTIPNRNVPMIAAALAGVFSAIVFEMLKNLFGTIMSNFTSYEIVYGAF 268

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           A+I   L+++Y+     +LG E++ ++  ++ R
Sbjct: 269 AAIPIFLLWIYLSWNIVLLGVEVSFAITAFHSR 301


>gi|226195661|ref|ZP_03791248.1| outer membrane porin [Burkholderia pseudomallei Pakistan 9]
 gi|225932146|gb|EEH28146.1| outer membrane porin [Burkholderia pseudomallei Pakistan 9]
          Length = 822

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 50/259 (19%), Positives = 95/259 (36%), Gaps = 5/259 (1%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAG-FLGAHQFVPTVIDVVFGAWPE 72
           DA + F  +   AMA+ I+  +  S+ P +V    +AG F GA      V   V      
Sbjct: 22  DAFKRFSADRCTAMAASIAFYSAFSLAPTLVMVIAVAGWFFGADAARGEVFSHVHELIGN 81

Query: 73  VIAKPITDEILQVLAVPA--KGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
             A  +   +       +       IS    A  +S    +L  +L+  +     R+  +
Sbjct: 82  EAAAGVQTIVENAHRSGSRGGTAALISFAMLALGASATFASLNTALSVIWPATGARASSV 141

Query: 131 TRLISFGYV-LLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
             L+    +     + +  +  V + +  A+ ++ ++       ++I    +    +  L
Sbjct: 142 LGLVRIRLISFGLVLGVAFLLIVSLVLDTAITFIGRWLWGASPYVVIGNLLQFSIGIAVL 201

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
                 +  FLP A+      + G I + + +  G  LF  Y+    T S  +    S  
Sbjct: 202 AFAFGTLMKFLPDARVSNRDAMTGGIVSAVLFSAGKKLFALYLAHAGTASA-FGAAGSFA 260

Query: 250 TCLVFLYMLGVFFILGAEL 268
             L++LY      +LGAE 
Sbjct: 261 VLLMWLYFSAAVLLLGAEF 279


>gi|108760431|ref|YP_634071.1| YihY family protein [Myxococcus xanthus DK 1622]
 gi|108464311|gb|ABF89496.1| YihY family protein [Myxococcus xanthus DK 1622]
          Length = 348

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 68/274 (24%), Positives = 116/274 (42%), Gaps = 1/274 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG-AHQFVPTVIDVV 66
             +     +  F E+    +A+ +S   L S+FPF+ F   L  +L  A   V  ++D +
Sbjct: 11  WREFSRRFVREFQEDSVTDIAAQLSYYLLFSLFPFLFFLVTLVAYLPFAPGAVDAMLDRI 70

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
               P      IT  +  ++  P   L T   +   + +S GV ALR +LN AY V E R
Sbjct: 71  RPLVPGDAMGLITGHLQSLVNQPQPKLLTAGLVITLWSASRGVNALRTALNLAYDVSESR 130

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
             + T+ ++    LL S+ + +    F+       ++      +    L+    R   T 
Sbjct: 131 PLWKTQGLAMLVTLLGSLLIPLSFAAFLLGGRLGLWLAGKLQLVDAFHLVWSWLRWPFTA 190

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             + + L   +  LP  K +   I PG +     W+     FT Y+  F  Y+  Y  + 
Sbjct: 191 SLVMLVLALCYYLLPDVKQRFKYITPGSVLGTGLWLTSTWGFTQYVEHFGKYNVTYGSIG 250

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            +M  L++LY+ G+ FI+G E+NA +       K
Sbjct: 251 GVMVLLLWLYLSGLIFIVGGEVNAILEHASVEGK 284


>gi|258406232|ref|YP_003198974.1| ribonuclease BN [Desulfohalobium retbaense DSM 5692]
 gi|257798459|gb|ACV69396.1| ribonuclease BN [Desulfohalobium retbaense DSM 5692]
          Length = 425

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 45/271 (16%), Positives = 101/271 (37%), Gaps = 4/271 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
           F ++ D +   +  FV +     AS ++  + L++ PF+    +L+   G    +   I 
Sbjct: 14  FRMIRDWVLFVLRAFVRDQCLLRASALTYVSALALVPFLAVAFSLSKGFGFQNTL--YIR 71

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
            +   +     + I   +  +       L +I          + +  +  + N  + V  
Sbjct: 72  TLLERFAAGREQVIEHVLAYINNTDVATLGSIGVGVLFVSVFSMLATVEKTFNTIWGVQR 131

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R             LL  V ++    +  ++    + V +    +G    +       A
Sbjct: 132 PRQLSRKFTDYLSVTLLCPVLVIASISITASLQ--SSAVAQKLLRVGFFNSVYGGLLSLA 189

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
                ++ LIF++  +P  + + +  L G +     W     L  HY + FS Y+ +Y  
Sbjct: 190 PFFMAWLALIFIYTVMPNTRVRFLPALGGGLVAGFLWQATQKLLIHYQIGFSKYNAIYGS 249

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            A +   LV++Y+  +  + GAE++ ++   
Sbjct: 250 FAQVPLLLVWMYLSWIIVLFGAEISFALQNR 280


>gi|89070971|ref|ZP_01158197.1| Ribonuclease BN [Oceanicola granulosus HTCC2516]
 gi|89043478|gb|EAR49692.1| Ribonuclease BN [Oceanicola granulosus HTCC2516]
          Length = 279

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 54/247 (21%), Positives = 104/247 (42%), Gaps = 8/247 (3%)

Query: 31  ISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPA 90
           ++   LL++FP I     +AG +     +   +  + G  P+  A  +  +  +V     
Sbjct: 1   MAFYGLLALFPAITAMIAIAGLVMEPAQITEQLQALGGMLPQDAADILIGQAQEVAGSRE 60

Query: 91  KGLF---TISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLV 147
            GL     +  L A Y +S GV +L   +N AY   + R +     ++    L+  V +V
Sbjct: 61  GGLGLAAVLGILLALYSASKGVSSLMEGINVAYDEEDQRGFIKRTALTLALTLVLIVGIV 120

Query: 148 IMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAK-SK 206
           +     V +P  L  V           ++I   R    ++    G   ++ F P    ++
Sbjct: 121 LGLASTVVLPAVLNVVD----LGPVTEILIAAFRWALLLVLAVGGFALLYRFAPDRSSAR 176

Query: 207 IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGA 266
           +  + PG I   I W+V  V F  Y   F +Y+  +  L  ++  L++L++     ++GA
Sbjct: 177 MKWLTPGAIVGCILWIVATVGFAIYADNFGSYNESFGALGGVIVLLMWLWLSSYAVLMGA 236

Query: 267 ELNASMI 273
           E+N+ + 
Sbjct: 237 EINSEIE 243


>gi|83644372|ref|YP_432807.1| ribonuclease BN-like family protein [Hahella chejuensis KCTC 2396]
 gi|83632415|gb|ABC28382.1| ribonuclease BN-like family protein [Hahella chejuensis KCTC 2396]
          Length = 455

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 42/266 (15%), Positives = 101/266 (37%), Gaps = 2/266 (0%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV 62
                   +++  +   +       A  +  + LLS+ P +    ++    G H  +  +
Sbjct: 31  RVLWHSARVLFAVVRDVLFGHVTLHAMGLVYTTLLSIVPLLALSFSVLKGFGVHNQLEPL 90

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
           ++ VF A+ E   + + + +  V  V    L ++      Y   + V+ +  S N  +RV
Sbjct: 91  LENVFQAFGEKGPELVQNVLAFVDNVKVGVLGSVGLGLLIYTVISLVQKVERSFNEIWRV 150

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            ++RS           +++  +           +      + +   ++     +      
Sbjct: 151 SQIRSLAQRFSSYLSVIVVGPLLAFSAMGATATL--VGTDMAQTVLSIEPFGRLFSLATR 208

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
            A  + +     F++ F+P  K +      G +   I+W     +F  ++V  S Y  +Y
Sbjct: 209 MAPYVIIVALFTFMYRFIPNTKVRTRYAFIGGLGAGIAWQTTGYVFAKFVVGTSNYEAIY 268

Query: 243 AGLASIMTCLVFLYMLGVFFILGAEL 268
           +G A  +  L++LY+  +  ++GA +
Sbjct: 269 SGFAVGILVLIWLYISWLILLMGASV 294


>gi|167828963|ref|ZP_02460434.1| outer membrane porin [Burkholderia pseudomallei 9]
          Length = 819

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 50/259 (19%), Positives = 95/259 (36%), Gaps = 5/259 (1%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAG-FLGAHQFVPTVIDVVFGAWPE 72
           DA + F  +   AMA+ I+  +  S+ P +V    +AG F GA      V   V      
Sbjct: 19  DAFKRFSADRCTAMAASIAFYSAFSLAPTLVMVIAVAGWFFGADAARGEVFSHVHELIGN 78

Query: 73  VIAKPITDEILQVLAVPA--KGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
             A  +   +       +       IS    A  +S    +L  +L+  +     R+  +
Sbjct: 79  EAAAGVQTIVENAHRSGSRGGTAALISFAMLALGASATFASLNTALSVIWPATGARASSV 138

Query: 131 TRLISFGYV-LLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
             L+    +     + +  +  V + +  A+ ++ ++       ++I    +    +  L
Sbjct: 139 LGLVRIRLISFGLVLGVAFLLIVSLVLDTAITFIGRWLWGASPYVVIGNLLQFSIGIAVL 198

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
                 +  FLP A+      + G I + + +  G  LF  Y+    T S  +    S  
Sbjct: 199 AFAFGTLMKFLPDARVSNRDAMTGGIVSAVLFSAGKKLFALYLAHAGTASA-FGAAGSFA 257

Query: 250 TCLVFLYMLGVFFILGAEL 268
             L++LY      +LGAE 
Sbjct: 258 VLLMWLYFSAAVLLLGAEF 276


>gi|260907006|ref|ZP_05915328.1| putative ribonuclease BN [Brevibacterium linens BL2]
          Length = 312

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 54/268 (20%), Positives = 112/268 (41%), Gaps = 2/268 (0%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
           I+ + I H + + G  +A+ ++  ALLS+ P  +   ++ G +G  +     +  +    
Sbjct: 42  ILTNTIRHVISDQGLDLAAGLAFYALLSMAPATLALVSMLGVVGEAKSTTEAVLGLTSDL 101

Query: 71  PEVIAKPITDEILQVLAVPAKGL-FTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
               A+ I   + ++++ PA GL   +S   A + SS  V A   + NRAY V E R  +
Sbjct: 102 STEAAQAIRPIVTELVSSPAAGLTLIVSVAVAIWSSSKYVGAFGRAANRAYAVEETRPLW 161

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
             + +     L+  + +  +  + V        + K        ++I    R    +  +
Sbjct: 162 KLKPMMLLITLVLLLLMAGLGLLLVVSGPIAESIGKLVGLGPVAVMIWSIARWPVVIFFV 221

Query: 190 FIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
            + +  ++   P  K  K      G     ++ +V ++ F  YI  F  Y+  Y  +  +
Sbjct: 222 MLAIALLYYATPNVKKVKFRWSSIGAFVAPMTLIVVSLGFVLYINNFDNYNATYGAIGGV 281

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYY 276
           +    +L+M+ +  I G+EL+A +    
Sbjct: 282 IVGFAWLWMVNLALIFGSELDAEIRRSR 309


>gi|296158116|ref|ZP_06840948.1| ribonuclease BN [Burkholderia sp. Ch1-1]
 gi|295891452|gb|EFG71238.1| ribonuclease BN [Burkholderia sp. Ch1-1]
          Length = 439

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 38/273 (13%), Positives = 95/273 (34%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A +   E+    +A  ++ + +LS+ P       L         F  ++ 
Sbjct: 11  LDTLKRLAQFAAQRSSEDRIPQVAGSLTFTTMLSLVPLATVAFALFTAFPIFASFQMSLQ 70

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +                L   A  AKGL TI  +     +   +  +  + N  +RV 
Sbjct: 71  IFLADHLMPAQLNSQIFNYLNQFASKAKGLTTIGMIFLFVTAVMTMMTVESAFNVIWRVR 130

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R      L+ +  + L  + + +   +   +                +  +I      
Sbjct: 131 KARPIAQRILVYWAIITLGPILIGVSLSISSYLFTQSMTFTAA----QRMTPVIEWALAG 186

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
           A +         ++++LP  + +    + G +   I++ +    F +Y+    TY+ +Y 
Sbjct: 187 AALPLTAAAFTILYVYLPNCRVEWRDAVIGGVTAAIAFELAKRGFGYYVRRIPTYTAVYG 246

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     + GA + +++    
Sbjct: 247 AFAAVPLFLLWMYLCWFITLAGAMIASALPAIR 279


>gi|289207949|ref|YP_003460015.1| ribonuclease BN [Thioalkalivibrio sp. K90mix]
 gi|288943580|gb|ADC71279.1| ribonuclease BN [Thioalkalivibrio sp. K90mix]
          Length = 452

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 42/265 (15%), Positives = 97/265 (36%), Gaps = 2/265 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +     +       +    E      A  +  + LLS+ P I    ++    GAH  V  
Sbjct: 33  KALLLGIVRGAGAIMHEAKEGQLTLRAMSLVYTTLLSIVPLIALSFSVLKAFGAHNAVEP 92

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           V+        E   +   + I  V  +    L  +  L   Y     V+ + ++ N  +R
Sbjct: 93  VVLGFLEPLGEQGVEIANNVIEFVDNMRVGVLGFVGLLFLVYTVIALVQKIELAFNTIWR 152

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V   R++          +L+  +  +++S + +   +      +    +     +I    
Sbjct: 153 VENSRNFAQRFSNYLSVILIGPL--LVVSALGITATVMSTTAMQTLAGIEPFGTLITGAS 210

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                L +     F+++F+P  + ++   L G +   + W      F   +   + Y  +
Sbjct: 211 RMVPYLLIMAAFTFIYVFVPNTRVRLFPALVGAVVAGLLWQSVGWGFATMVAGSTRYDAI 270

Query: 242 YAGLASIMTCLVFLYMLGVFFILGA 266
           Y+G A ++  L+++Y+  +  ++GA
Sbjct: 271 YSGFAIMILLLIWIYLAWLILLIGA 295


>gi|115372473|ref|ZP_01459781.1| ribonuclease BN [Stigmatella aurantiaca DW4/3-1]
 gi|310819113|ref|YP_003951471.1| ribonuclease bn-related protein [Stigmatella aurantiaca DW4/3-1]
 gi|115370435|gb|EAU69362.1| ribonuclease BN [Stigmatella aurantiaca DW4/3-1]
 gi|309392185|gb|ADO69644.1| Ribonuclease BN-related protein [Stigmatella aurantiaca DW4/3-1]
          Length = 307

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 65/271 (23%), Positives = 124/271 (45%), Gaps = 6/271 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI+ +    +        A+ ++   +LS+FPF++F   LAG +   + V  +I  +   
Sbjct: 35  DILGNLRREWKRNKLSDAAAALTFYGVLSLFPFLLFIVALAGLVIQPEQVQALIGELGRE 94

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P   ++  + ++ Q+ + P+ GL T SALAA + ++ GV +L  +LN AY V E R  +
Sbjct: 95  VPPAFSQIPSAQLAQLTSGPSTGLLTFSALAAVWSAAAGVVSLMTALNTAYGVTESRPRW 154

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
                   Y +   + L       +A  +A+A            + ++   R+    L +
Sbjct: 155 K------VYGIALGMMLGGALLALLAGLVAVAAPALATRLGQPWMALVGWLRLPLAALLM 208

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
                 ++  LP  + K   I PG +   + W+  ++ F+ Y+  FST+   Y  L  I+
Sbjct: 209 MSLWATLYSVLPDVRQKFKFITPGSVAGVLVWLAASLGFSFYVSHFSTFGITYGALGGII 268

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             L+++++  +  +LGAE+NA +       K
Sbjct: 269 VLLLWMWISSLALMLGAEINAVLARRSSEGK 299


>gi|238027745|ref|YP_002911976.1| YihY family protein [Burkholderia glumae BGR1]
 gi|237876939|gb|ACR29272.1| YihY family protein [Burkholderia glumae BGR1]
          Length = 434

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 33/273 (12%), Positives = 96/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A     E+    +A  ++ + +L++ P +     L         F  ++ 
Sbjct: 8   LDTIKRLARFAARRGGEDRIPQVAGSLTFTTILALVPLVTVAFALFTAFPIFSSFQASLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   +  AKGL T   +     +   +  +  + N  +RV 
Sbjct: 68  SFLADHLMPAQINNQIFKYLNQFSAKAKGLTTAGLIVLVVTAVMTMMTIESAFNVIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L  + ++ L  +   +   +   +               +   ++    + 
Sbjct: 128 KPRPFAQRVLAYWAFITLGPLLFGVSLSISSYLFTKSLAFAGAPATPSSFEWLLTAASLP 187

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+    +    ++++LP         + G +   +++ +    F +Y+    TY+ +Y 
Sbjct: 188 LTV----VAFTLLYVYLPNCTVAWRDAVVGGVCAALAFELAKRGFGYYVRRIPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+  +  + GA + +++    
Sbjct: 244 AFAAVPLFLLWVYLSWLITLAGAMIASALPAIR 276


>gi|328956776|ref|YP_004374162.1| putative integral inner membrane protein with ribonuclease fold
           [Carnobacterium sp. 17-4]
 gi|328673100|gb|AEB29146.1| putative integral inner membrane protein with ribonuclease fold
           [Carnobacterium sp. 17-4]
          Length = 331

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 62/276 (22%), Positives = 121/276 (43%), Gaps = 3/276 (1%)

Query: 5   FCIVFDIIYDAIE-HFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI 63
           F   F    +  + ++   +  A A+ ++   LLS+FP ++  AN+            ++
Sbjct: 13  FKDKFKHFLEVFKPNWARAEVSANAAQLAYFTLLSLFPILLVVANVIPLFPIDAA--DIL 70

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
            +V  A P  I   +   +   L+  + G  +I  + + + +S    AL+  LN  Y V 
Sbjct: 71  PMVETAVPPDIYNVLAPILENYLSSSSGGAISIGLITSLWSASKAFNALQDVLNEVYGVE 130

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           +  ++ I RL+SF   L     + ++ FVFV     L ++  F     +L+L +++ +  
Sbjct: 131 KRNNFIIVRLVSFLVQLAIVAIVGVVIFVFVFGEFILLFLEDFVGIELDLVLQVFSYKWL 190

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
              + L + +  V+  +P  +  I   LPG +F  I W+V +  FT Y+      +   A
Sbjct: 191 VLFIVLILIITMVYFLVPNHRMHIKYALPGAVFATIGWMVLSQAFTLYVQFAGGEAAASA 250

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
                +  +++LY+  +  +LGA +NA        K
Sbjct: 251 TFGVFIVLMLWLYLSAIILLLGALINAVYFEIKIGK 286


>gi|108763366|ref|YP_632756.1| YihY family protein [Myxococcus xanthus DK 1622]
 gi|108467246|gb|ABF92431.1| YihY family protein [Myxococcus xanthus DK 1622]
          Length = 359

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 56/268 (20%), Positives = 116/268 (43%), Gaps = 7/268 (2%)

Query: 9   FDIIYDAIE-HFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +   + A++  +  ++   +A  ++   +L++FPF++F  +LAG L        +I  + 
Sbjct: 10  WKTFFLALKDEWTRDEVGDVAGALTFRMILALFPFLLFLVSLAGLLIEPAQAQVLIQELA 69

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P  +   +++ I  +      GL T+  + A + +S GV AL  +LN+ Y V E R 
Sbjct: 70  RVAPREVTSILSERIEALANSRPVGLLTVGGVGAVWAASAGVVALMTALNKVYGVTESRP 129

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
            +  R I+    L  +   ++ +F  +  P+    +            ++   R+    L
Sbjct: 130 IWKLRGIALLVTLGGAAVAILAAFAVIVTPVIAGKLPGGLG------TVLMWLRLPVAGL 183

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            +      ++  LP    K   I PG +   + WV  +  F+ Y+  F  Y   Y  +  
Sbjct: 184 LMMFLWAVLYYVLPDVNQKFRFITPGSVVGVLIWVFASWGFSQYVANFGKYDVNYGAIGG 243

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIY 275
           ++  L+++++     +LGAE+NA +   
Sbjct: 244 VIVMLLWMWISAQVILLGAEINAILEHR 271


>gi|303246520|ref|ZP_07332799.1| ribonuclease BN [Desulfovibrio fructosovorans JJ]
 gi|302492230|gb|EFL52105.1| ribonuclease BN [Desulfovibrio fructosovorans JJ]
          Length = 448

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 43/264 (16%), Positives = 100/264 (37%), Gaps = 4/264 (1%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
            +  +  F++  G ++A+ +S + +LS+ PF+    ++A  LG +      +  +     
Sbjct: 39  FFHVLHLFLKNHGLSLAAALSYTTVLSIVPFLAVAFSVAKGLGFYD--SPQVHDLLMRIT 96

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
              A+ +    L +     K L  I  +     + + V  +  ++N A+ +   R +   
Sbjct: 97  AGRAEVVEQIQLYIQNTNVKTLGAIGTVLLLVTAVSLVSTIEGAINAAWDIGVKRGFVTR 156

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
                  +++    L        A+  A   + +       +  +       A +L ++ 
Sbjct: 157 FTSYLLLIIICPPLLFAAVSAMAAVQDAS--LTRRLLEFSLVQDVERIVLSVAPVLIVWT 214

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
               ++ FLP  + K    L G       W +    +  +    + Y+ +Y   A I   
Sbjct: 215 VFFVLYQFLPNTRVKPRCALIGAFCAGTLWQLVQWAYIKFQFGAAGYNAIYGSFAQIPLL 274

Query: 252 LVFLYMLGVFFILGAELNASMIIY 275
           L++LY+     +LGA+++ +   Y
Sbjct: 275 LLWLYISWAIVLLGAQISHTAQRY 298


>gi|261211303|ref|ZP_05925592.1| ribonuclease BN [Vibrio sp. RC341]
 gi|260839804|gb|EEX66415.1| ribonuclease BN [Vibrio sp. RC341]
          Length = 309

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 36/267 (13%), Positives = 85/267 (31%), Gaps = 6/267 (2%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
                  +     +     A +++   LLS+ P +    ++            VI     
Sbjct: 16  LHFFRYLLSRMNHDRVNVNAGYLAYITLLSIVPMLTVLLSILSSFSIFASAGEVIQDFVI 75

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
                 A  +    L         +  +        +   +  +  +LN  +RV + R  
Sbjct: 76  THFVPAAGEVVKTALVEFVANTGKMTAVGGAFLFVAAIMLISNIDKNLNYIWRVQQKRRA 135

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
             +  + +  + L  + +         I                L         +   + 
Sbjct: 136 VFSFSMYWMILTLGPILVGASIAATSYITSL------KILDNETLSGAYNLFLRWLPFVL 189

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
            +   + ++L +P  K  +   + G +   + + +    F  YI  F +Y  +Y  LA+I
Sbjct: 190 SYCAFVGLYLLVPNKKVHLQHAMTGALIAAVLFELSKKGFAAYITQFPSYQLIYGALAAI 249

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIY 275
               V++Y+  +  ++GAE+ A++   
Sbjct: 250 PILFVWVYLCWLIVLVGAEVTAALGER 276


>gi|197333895|ref|YP_002154869.1| tRNA-processing ribonuclease BN [Vibrio fischeri MJ11]
 gi|197315385|gb|ACH64832.1| tRNA-processing ribonuclease BN [Vibrio fischeri MJ11]
          Length = 316

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 40/276 (14%), Positives = 100/276 (36%), Gaps = 8/276 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FV 59
           ++    I +  +    +  + +     A +++   LLS+ P I    ++           
Sbjct: 11  IKHKLRIGWSYLLFLKQRVIHDRLTVSAGYMAYITLLSLVPLITVLLSVLSQFPVFSGAG 70

Query: 60  PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
            TV   V   +    +  +   + + ++     +  + +      S   + ++  SLN  
Sbjct: 71  DTVQAFVIQNFVPAASDAVEASLKEFISN-TGKMTAVGSGFLFVASVMLISSIDRSLNYI 129

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +RV + R    +  + +  + L  + +         +                +      
Sbjct: 130 WRVKKKRRPMYSFSLYWMILTLGPLLVGASLAATSYVTSL------KIMDDEIVSSFYRT 183

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
              +  ++  F   + ++L +P  K ++   L G +     +    V F  YI  F +Y 
Sbjct: 184 LLGWLPIILSFSAFVGLYLLVPNKKVRVTHALIGAMSAGCLFEFSKVGFAQYITQFPSYQ 243

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            +Y  LA++    V++Y+  +  ++GAE+ AS+  +
Sbjct: 244 VIYGALAAVPILFVWVYLCWIIVLIGAEITASLGEF 279


>gi|194364494|ref|YP_002027104.1| ribonuclease BN/unknown domain fusion protein [Stenotrophomonas
           maltophilia R551-3]
 gi|226737460|sp|B4SKS3|Y716_STRM5 RecName: Full=UPF0761 membrane protein Smal_0716
 gi|194347298|gb|ACF50421.1| ribonuclease BN [Stenotrophomonas maltophilia R551-3]
          Length = 424

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 39/266 (14%), Positives = 96/266 (36%), Gaps = 8/266 (3%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVIDVVFGAWP 71
                 F+++  +  A+ ++ + + ++ P  +    +         +   + D VF  + 
Sbjct: 25  RFLWHRFLDDRLFQAAAALAYTTVFALVPLAIVVFGVLSAFPVFDRWSDQLSDYVFSNFV 84

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
              A+     + Q  +  A  L     +A        + ++  + N+ +RV   R     
Sbjct: 85  PNAARAAEGYLRQF-SASAGQLTAAGFIALVVSLLITLNSVEETFNQIWRVGSTRPKLTR 143

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
            L+ +  + L             ++ ++                +       A +L  F+
Sbjct: 144 FLVYWTVLTLG------AMLAAASLAVSARVFAMPLFGTQEGRWLADLALRLAPILIEFV 197

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
            +  +   +P    K    +PG I   +   +       Y+ +F +Y  +Y  +A +   
Sbjct: 198 CITLMFRVVPHHTVKWRHAVPGAILAAVILELVKWGIGAYLGSFQSYQKLYGTVAFVPIL 257

Query: 252 LVFLYMLGVFFILGAELNASMIIYYW 277
           L+++Y+  V  +LGA L++SM  + +
Sbjct: 258 LLWIYLCWVAVLLGASLSSSMAAFRY 283


>gi|84501469|ref|ZP_00999674.1| Ribonuclease BN family protein [Oceanicola batsensis HTCC2597]
 gi|84390760|gb|EAQ03248.1| Ribonuclease BN family protein [Oceanicola batsensis HTCC2597]
          Length = 315

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 61/266 (22%), Positives = 106/266 (39%), Gaps = 8/266 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI+         +    + + ++   LL++FP I     LAG       V   I+ +   
Sbjct: 24  DILLRVWAEMGRDHIGLIGAGVAFYGLLALFPAITALMALAGLTFDASQVTAQIESISQF 83

Query: 70  WPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            PE  A  I D+ + V      GL     +    A + +S GV +L   +N AY   E R
Sbjct: 84  VPEAAADIIIDQAVAVTGSQDGGLGLAAILGFALAIWAASKGVGSLMEGINIAYDETETR 143

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            +    L   G  L     +V      + +P  L+ +           L+I   R  A +
Sbjct: 144 GFVRLTLTRLGLTLFLVFGMVAGLGATIVLPSILSLIN----LGATTELLIGLARWIALL 199

Query: 187 LALFIGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
                G+  ++   P  K +    ++PG +   + W+  +  F  Y+  F +Y   +  L
Sbjct: 200 AMTVAGITVLYRVAPDRKDATWSWLVPGAVLATLLWIGASAAFAIYVQNFGSYQETFGTL 259

Query: 246 ASIMTCLVFLYMLGVFFILGAELNAS 271
           A ++  L++L++     +LGAELNA 
Sbjct: 260 AGVVILLMWLWISAYVILLGAELNAE 285


>gi|77165113|ref|YP_343638.1| ribonuclease BN [Nitrosococcus oceani ATCC 19707]
 gi|254433289|ref|ZP_05046797.1| Ribonuclease BN-like family [Nitrosococcus oceani AFC27]
 gi|76883427|gb|ABA58108.1| tRNA-processing RNAse BN [Nitrosococcus oceani ATCC 19707]
 gi|207089622|gb|EDZ66893.1| Ribonuclease BN-like family [Nitrosococcus oceani AFC27]
          Length = 447

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 49/267 (18%), Positives = 102/267 (38%), Gaps = 2/267 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R +      +IY     F + D    A+ +  + LLS+ P +    ++    G H  +  
Sbjct: 28  RTFLRHKAKLIYAVSGEFFKGDLTLQATSLVYTTLLSLAPLLAVSFSVLKAFGIHNEIEP 87

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           V+            +  T  I  V  +    L ++      Y   + ++ +  + N  +R
Sbjct: 88  VLHHFLLPLGPRGEEITTKIIQYVENLKVGVLGSVGVGLLFYTVLSLIQKVEGAFNHVWR 147

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           +   R +          +L+  V +        ++        +       L   +    
Sbjct: 148 IKAERPFVRRFSDYLSVLLIGPVLVFSAVGATASVMQTS--FIQTLLEFELLGKTLVVVS 205

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                L +  G  FV+LFLP  K K+ S + G +   I W    +LF  ++ T + Y  +
Sbjct: 206 KLLPYLLVIGGFTFVYLFLPNTKVKLGSAVVGGVVAGILWESIGILFAFFVATSTKYDAI 265

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAEL 268
           Y+ LA ++  +++LY+  +  ++GA++
Sbjct: 266 YSSLAILILFMIWLYISWLILLVGAQV 292


>gi|58038914|ref|YP_190878.1| t-RNA-processing ribonuclease BN [Gluconobacter oxydans 621H]
 gi|58001328|gb|AAW60222.1| t-RNA-processing ribonuclease BN [Gluconobacter oxydans 621H]
          Length = 348

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 61/284 (21%), Positives = 116/284 (40%), Gaps = 17/284 (5%)

Query: 9   FDII-YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           + +I                A+  +  A LS+FP I    +L G     Q V   ++V+ 
Sbjct: 51  WRVIAKHLFAEVGSSQTSLSAAGCAFYATLSLFPAISSLISLYGLAFDLQTVEPQLEVLR 110

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGL---FTISALAAAYFSSNGVEALRISLNRAYRVVE 124
              P      I D I ++++ P   L      S   A + +S   +++  +LN AY   E
Sbjct: 111 HLLPPSAYDLIGDRIHELISQPHSSLTIGLIFSLAIALWSASASTKSILSALNMAYNAQE 170

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGN------------ 172
            RS+   + I+    L A +   +   + VA P  + Y+ +    L +            
Sbjct: 171 TRSFLKFQAIALSTTLTAILGAALTLALMVAAPALVDYLPRHVSFLSDPPFPVDLLLSYG 230

Query: 173 LLLIIWNGRIYATMLALFIGLIFVHLFLPAA-KSKIMSILPGVIFTWISWVVGAVLFTHY 231
             +++        +L +FI +  ++ F P    ++   I PG     I WV+ ++ F+ Y
Sbjct: 231 APMVVHTLAPLLMLLFVFIAVTLLYRFAPCRVHTQWRWIFPGSALATILWVITSLGFSWY 290

Query: 232 IVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           +  F++Y   Y  L ++   +++ ++     + GAELNAS+   
Sbjct: 291 VAHFASYGATYGPLGAVAAIMMWFFVSAYVVLFGAELNASLEAR 334


>gi|329770330|ref|ZP_08261713.1| hypothetical protein HMPREF0433_01477 [Gemella sanguinis M325]
 gi|328836688|gb|EGF86344.1| hypothetical protein HMPREF0433_01477 [Gemella sanguinis M325]
          Length = 301

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 68/274 (24%), Positives = 128/274 (46%), Gaps = 3/274 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
                 +     + ++   +++++S   +LS+FP ++    L  +    Q    ++D + 
Sbjct: 21  FKKFCKEMYYRIMYDEISLLSANLSYYFILSLFPMLIVAMALTPYFNIDQKF--LLDKIQ 78

Query: 68  GAWPEVIAKPITDEILQVLAVPAK-GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
              P  +   I   I +VL   +   L T+  +   + +SNG+  + I+ N A+RV + R
Sbjct: 79  SFAPGELGDFIFGMISEVLNSKSNNTLITLGIVFTLWSASNGIYGIIIAFNNAFRVRDGR 138

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            W +T+L+S  + +L  V + ++  + V        +   F                  +
Sbjct: 139 IWIVTKLMSILFTVLFLVGMFLVLALVVFGKQLTYLLFHKFNLDEGFYNGWSYLSYSFPI 198

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           L  FI  +F+++F P  + K +SILPG +F+ ISW + + LF +YI  FS+Y   Y  + 
Sbjct: 199 LFTFIVFVFLYIFGPNLRLKAISILPGAVFSTISWTLVSRLFGYYIDHFSSYIKTYGTIG 258

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           + M  +++LY+ G   ILGAE+NA    Y    +
Sbjct: 259 AFMAFIMWLYITGFILILGAEINAIFHNYRVEHR 292


>gi|209696335|ref|YP_002264266.1| ribonuclease BN [Aliivibrio salmonicida LFI1238]
 gi|226736667|sp|B6EGQ7|Y2938_ALISL RecName: Full=UPF0761 membrane protein VSAL_I2938
 gi|208010289|emb|CAQ80622.1| tRNA-processing ribonuclease BN [Aliivibrio salmonicida LFI1238]
          Length = 310

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 41/274 (14%), Positives = 99/274 (36%), Gaps = 8/274 (2%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVP 60
           +    I +       +  + +     A +++   LLS+ P +    ++            
Sbjct: 6   KYSLRISWSYFLFLKQRIIHDRLTVSAGYMAYITLLSLVPLVTVLLSVLSQFPIFSGAGE 65

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           TV + V   +    +  +   + + ++     +  + +      S   + A+  SLN  +
Sbjct: 66  TVQEFVIQNFVPAASDAVEGSLKEFISN-TGKMTAVGSGFLFVASVMLISAIDRSLNYIW 124

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV + R    +  + +  + L  + +         +                +       
Sbjct: 125 RVKKKRRPMYSFSLYWMILTLGPLLVWASLAATSYVTSL------NIMDDEIVSSFYRTL 178

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
             +  ++  F   + ++L +P  K ++   L G +     + V  V F  YI  F +Y  
Sbjct: 179 LGWLPIILSFSAFLGLYLLVPNKKIRVRHALVGAMSAGCLFEVSKVGFAQYITQFPSYEV 238

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMII 274
           +Y  LA++    V++Y+  +  ++GAE+ AS+  
Sbjct: 239 IYGALAAVPILFVWIYLCWIIVLIGAEITASLGE 272


>gi|296135831|ref|YP_003643073.1| ribonuclease BN [Thiomonas intermedia K12]
 gi|295795953|gb|ADG30743.1| ribonuclease BN [Thiomonas intermedia K12]
          Length = 421

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 43/273 (15%), Positives = 102/273 (37%), Gaps = 9/273 (3%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI--DV 65
           +   +      F +++    A  ++ + L+S+ P +     +     A   +   I   +
Sbjct: 10  LLASLRTLARRFAQDNLAQTAGSLTFTTLISLVPLLTVVLAVFTAFPAFDRMQGQIQAHL 69

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
                P+ I+  +   +    A  AK L  +S +     +++ +  +  +LN  +R    
Sbjct: 70  AQTMLPDGISDKVYHYLSDF-AAKAKSLGVVSVVFLIVTATSMMLTVDRALNAIWRTPRP 128

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           RS     L+ +    L  + L     +   +  A   +    P   +          +A+
Sbjct: 129 RSLAQRVLLYWAGFTLGPLVLGASIGLMSFVAGAHRGLLHHLPGGASA------LLSFAS 182

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
              + + L  +  F+P  + +    L G     +++ +G      Y  T +TY+ +Y   
Sbjct: 183 WAVMAVALAALFRFIPNTEVRWRDALIGGFVAALAFSLGGRALAWYFSTVTTYTAVYGTF 242

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           A++   L+++Y   +  ++GA + A +     R
Sbjct: 243 AALPLLLLWIYFSWIAVLVGAMIAAYLPSLRVR 275


>gi|168212796|ref|ZP_02638421.1| YihY family protein [Clostridium perfringens CPE str. F4969]
 gi|170715733|gb|EDT27915.1| YihY family protein [Clostridium perfringens CPE str. F4969]
          Length = 283

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 64/278 (23%), Positives = 132/278 (47%), Gaps = 2/278 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           + +       +   I+   ++D +A+ + ++   +LS  PF++F   L GF   +     
Sbjct: 6   KGFLRKTVIFLVMFIKKIGDDDIFALGAQLAYYMVLSFIPFLMFLMTLVGFSHLNS--DA 63

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           V++++    P      I   +++++     GL  IS   A + SS+G +A+   LN+AY 
Sbjct: 64  VLNLLSNVMPTEAFNLIQSTVIEIVDREQTGLLWISIALAIWVSSSGFKAVIKGLNKAYG 123

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E RS+   +LIS  Y +L ++ ++   F+FV   +   +  K       +  I    R
Sbjct: 124 VKETRSYIKLKLISMIYTILLALIVIATLFLFVFGDVIGDFFMKVLEHPELIYYIWNILR 183

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
               +L + +  +F++   P  +   + ++PG + T + W+  + +F +Y+  FS YS +
Sbjct: 184 YVVVILIMILFFMFLYNATPCVRLGWLEVIPGAVITTLGWISISYIFAYYVNNFSNYSRL 243

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           Y  L ++   + ++++  +  ILG E+NA +      K
Sbjct: 244 YGSLGAVFMFMTWMFITSMILILGGEINAVLAEKNRLK 281


>gi|307730419|ref|YP_003907643.1| ribonuclease BN [Burkholderia sp. CCGE1003]
 gi|307584954|gb|ADN58352.1| ribonuclease BN [Burkholderia sp. CCGE1003]
          Length = 436

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 37/273 (13%), Positives = 96/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A +   E+    +A  ++ + +L++ P       L         F  ++ 
Sbjct: 8   LDTLKRLAQFAAKRSSEDRIPQVAGSLTFTTMLALVPLATVAFALFTAFPLFSSFQESLQ 67

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL TI  +         +  +  + N  +RV 
Sbjct: 68  FFLADHLMPAQLNSQIFKYLNQFAAKAKGLTTIGMVLLFLTGVMTMMTIESAFNVIWRVR 127

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R      L+ +  + L  + + +   +   +          F A   +  +I      
Sbjct: 128 KARPVAQRILVYWAIITLGPILIGVSLSISSYLFTQSM----TFSAAQRMTPVIEWALAG 183

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
             +    +    ++++LP  + +    + G +   I++ +    F +Y+    TY+ +Y 
Sbjct: 184 TALPLTALAFTILYVYLPNCRVEWRDAVIGGVTAAIAFELAKRGFGYYVRRMPTYTAVYG 243

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             + +   L+++Y+     + GA + +++    
Sbjct: 244 AFSVVPLFLLWMYLCWFITLAGAMIASALPAIR 276


>gi|169344091|ref|ZP_02865077.1| YihY family protein [Clostridium perfringens C str. JGS1495]
 gi|169297826|gb|EDS79923.1| YihY family protein [Clostridium perfringens C str. JGS1495]
          Length = 283

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 64/278 (23%), Positives = 132/278 (47%), Gaps = 2/278 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           + +       +   I+   ++D +A+ + ++   +LS  PF++F   L GF   +     
Sbjct: 6   KGFLRKTVIFLVMFIKKIGDDDIFALGAQLAYYMVLSFIPFLMFLMTLVGFSHLNS--DA 63

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           V++++    P      I   +++++     GL  IS   A + SS+G +A+   LN+AY 
Sbjct: 64  VLNLLSNVMPTEAFNLIQSTVIEIVDREQTGLLWISIALAIWVSSSGFKAVIKGLNKAYG 123

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E RS+   +LIS  Y +L ++ ++   F+FV   +   +  K       +  I    R
Sbjct: 124 VKENRSYIKLKLISMIYTILLALIVIATLFLFVFGDVIGDFFMKVLEHPEFIYYIWNMLR 183

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
               +L + +  +F++   P  +   + ++PG + T + W+  + +F +Y+  FS YS +
Sbjct: 184 YVVVILIMILFFMFLYNATPCVRLGWLEVIPGAVITTLGWISISYIFAYYVNNFSNYSRL 243

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           Y  L ++   + ++++  +  ILG E+NA +      K
Sbjct: 244 YGSLGAVFMFMTWMFITSMILILGGEINAVLAEKNRLK 281


>gi|82701586|ref|YP_411152.1| ribonuclease BN, putative [Nitrosospira multiformis ATCC 25196]
 gi|123545059|sp|Q2YBW1|Y452_NITMU RecName: Full=UPF0761 membrane protein Nmul_A0452
 gi|82409651|gb|ABB73760.1| tRNA-processing RNAse BN [Nitrosospira multiformis ATCC 25196]
          Length = 426

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 48/271 (17%), Positives = 104/271 (38%), Gaps = 7/271 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH-QFVPTVIDVVFG 68
           D ++  +  F + +   +A  ++ + LLS+ P +  G ++     A  +F   + + +  
Sbjct: 22  DFMHYVLVRFFQHNCTQIAGSLTFTTLLSLVPMLAIGLSVIAAFPAFAEFSDRIKEFILT 81

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
                 A  +    +Q  A  A  L  I        +   +  +  +LN  +RV  +R  
Sbjct: 82  TMVPEAANKVISVYMQQFADNAAKLTAIGIAFLGVTALALMLTIDEALNSIWRVSRLRPL 141

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
               LI +  + +  + +     +   +  A     +  P    +          + ++ 
Sbjct: 142 LHRLLIYWSVLTIGPLLIGASLSLTSWLMTASRGFTRDIPGGDIM------LLRLSPLVL 195

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
             I     +L +P  +      + G +   I + +    F  YI  F TY  +Y   A+I
Sbjct: 196 TSIAFSASYLIVPNRQVAWRHAIAGGVAAAIGFEIMKEGFAFYITRFPTYQAVYGTFATI 255

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
              L++LY+  +  +LGA + AS+  + +R+
Sbjct: 256 PIFLLWLYLSWLMVLLGAVIAASLSSWRFRE 286


>gi|220918325|ref|YP_002493629.1| ribonuclease BN [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219956179|gb|ACL66563.1| ribonuclease BN [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 338

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 59/273 (21%), Positives = 112/273 (41%), Gaps = 6/273 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
             +           ++   +A+ ++   +L++FPF++F   LA  +        ++  + 
Sbjct: 10  WREFGKGLYHELDHDNVTDLAATVTYYGVLALFPFLLFLVALASVVITPAQAQQLVHQLA 69

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P  + K + D I Q+ A     L    AL A + +S    AL  SLN AY V E R 
Sbjct: 70  QVAPGEVTKIVGDRIQQLGAQQNVTLLGFGALGALWAASGATLALMRSLNTAYDVGESRP 129

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           ++  R I+    ++A V  ++ +   VA       +             I   R+    L
Sbjct: 130 FWKVRAIALLMTVVAGVLALVGALAAVATEPLANAIGGRAG------AAILWLRLPVAAL 183

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            +      ++  LP  + +   I PG +F  + WV+ +  F  Y+  F  Y   Y  +A 
Sbjct: 184 VMMFLWALLYYVLPDVEQRFKFITPGSVFGVVLWVLASWGFGKYVANFGHYDKTYGSIAG 243

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           ++  L ++++  +  ++GAE+NA +       K
Sbjct: 244 VIVLLFWMWLSALVLLVGAEINALIEHRSPEGK 276


>gi|197123527|ref|YP_002135478.1| ribonuclease BN [Anaeromyxobacter sp. K]
 gi|196173376|gb|ACG74349.1| ribonuclease BN [Anaeromyxobacter sp. K]
          Length = 338

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 59/273 (21%), Positives = 112/273 (41%), Gaps = 6/273 (2%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
             +           ++   +A+ ++   +L++FPF++F   LA  +        ++  + 
Sbjct: 10  WREFGKGLYHELDHDNVTDLAATVTYYGVLALFPFLLFLVALASVVITPAQAQQLVHQLA 69

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P  + K + D I Q+ A     L    AL A + +S    AL  SLN AY V E R 
Sbjct: 70  QVAPGEVTKIVGDRIQQLGAQQNVTLLGFGALGALWAASGATLALMRSLNTAYDVGESRP 129

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATML 187
           ++  R I+    ++A V  ++ +   VA       +             I   R+    L
Sbjct: 130 FWKVRAIALLMTVVAGVLALVGALAAVATEPLANAIGGRAG------AAILWLRLPVAAL 183

Query: 188 ALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLAS 247
            +      ++  LP  + +   I PG +F  + WV+ +  F  Y+  F  Y   Y  +A 
Sbjct: 184 VMMFLWALLYYVLPDVEQRFKFITPGSVFGVVLWVLASWGFGKYVANFGHYDKTYGSIAG 243

Query: 248 IMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           ++  L ++++  +  ++GAE+NA +       K
Sbjct: 244 VIVLLFWMWLSALVLLVGAEINALIEHRSPEGK 276


>gi|153828362|ref|ZP_01981029.1| YihY family protein [Vibrio cholerae 623-39]
 gi|148876192|gb|EDL74327.1| YihY family protein [Vibrio cholerae 623-39]
          Length = 309

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 38/275 (13%), Positives = 90/275 (32%), Gaps = 6/275 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M++   +  +     +     +     A +++   LLS+ P +    ++           
Sbjct: 8   MKQQARLGLNFFRYLLARMNHDRVNVNAGYLAYITLLSMVPMLTVLLSILSSFALFANAG 67

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            VI           A  +    L         +  +        +   +  +  +LN  +
Sbjct: 68  EVIQDFVITHFVPAAGEVVKTALIEFVANTGKMTAVGGAFLFVAAIMLISNIDKNLNYIW 127

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV + R    +  + +  + L  + +         I                L  +    
Sbjct: 128 RVQQKRRAVFSFSMYWMILTLGPILVGASIAATSYITSL------KILDNEALSGVYNLF 181

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
             +   +  +   + ++L +P  K      + G +   I + +    F  YI  F +Y  
Sbjct: 182 LRWLPFVLSYCAFVGLYLLVPNKKVHWQHAMLGALIAAILFELSKKGFAAYITQFPSYQL 241

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           +Y  LA+I    V++Y+  +  ++GAE+ A++   
Sbjct: 242 IYGALAAIPILFVWVYLCWLIVLVGAEVTAALGER 276


>gi|127514473|ref|YP_001095670.1| ribonuclease BN [Shewanella loihica PV-4]
 gi|126639768|gb|ABO25411.1| tRNA-processing RNAse BN [Shewanella loihica PV-4]
          Length = 285

 Score =  139 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 45/264 (17%), Positives = 102/264 (38%), Gaps = 8/264 (3%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID-VVFGAWPEVIA 75
           +   E+     A H++   LLS+ P +    ++       + + + I+  ++  +     
Sbjct: 6   QRITEDQINMRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFKGIRSHIETFIYENFIPSAG 65

Query: 76  KPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLIS 135
             +   I + +A  +KG   +   A    +   +  +  SLN  +R  E R   ++  + 
Sbjct: 66  DSVQMYINEFVANASKG-TAVGIGALVVVAILLISNIDKSLNGIWRTTEKRPMVVSFSMY 124

Query: 136 FGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIF 195
           +  + L  V +         +     +         +L  ++        M       + 
Sbjct: 125 WMVLTLGPVLMGASLVATSYVVSLKLFSG------TDLSGVVPLLVERLPMFFSVATFLL 178

Query: 196 VHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFL 255
           +++ +P  K K    L G I   + + +G   F  Y+  F  Y  +Y  LA+I    +++
Sbjct: 179 IYMVVPNTKVKFFHALLGAIVAALLFELGKKGFALYLTEFPAYEAIYGALATIPILFMWV 238

Query: 256 YMLGVFFILGAELNASMIIYYWRK 279
           Y+  +  ++GAE+ A+M  Y  ++
Sbjct: 239 YLSWIIVLIGAEITAAMPEYLDKR 262


>gi|153212589|ref|ZP_01948336.1| YihY family protein [Vibrio cholerae 1587]
 gi|124116460|gb|EAY35280.1| YihY family protein [Vibrio cholerae 1587]
          Length = 309

 Score =  139 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 38/275 (13%), Positives = 89/275 (32%), Gaps = 6/275 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M++   +  +     +     +     A +++   LLS+ P +    ++           
Sbjct: 8   MKQQARLGLNFFRYLLARMNHDRVNVNAGYLAYITLLSMVPMLTVLLSILSSFALFANAG 67

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            VI           A  +    L         +  +        +   +  +  +LN  +
Sbjct: 68  EVIQDFVITHFVPAAGEVVKTALIEFVANTGKMTAVGGAFLFVAAIMLISNIDKNLNYIW 127

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV + R    +  + +  + L  + +         I                L       
Sbjct: 128 RVQQKRRAVFSFSMYWMILTLGPILVGASIAATSYITSL------KILDNETLSGAYNLF 181

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
             +   +  +   + ++L +P  K      + G +   I + +    F  YI  F +Y  
Sbjct: 182 LRWLPFVLSYCAFVGLYLLVPNKKVHWQHAMLGALIAAILFELSKKGFAAYITQFPSYQL 241

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           +Y  LA+I    V++Y+  +  ++GAE+ A++   
Sbjct: 242 IYGALAAIPILFVWVYLCWLIVLVGAEVTAALGER 276


>gi|288559219|sp|B5FFD1|Y098_VIBFM RecName: Full=UPF0761 membrane protein VFMJ11_0098
          Length = 310

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 40/276 (14%), Positives = 100/276 (36%), Gaps = 8/276 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FV 59
           ++    I +  +    +  + +     A +++   LLS+ P I    ++           
Sbjct: 5   IKHKLRIGWSYLLFLKQRVIHDRLTVSAGYMAYITLLSLVPLITVLLSVLSQFPVFSGAG 64

Query: 60  PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
            TV   V   +    +  +   + + ++     +  + +      S   + ++  SLN  
Sbjct: 65  DTVQAFVIQNFVPAASDAVEASLKEFISN-TGKMTAVGSGFLFVASVMLISSIDRSLNYI 123

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +RV + R    +  + +  + L  + +         +                +      
Sbjct: 124 WRVKKKRRPMYSFSLYWMILTLGPLLVGASLAATSYVTSL------KIMDDEIVSSFYRT 177

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
              +  ++  F   + ++L +P  K ++   L G +     +    V F  YI  F +Y 
Sbjct: 178 LLGWLPIILSFSAFVGLYLLVPNKKVRVTHALIGAMSAGCLFEFSKVGFAQYITQFPSYQ 237

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            +Y  LA++    V++Y+  +  ++GAE+ AS+  +
Sbjct: 238 VIYGALAAVPILFVWVYLCWIIVLIGAEITASLGEF 273


>gi|190572909|ref|YP_001970754.1| ribonuclease BN/unknown domain fusion protein [Stenotrophomonas
           maltophilia K279a]
 gi|226737461|sp|B2FQ10|Y865_STRMK RecName: Full=UPF0761 membrane protein Smlt0865
 gi|190010831|emb|CAQ44440.1| putative ribonuclease [Stenotrophomonas maltophilia K279a]
          Length = 424

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 39/266 (14%), Positives = 96/266 (36%), Gaps = 8/266 (3%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVIDVVFGAWP 71
                 F+++  +  A+ ++ + + ++ P  +    +         +   + D VF  + 
Sbjct: 25  RFLWHRFLDDRLFQAAAALAYTTVFALVPLAIVVFGVLSAFPVFDRWSDQLSDYVFSNFV 84

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
              A+     + Q  +  A  L     +A        + ++  + N+ +RV   R     
Sbjct: 85  PNAARAAEGYLRQF-SASAGQLTAAGFIALVVSLLITLNSVEETFNQIWRVGSTRPKLTR 143

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
            L+ +  + L             ++ ++                +       A +L  F+
Sbjct: 144 FLVYWTVLTLG------AMLAAASLAVSARVFAMPLFGTQEGRWLAELALRLAPILIEFV 197

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
            +  +   +P    K    +PG I   +   +       Y+ +F +Y  +Y  +A +   
Sbjct: 198 CITLMFRVVPHHTVKWRHAVPGAILAAVILELVKWGIGAYLGSFQSYQKLYGTVAFVPIL 257

Query: 252 LVFLYMLGVFFILGAELNASMIIYYW 277
           L+++Y+  V  +LGA L++SM  + +
Sbjct: 258 LLWIYLCWVAVLLGASLSSSMAAFRY 283


>gi|59710707|ref|YP_203483.1| ribonuclease BN [Vibrio fischeri ES114]
 gi|67460602|sp|Q5E8Q1|Y100_VIBF1 RecName: Full=UPF0761 membrane protein VF_0100
 gi|59478808|gb|AAW84595.1| predicted inner membrane protein [Vibrio fischeri ES114]
          Length = 310

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 40/276 (14%), Positives = 100/276 (36%), Gaps = 8/276 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FV 59
           ++    I +  +    +  + +     A +++   LLS+ P I    ++           
Sbjct: 5   IKHKLRIGWSYLLFLKQRVIHDRLTVSAGYMAYITLLSLVPLITVLLSVLSQFPVFSGAG 64

Query: 60  PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
            TV   V   +    +  +   + + ++     +  + +      S   + ++  SLN  
Sbjct: 65  ETVQAFVIQNFVPAASDAVEASLKEFISN-TGKMTAVGSGFLFVASVMLISSIDRSLNYI 123

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +RV + R    +  + +  + L  + +         +                +      
Sbjct: 124 WRVKKKRRPMYSFSLYWMILTLGPLLVGASLAATSYVTSL------KIMDDEIVSSFYRT 177

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
              +  ++  F   + ++L +P  K ++   L G +     +    V F  YI  F +Y 
Sbjct: 178 LLGWLPIILSFSAFVGLYLLVPNKKVRVTHALIGAMSAGCLFEFSKVGFAQYITQFPSYQ 237

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            +Y  LA++    V++Y+  +  ++GAE+ AS+  +
Sbjct: 238 VIYGALAAVPILFVWVYLCWIIVLIGAEITASLGEF 273


>gi|225573600|ref|ZP_03782355.1| hypothetical protein RUMHYD_01794 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039039|gb|EEG49285.1| hypothetical protein RUMHYD_01794 [Blautia hydrogenotrophica DSM
           10507]
          Length = 323

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 62/273 (22%), Positives = 121/273 (44%), Gaps = 3/273 (1%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M++    V   +   I    ++   A A+  +   +LS  PF++F   L  +        
Sbjct: 1   MKKKLGPVLSSLSGFIRRTQKDHVGAYAAQAAYFIILSFIPFMLFLMTLVQYTPL--TYN 58

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            V   +    P  I   +   + +V +  +  +  ++ + A + +  G++AL   LN  Y
Sbjct: 59  AVRSAIVSFLPREIQSFVLGIVAEVFS-KSGAVLPVTLVTAIWSAGKGIQALTNGLNTIY 117

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
            V E R+W  TRL S  Y +L    L+    + V        + ++ P LG ++      
Sbjct: 118 HVKETRNWLTTRLWSMLYTVLFVFALIGSLILLVFGNSIQQTLMRYVPFLGEMVARFLGA 177

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           + +   + L +  +F++  LP  ++ + S +PG + T I+W V +  F+ Y   F  +S 
Sbjct: 178 KNFLVFIVLVLLFLFLYKALPNRRASLKSQVPGAVLTAIAWSVFSFGFSIYFTFFPNFSN 237

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
           MY  L +I+  ++++Y+     + GAE+NA   
Sbjct: 238 MYGSLTTIILIMLWMYICMNIVLFGAEINAYYE 270


>gi|260890637|ref|ZP_05901900.1| ribonuclease BN [Leptotrichia hofstadii F0254]
 gi|260859682|gb|EEX74182.1| ribonuclease BN [Leptotrichia hofstadii F0254]
          Length = 521

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 44/272 (16%), Positives = 108/272 (39%), Gaps = 6/272 (2%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           ++    +  +IY    ++ + +   +A  ++  +LL++FP +     +    G  +    
Sbjct: 20  KKKMSEIKRMIYLIYRNYRDGETQILAISLTYYSLLAIFPVVALVLGITKGFGLDKIFIQ 79

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
               ++      +   +      +L+  +  L  +  +   Y +   +  L  S N+ ++
Sbjct: 80  KFFELWPGNNSFLRVIVDVAQRLLLSTESSILTGVGIVILIYSAVKVLITLENSFNKIWK 139

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           + + RS     +     + L  +  V++S +     +A+  + K F     ++ +     
Sbjct: 140 INKKRSITRRVVDYIAIIFLGPIFFVLLSALNS---VAVEEIAKHFSENAVIMNLFIGLF 196

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
             AT + LF    ++   +P    KI   +   I T +      +LF     + + Y+ +
Sbjct: 197 GPATYIILF---SYLFYIIPNTNVKIKPAVYAGIVTTLLTFGWKLLFLLLQSSITRYNII 253

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
           Y  LA I   L+++  + V  +LGA++  S+ 
Sbjct: 254 YGSLALIPIFLIWVQYVWVTILLGAQIAFSIQ 285


>gi|294339996|emb|CAZ88359.1| putative Ribonuclease BN transmembrane protein [Thiomonas sp. 3As]
          Length = 419

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 43/273 (15%), Positives = 102/273 (37%), Gaps = 9/273 (3%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI--DV 65
           +   +      F +++    A  ++ + L+S+ P +     +     A   +   I   +
Sbjct: 10  LLASLRTLARRFAQDNLAQTAGSLTFTTLISLVPLLTVVLAVFTAFPAFDRMQGQIQAHL 69

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
                P+ I+  +   +    A  AK L  +S +     +++ +  +  +LN  +R    
Sbjct: 70  AQTMLPDGISDKVYHYLSDF-AAKAKSLGVVSVVFLIVTATSMMLTVDRALNAIWRTPRP 128

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           RS     L+ +    L  + L     +   +  A   +    P   +          +A+
Sbjct: 129 RSLAQRVLLYWAGFTLGPLVLGASIGLMSFVAGAHRGLLHHLPGGASA------LLSFAS 182

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
              + + L  +  F+P  + +    L G     +++ +G      Y  T +TY+ +Y   
Sbjct: 183 WAVMAVALAALFRFIPNTEVRWRDALIGGFVAALAFSLGGRALAWYFSTVTTYTAVYGTF 242

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           A++   L+++Y   +  ++GA + A +     R
Sbjct: 243 AALPLLLLWIYFSWIAVLVGAMIAAYLPSLRVR 275


>gi|163795887|ref|ZP_02189851.1| probable ribonuclease [alpha proteobacterium BAL199]
 gi|159178920|gb|EDP63456.1| probable ribonuclease [alpha proteobacterium BAL199]
          Length = 443

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 48/271 (17%), Positives = 96/271 (35%), Gaps = 3/271 (1%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
           +  A+  F  + G   A+ ++ + LL++ P +     +     A Q V   I+++     
Sbjct: 9   VLYAVRRFYRDGGLQAAAALTYTTLLALVPLMTIAFAIFSAFPAFQAVQYQIELLLFQNL 68

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
                 I    +      A  L T+  +A A  +   +  +    NR +RV   R     
Sbjct: 69  VPEVGSIIQSHISEFTRNATNLTTVGVVALAVSAVLLLSTVESVFNRIWRVERERPILTR 128

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLL---IIWNGRIYATMLA 188
            LI +  + L  V +     +   +   +         L  + L       G        
Sbjct: 129 LLIFWTVLTLGPVLMGASFTLTTGVFDWIGQFANESVGLAPISLEGDRWVIGGRLLAAAL 188

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
                  + + +PA   ++     G     ++  +   +F  Y+V F +Y  +Y  LA++
Sbjct: 189 QATAFTILFVLVPARPVRLRDAAVGGAIAGVALEILKWVFRLYVVGFPSYQAIYGALAAV 248

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
              L++LY+     I+GA   AS   +   +
Sbjct: 249 PIFLIWLYLSWTVIIMGAVFAASFSEWRSAR 279


>gi|119899455|ref|YP_934668.1| exoribonuclease II [Azoarcus sp. BH72]
 gi|288559235|sp|A1KAC6|Y3165_AZOSB RecName: Full=UPF0761 membrane protein azo3165
 gi|119671868|emb|CAL95782.1| exoribonuclease II [Azoarcus sp. BH72]
          Length = 408

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 46/272 (16%), Positives = 98/272 (36%), Gaps = 7/272 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLG-AHQFVPTVIDVVFG 68
           D +    E F       +A  ++ + LL++ P +     + G L    +   ++ D +  
Sbjct: 8   DFLRLLGERFSATRCPQVAGSLAFTTLLALVPLLTVAIGVFGNLPGMDKLGASLKDFLLE 67

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
                 A  I        +  A  L  I     A  +   +  +    N+ + V   R  
Sbjct: 68  NLLPDRAGRIITTYALQFSQKAARLTLIGTAMLAVTALMLLATIERVFNQIWGVRHRRPL 127

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
            +   +S+  + L  V L         +    A      P +G +             L 
Sbjct: 128 LMRITVSWFMLTLGPVILGGSVVATGYLVSTSAEWSDRLPWIGEIAAAT------LPPLL 181

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           L     F++  +P    +++  L G +   + +++       +I  F TY+ +Y   A++
Sbjct: 182 LGALFSFLYYAVPNHPVRLLHALAGGLCAALVFLLMQRGLGLFIAGFPTYTLIYGTFAAL 241

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
              L++LY+     +LGA + A++  +  R++
Sbjct: 242 PIFLLWLYLSWTVILLGALITATLPAFLERQR 273


>gi|254523442|ref|ZP_05135497.1| tRNA-processing ribonuclease BN [Stenotrophomonas sp. SKA14]
 gi|219721033|gb|EED39558.1| tRNA-processing ribonuclease BN [Stenotrophomonas sp. SKA14]
          Length = 414

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 39/266 (14%), Positives = 96/266 (36%), Gaps = 8/266 (3%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVIDVVFGAWP 71
                 F+++  +  A+ ++ + + ++ P  +    +         +   + D VF  + 
Sbjct: 15  RFLWHRFLDDRLFQAAAALAYTTVFALVPLAIVVFGVLSAFPVFDRWSDQLSDYVFSNFV 74

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
              A+     + Q  +  A  L     +A        + ++  + N+ +RV   R     
Sbjct: 75  PNAARAAEGYLRQF-SASAGQLTAAGFIALVVSLLITLNSVEETFNQIWRVGSTRPKLTR 133

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
            L+ +  + L             ++ ++                +       A +L  F+
Sbjct: 134 FLVYWTVLTLG------AMLAAASLAVSARVFAMPLFGTQEGRWLAELALRLAPILIEFV 187

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
            +  +   +P    K    +PG I   +   +       Y+ +F +Y  +Y  +A +   
Sbjct: 188 CITLMFRVVPHHTVKWRHAVPGAILAAVILELVKWGIGAYLGSFQSYQKLYGTVAFVPIL 247

Query: 252 LVFLYMLGVFFILGAELNASMIIYYW 277
           L+++Y+  V  +LGA L++SM  + +
Sbjct: 248 LLWIYLCWVAVLLGASLSSSMAAFRY 273


>gi|168216626|ref|ZP_02642251.1| YihY family protein [Clostridium perfringens NCTC 8239]
 gi|182626819|ref|ZP_02954556.1| YihY family protein [Clostridium perfringens D str. JGS1721]
 gi|177907828|gb|EDT70428.1| YihY family protein [Clostridium perfringens D str. JGS1721]
 gi|182381516|gb|EDT78995.1| YihY family protein [Clostridium perfringens NCTC 8239]
          Length = 283

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 64/278 (23%), Positives = 132/278 (47%), Gaps = 2/278 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           + +       +   I+   ++D +A+ + ++   +LS  PF++F   L GF   +     
Sbjct: 6   KGFLRKTVIFLVMFIKKIGDDDIFALGAQLAYYMVLSFIPFLMFLMTLVGFSHLNS--DA 63

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           V++++    P      I   +++++     GL  IS   A + SS+G +A+   LN+AY 
Sbjct: 64  VLNLLSNVMPTEAFNLIQSTVIEIVDREQTGLLWISIALAIWVSSSGFKAVIKGLNKAYG 123

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E RS+   +LIS  Y +L ++ ++   F+FV   +   +  K       +  I    R
Sbjct: 124 VKETRSYIKLKLISMIYTILLALIVIATLFLFVFGDVIGDFFMKVLEHPEFIYYIWNILR 183

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
               +L + +  +F++   P  +   + ++PG + T + W+  + +F +Y+  FS YS +
Sbjct: 184 YVVVILIMILFFMFLYNATPCVRLGWLEVIPGAVITTLGWISISYIFAYYVNNFSNYSRL 243

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           Y  L ++   + ++++  +  ILG E+NA +      K
Sbjct: 244 YGSLGAVFMFMTWMFITSMILILGGEINAVLAEKNRLK 281


>gi|86159452|ref|YP_466237.1| ribonuclease BN [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85775963|gb|ABC82800.1| ribonuclease BN, putative [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 338

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 59/271 (21%), Positives = 112/271 (41%), Gaps = 6/271 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           +      +    ++   +A+ ++   +L++FPF++F   LA  +        ++  +   
Sbjct: 12  EFGKGLYQELGHDNVTDLAATVTYYGVLALFPFLLFLVALASVVITPAQAQALVHQLAQV 71

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            P  + K + D I Q+ A     L    AL A + +S    AL  SLN AY V E R ++
Sbjct: 72  APGEVTKIVGDRIQQLGAQQNVTLLGFGALGALWAASGATLALMRSLNTAYDVKESRPFW 131

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
             R I+    ++A V  +  +   VA       +             I   R+    L +
Sbjct: 132 KVRAIALLMTVVAGVLALAGAVAAVATEPIANAIGGSAG------AAILWLRLPFAALVM 185

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
                 ++  LP  + +   I PG +F  + WV+ +  F  Y+  F  Y   Y  +A ++
Sbjct: 186 MSLWALLYYVLPDVEQQFKFITPGSVFGVVLWVLASWGFGKYVANFGHYDKTYGSIAGVI 245

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             L ++++  +  ++GAE+NA +       K
Sbjct: 246 VLLFWMWISSLVLLVGAEINALIEHRSPEGK 276


>gi|18309267|ref|NP_561201.1| YihY family protein [Clostridium perfringens str. 13]
 gi|110799841|ref|YP_694741.1| YihY family protein [Clostridium perfringens ATCC 13124]
 gi|168207453|ref|ZP_02633458.1| YihY family protein [Clostridium perfringens E str. JGS1987]
 gi|168210398|ref|ZP_02636023.1| YihY family protein [Clostridium perfringens B str. ATCC 3626]
 gi|18143943|dbj|BAB79991.1| conserved hypothetical protein [Clostridium perfringens str. 13]
 gi|110674488|gb|ABG83475.1| YihY family protein [Clostridium perfringens ATCC 13124]
 gi|170661202|gb|EDT13885.1| YihY family protein [Clostridium perfringens E str. JGS1987]
 gi|170711461|gb|EDT23643.1| YihY family protein [Clostridium perfringens B str. ATCC 3626]
          Length = 283

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 64/278 (23%), Positives = 132/278 (47%), Gaps = 2/278 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           + +       +   I+   ++D +A+ + ++   +LS  PF++F   L GF   +     
Sbjct: 6   KGFLRKTVIFLVMFIKKIGDDDIFALGAQLAYYMVLSFIPFLMFLMTLVGFSHLNS--DA 63

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           V++++    P      I   +++++     GL  IS   A + SS+G +A+   LN+AY 
Sbjct: 64  VLNLLSNVMPTEAFNLIQSTVIEIVDREQTGLLWISIALAIWVSSSGFKAVIKGLNKAYG 123

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V E RS+   +LIS  Y +L ++ ++   F+FV   +   +  K       +  I    R
Sbjct: 124 VKETRSYIKLKLISMIYTILLALIVIATLFLFVFGDVIGDFFMKVLEHPEFIYYIWNMLR 183

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
               +L + +  +F++   P  +   + ++PG + T + W+  + +F +Y+  FS YS +
Sbjct: 184 YVVVILIMILFFMFLYNATPCVRLGWLEVIPGAVITTLGWISISYIFAYYVNNFSNYSRL 243

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           Y  L ++   + ++++  +  ILG E+NA +      K
Sbjct: 244 YGSLGAVFMFMTWMFITSMILILGGEINAVLAEKNRLK 281


>gi|37678387|ref|NP_932996.1| ribonuclease BN [Vibrio vulnificus YJ016]
 gi|37197126|dbj|BAC92967.1| ribonuclease BN [Vibrio vulnificus YJ016]
          Length = 317

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 36/270 (13%), Positives = 95/270 (35%), Gaps = 8/270 (2%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID-VVFGA 69
            +   I     +     A +++   LLS+ P +    ++       + V +V+   +   
Sbjct: 26  FVRYLIARMNHDRINVNAGYLAYITLLSIVPMLTVLLSILSKFSVFENVGSVLQSFIINN 85

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           +       +   + + +A     +  + A      +   +  +  +LN  +RV + R   
Sbjct: 86  FVPASGDAVHAALQEFIAN-TGKMTAVGAAFLFVAALMLISNIDKNLNYIWRVKKKRRAV 144

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
            +  + +  + L  + +         I                +  +      +   +  
Sbjct: 145 FSFSMYWMVLTLGPILVGASIAATSYITSL------RLLDSEAISTVYDQLLRWLPFILS 198

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
               + ++L +P  K +    + G +   + + +    F  YI  F +Y  +Y  LA+I 
Sbjct: 199 SSAFVGLYLLVPNKKVQFSHAVVGAMIAAVLFELSKKGFAAYITQFPSYQLIYGALAAIP 258

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
              V++Y+  +  ++GAE+ A++      +
Sbjct: 259 ILFVWVYLCWLIVLIGAEVTAALGEREHWR 288


>gi|159900436|ref|YP_001546683.1| putative ribonuclease BN [Herpetosiphon aurantiacus ATCC 23779]
 gi|159893475|gb|ABX06555.1| putative ribonuclease BN [Herpetosiphon aurantiacus ATCC 23779]
          Length = 360

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 39/274 (14%), Positives = 95/274 (34%), Gaps = 3/274 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGF-LGAHQFVPTVIDVV 66
           + ++     + + ++    + + ++   + S+ P ++   ++AG           V   +
Sbjct: 5   IINLFKQTFKEWGDDKVPRLGAALAYYTVFSLAPLLIIAISIAGLVFDQEAARGEVTRQL 64

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFT-ISALAAAYFSSNGVEALRISLNRAYRVVEM 125
                +  A+ I + I Q     +  + T I      + +S     L+ ++N  + V   
Sbjct: 65  ATLINDDAAQAINEIIQQSSNQRSGIIGTLIGVATLLFGASGVFGQLKDAMNTIWGVQPK 124

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
               I  ++   +     V  V    +   I   L    K +     + ++     +  +
Sbjct: 125 PRRGIWGIVQERFFSFTMVLGVGFLLLVSLIISTLLEAGKNWLFGAEIGIVFQIINLIVS 184

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
              + +    +  FLP  K     +  G   T + + +G      Y+ T S+ ++ +   
Sbjct: 185 FGIITVVFALLFKFLPDVKMAWRDVWIGAALTALLFTIGKFAIGQYLST-SSTASTFGAA 243

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            S++  L+++Y        GAEL       Y   
Sbjct: 244 GSLIIVLLWVYYSSQILFFGAELTQVYANMYGSH 277


>gi|166710796|ref|ZP_02242003.1| ribonuclease BN/unknown domain fusion protein [Xanthomonas oryzae
           pv. oryzicola BLS256]
          Length = 425

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 41/266 (15%), Positives = 98/266 (36%), Gaps = 8/266 (3%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV-PTVIDVVFGAWP 71
                 F+++  +  A+ ++ + + ++ P  +    +     A       + D +F  + 
Sbjct: 25  RFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLSAFPAFNEWKDALTDFIFTNFV 84

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
              A+ + + + + L            +A        + ++  + N  +RV   R     
Sbjct: 85  PGAARSVQNYLNRSLED-LGKFTVAGMVALVASLLITLHSIEQTFNSIWRVAAARPKVTR 143

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
            LI +  + L ++       +   +     +       L             A M   F+
Sbjct: 144 FLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTEGQWLAEFAW------RLAPMAVEFV 197

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
            ++ ++  +P    ++   LPG +   I   +    F  Y+  F TY  +Y  L+++   
Sbjct: 198 CIVLIYRVVPQHVVRLRHALPGALLAVILMEIVKWGFGFYLGNFQTYQRIYGALSALPIL 257

Query: 252 LVFLYMLGVFFILGAELNASMIIYYW 277
           L+++Y+  V  +LGA L +SM  + +
Sbjct: 258 LLWIYLSWVSVLLGASLASSMAAFRY 283


>gi|328542071|ref|YP_004302180.1| ribonuclease rnase bn (Rbn) transmembrane protein [polymorphum
           gilvum SL003B-26A1]
 gi|326411821|gb|ADZ68884.1| Putative ribonuclease rnase bn (Rbn) transmembrane protein
           [Polymorphum gilvum SL003B-26A1]
          Length = 291

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 118/280 (42%), Positives = 174/280 (62%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           + +   I + ++ DA+ HF  +DGWAMASH++LS+LL++FP ++F A LAGFLG      
Sbjct: 3   LSKRLVIGYRVLGDALGHFNRDDGWAMASHVALSSLLALFPLLIFIAALAGFLGLTGTAA 62

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            V +++F AWPE +A P+ +EI +VL VP   L T   +AA +F+SNGVEA+R++LNRAY
Sbjct: 63  RVSELIFEAWPEQVAAPVANEIKKVLTVPRGDLLTFGVVAALWFASNGVEAVRVALNRAY 122

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV++ R + + RL S   VLL S+ L+  +F+ V  PLALA    +FP L +    I   
Sbjct: 123 RVIDTRPFVLLRLQSILLVLLCSIGLIAFTFLMVLAPLALAAAHAWFPWLADFAGRINAV 182

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R  A  L    GLI VH  LPA + + + ILPGV  T   W+     F  Y+  ++ Y +
Sbjct: 183 RYGAASLVAVAGLIVVHAVLPAGRRRFVDILPGVAATLALWLAAGAAFGAYLAGYADYVS 242

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            YAGLA +M+ LVFLY++ +  ++G ELNA++I     ++
Sbjct: 243 TYAGLAGVMSALVFLYIVALALLIGGELNAALIRQRDLRR 282


>gi|77463212|ref|YP_352716.1| ribonuclease BN family protein [Rhodobacter sphaeroides 2.4.1]
 gi|77387630|gb|ABA78815.1| Ribonuclease BN family protein [Rhodobacter sphaeroides 2.4.1]
          Length = 373

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 57/273 (20%), Positives = 120/273 (43%), Gaps = 8/273 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI         E+    +A+ ++   LL++FP +    +L G       +    + + G 
Sbjct: 79  DIALRVWRSIDEDRVMLVAAGVTFYLLLALFPALAAFVSLYGLFADPAVIAEQAESLRGV 138

Query: 70  WPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P      +T+++  + +  +  L     +S L A + +++G++AL  ++N A+   E R
Sbjct: 139 IPAEGLDLLTEQLRTLASGESSSLTFSFVLSFLIAFWSANSGMKALIEAMNIAHEEREKR 198

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+    L+SF   L A V  V M    +     +  V   F        ++W  R    +
Sbjct: 199 SFVKLTLLSFALTLGAMVLAVTM----IVAVAVVPAVLAVFDLGSVATAVVWLVRWPLLL 254

Query: 187 LALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           L +   +  ++ + P+  +     +  G     + W++ ++ FT Y+  F+ YS  Y  L
Sbjct: 255 LLVATAMAGLYRWAPSRNAPEWRWVTWGSGIATLVWLIASIAFTIYLENFANYSATYGSL 314

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            +++  L+++++  +  I+GAE+N+ M     R
Sbjct: 315 GALVGLLLWVWIAVMILIVGAEVNSEMEHQTAR 347


>gi|126665845|ref|ZP_01736826.1| ribonuclease BN-like family protein [Marinobacter sp. ELB17]
 gi|126629779|gb|EBA00396.1| ribonuclease BN-like family protein [Marinobacter sp. ELB17]
          Length = 441

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 46/264 (17%), Positives = 100/264 (37%), Gaps = 2/264 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
             +Y  I  F+       A  +  + LLS+ P +    ++   LG HQ +   +   F  
Sbjct: 37  RSLYALIRDFISGQLTLHAMSLVYTTLLSIVPLLALSFSVLKALGVHQKMEPFLYQFFQP 96

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
                 +     +  V  +    L ++      Y   + V+ +  S N  +RV EMRS  
Sbjct: 97  LGPQGIEIAERILGFVDNMKVGVLGSVGLAVLVYTVVSLVQKIERSFNMIWRVPEMRSLA 156

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
                    +++  + +V    +   I    +   +    +     +I     +     +
Sbjct: 157 QRFSNYLSVIMVGPLLMVSAIGISATI--FSSSFVQTLIEIEPFGSVILLVSRFTPFFLV 214

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
                FV++F+P  + K+       +   +SW    +LF  ++   + Y+ +Y+  A  +
Sbjct: 215 VGAFTFVYVFIPNTRVKLRYAFLAGLIAGVSWQGAGMLFASFVAGSAKYAAIYSSFAIGI 274

Query: 250 TCLVFLYMLGVFFILGAELNASMI 273
             L+++Y+  +  +LGA L+  + 
Sbjct: 275 IMLIWIYLNWMILLLGASLSFYLQ 298


>gi|16762407|ref|NP_458024.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar Typhi
           str. CT18]
 gi|29143895|ref|NP_807237.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
 gi|62182487|ref|YP_218904.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|168232952|ref|ZP_02658010.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168237643|ref|ZP_02662701.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168244229|ref|ZP_02669161.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168263083|ref|ZP_02685056.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168467359|ref|ZP_02701196.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168821635|ref|ZP_02833635.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194444515|ref|YP_002043245.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194450742|ref|YP_002048026.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194470662|ref|ZP_03076646.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194734561|ref|YP_002116947.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197249949|ref|YP_002148947.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|198245131|ref|YP_002217947.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|200387726|ref|ZP_03214338.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204930339|ref|ZP_03221316.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205354393|ref|YP_002228194.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207859217|ref|YP_002245868.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|213161529|ref|ZP_03347239.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar Typhi
           str. E00-7866]
 gi|213426072|ref|ZP_03358822.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar Typhi
           str. E02-1180]
 gi|213620640|ref|ZP_03373423.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-2068]
 gi|213647342|ref|ZP_03377395.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar Typhi
           str. J185]
 gi|213852982|ref|ZP_03382514.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar Typhi
           str. M223]
 gi|238912170|ref|ZP_04656007.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|289828504|ref|ZP_06546358.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-3139]
 gi|32699644|sp|Q8Z2T8|YIHY_SALTI RecName: Full=UPF0761 membrane protein yihY
 gi|75479427|sp|Q57HI9|YIHY_SALCH RecName: Full=UPF0761 membrane protein yihY
 gi|226737451|sp|B5EZZ9|YIHY_SALA4 RecName: Full=UPF0761 membrane protein yihY
 gi|226737452|sp|B5FP16|YIHY_SALDC RecName: Full=UPF0761 membrane protein yihY
 gi|226737453|sp|B5QWW1|YIHY_SALEP RecName: Full=UPF0761 membrane protein yihY
 gi|226737454|sp|B5RFE6|YIHY_SALG2 RecName: Full=UPF0761 membrane protein yihY
 gi|226737455|sp|B4TBV9|YIHY_SALHS RecName: Full=UPF0761 membrane protein yihY
 gi|226737456|sp|B4SZW9|YIHY_SALNS RecName: Full=UPF0761 membrane protein yihY
 gi|226737457|sp|B4TPN7|YIHY_SALSV RecName: Full=UPF0761 membrane protein yihY
 gi|25512569|pir||AE0947 ribonuclease BN (EC 3.1.-.-) [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16504711|emb|CAD09599.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29139531|gb|AAO71097.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
 gi|62130120|gb|AAX67823.1| tRNA processing exoribonuclease BN [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|194403178|gb|ACF63400.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194409046|gb|ACF69265.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194457026|gb|EDX45865.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194710063|gb|ACF89284.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195630178|gb|EDX48818.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197213652|gb|ACH51049.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197289415|gb|EDY28780.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197939647|gb|ACH76980.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199604824|gb|EDZ03369.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204320743|gb|EDZ05945.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205274174|emb|CAR39189.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205332809|gb|EDZ19573.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205336891|gb|EDZ23655.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205341886|gb|EDZ28650.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205348123|gb|EDZ34754.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206711020|emb|CAR35389.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|320088432|emb|CBY98191.1| tRNA processing exoribonuclease BN [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|322613091|gb|EFY10041.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322619162|gb|EFY16045.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322626028|gb|EFY22840.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322626513|gb|EFY23319.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322632375|gb|EFY29123.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322635144|gb|EFY31865.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322642654|gb|EFY39244.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322647943|gb|EFY44415.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322650693|gb|EFY47094.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322652876|gb|EFY49213.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322657191|gb|EFY53471.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322662322|gb|EFY58537.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322666857|gb|EFY63033.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322672127|gb|EFY68242.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322675849|gb|EFY71921.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322681736|gb|EFY77762.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322684070|gb|EFY80079.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|322716982|gb|EFZ08553.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323193342|gb|EFZ78557.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323197699|gb|EFZ82832.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323200728|gb|EFZ85799.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323207268|gb|EFZ92220.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323211470|gb|EFZ96311.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323218485|gb|EGA03193.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323221033|gb|EGA05465.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323226009|gb|EGA10228.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323231689|gb|EGA15801.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323236063|gb|EGA20141.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323239516|gb|EGA23565.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323243891|gb|EGA27902.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323249253|gb|EGA33170.1| hypothetical protein SEEM9199_02097 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323250504|gb|EGA34387.1| hypothetical protein SEEM8282_08567 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323258958|gb|EGA42610.1| hypothetical protein SEEM8283_01652 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323260203|gb|EGA43826.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323265322|gb|EGA48819.1| hypothetical protein SEEM8285_17387 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323270544|gb|EGA53990.1| hypothetical protein SEEM8287_12923 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326625738|gb|EGE32083.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar Dublin
           str. 3246]
          Length = 290

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 49/279 (17%), Positives = 97/279 (34%), Gaps = 10/279 (3%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-T 61
            +   V   +    +   E++   +A +++  +LLS+ P I     L         V   
Sbjct: 11  RHTRPVRAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSDVSIQ 70

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           +   +F  +       I   I Q +A   K +  + A      +   + A+  +LN  +R
Sbjct: 71  LRHFIFANFMPATGDVIQRYIEQFVANSNK-MTAVGACGLIVTALLLMYAIDSALNTIWR 129

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
               R    +  + +  + L  +       +   +               +L  +I N  
Sbjct: 130 SKRTRPKVYSFAVYWMILTLGPLLAGASLAISSYLLSLR--------WASDLNTVIDNVL 181

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
               +L  +I    ++  +P  +      L G     + +  G   F  YI  F +Y  +
Sbjct: 182 RILPLLLSWISFWLLYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQLI 241

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           Y  LA I    V++Y      +LGAE+  ++  Y   K+
Sbjct: 242 YGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQ 280


>gi|301020240|ref|ZP_07184360.1| YihY family protein [Escherichia coli MS 196-1]
 gi|299881873|gb|EFI90084.1| YihY family protein [Escherichia coli MS 196-1]
          Length = 290

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 46/280 (16%), Positives = 98/280 (35%), Gaps = 10/280 (3%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP- 60
           R     ++  +    +   E++   +A +++  +LLS+ P +     L         V  
Sbjct: 10  RHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSI 69

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            +   +F  +       I   I Q +A   K +  + A      +   + ++  +LN  +
Sbjct: 70  QLRHFIFANFLPATGDVIQRYIEQFVANSNK-MTAVGACGLIVTALLLMYSIDSALNTIW 128

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           R    R    +  + +  + L  +       +   +               +L  +I N 
Sbjct: 129 RSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSL--------HWASDLNTVIDNV 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                +L  +I    ++  +P  +      + G     + +  G   F  YI  F +Y  
Sbjct: 181 LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +Y  LA I    V++Y      +LGAE+  ++  Y   K+
Sbjct: 241 IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQ 280


>gi|209522505|ref|ZP_03271096.1| ribonuclease BN [Burkholderia sp. H160]
 gi|209497059|gb|EDZ97323.1| ribonuclease BN [Burkholderia sp. H160]
          Length = 437

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 36/273 (13%), Positives = 97/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A +   E+    +A  ++ + +L++ P       L         F  ++ 
Sbjct: 9   LDTLKRLAQFAAQRIGEDRIPQVAGSLTFTTMLALVPLATVAFALFTAFPIFSSFQASLQ 68

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL TI  +     +   +  +  + N  +RV 
Sbjct: 69  FFLADHLMPARLNDQIFKYLNQFASKAKGLTTIGMIVLFLTAVMTMMTVESAFNVIWRVR 128

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R      L+ +  + L  + + +   +   +                +   + +  + 
Sbjct: 129 KARPVAQRILVYWAIITLGPILIGVSLSISSYLFTQSMSYSAAQRITPLIAWALASATLP 188

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+L        ++++LP  +      + G +   +++ +    F +Y+    TY+ +Y 
Sbjct: 189 LTVL----AFTILYVYLPNCRVAWRDAVVGGVIAAVAFELSKRGFGYYVRQIPTYTAVYG 244

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             A++   L+++Y+     + GA + +++    
Sbjct: 245 AFAAVPLFLLWMYLCWFITLTGAMIASALPAIR 277


>gi|21230334|ref|NP_636251.1| ribonuclease BN/unknown domain fusion protein [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66769672|ref|YP_244434.1| ribonuclease BN/unknown domain fusion protein [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|32699642|sp|Q8PC75|Y860_XANCP RecName: Full=UPF0761 membrane protein XCC0860
 gi|81175005|sp|Q4URA9|Y3370_XANC8 RecName: Full=UPF0761 membrane protein XC_3370
 gi|21111886|gb|AAM40175.1| ribonuclease BN [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66575004|gb|AAY50414.1| ribonuclease BN [Xanthomonas campestris pv. campestris str. 8004]
          Length = 425

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 41/266 (15%), Positives = 98/266 (36%), Gaps = 8/266 (3%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV-PTVIDVVFGAWP 71
                 F+++  +  A+ ++ + + ++ P  +    +     A       + D +F  + 
Sbjct: 25  RFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLSAFPAFNEWKDALTDFIFNNFV 84

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
              A+ + + + + L            +A        + ++  + N  +RV   R     
Sbjct: 85  PGAARSVQNYLNRSLED-LGKFTVAGMVALVASLLITLHSIEQTFNSIWRVAAARPKVTR 143

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
            LI +  + L ++       +   +     +       L             A M   F+
Sbjct: 144 FLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTEGQWLAEFAW------RLAPMAVEFV 197

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
            ++ ++  +P    ++   LPG +   I   +    F  Y+  F TY  +Y  L+++   
Sbjct: 198 CIVLIYRVVPQHAVRLRHALPGALLAVILMEIVKWGFGFYLGNFQTYQRIYGALSALPIL 257

Query: 252 LVFLYMLGVFFILGAELNASMIIYYW 277
           L+++Y+  V  +LGA L +SM  + +
Sbjct: 258 LLWIYLSWVSVLLGASLASSMSAFRY 283


>gi|260220892|emb|CBA28912.1| hypothetical protein Csp_A09510 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 418

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 47/275 (17%), Positives = 96/275 (34%), Gaps = 10/275 (3%)

Query: 1   MREYFCIVFDIIYDAIE-HFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV 59
           +R+   I +      +   F E+     AS ++ +  +++ P I     +          
Sbjct: 21  LRDIASIPWRDAAITLRERFREDRLGLTASSLTFTTTIALVPLITVALAVFTAFPMFAKF 80

Query: 60  PTVI--DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLN 117
             V+   ++    P+ IA+ +   + Q  A  A  L           +   +  +  +LN
Sbjct: 81  QDVLQKWLIESLVPDNIARQVLGYLNQF-AGKASRLGVAGLTILLGTALALIFTIDRTLN 139

Query: 118 RAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLII 177
             +RV + R +    LI +  V L  + L     +      A          +G L   +
Sbjct: 140 SIWRVKKRRPFGQRVLIYWAAVTLGPLLLGASLSITSYAITASKG------VVGGLPGGL 193

Query: 178 WNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
                    + +  G   +  ++P    +      G +F      +       Y+    T
Sbjct: 194 TLLLDSLQFVLVAAGTAAMFHYVPNTHVRWGHAWMGGLFVSTGMELARKGLALYLSKVPT 253

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
           YS +Y   A++   L+++Y+  V  +LGA L A +
Sbjct: 254 YSAVYGAFATVPILLIWIYIAWVIVLLGAALTAYL 288


>gi|256828407|ref|YP_003157135.1| ribonuclease BN [Desulfomicrobium baculatum DSM 4028]
 gi|256577583|gb|ACU88719.1| ribonuclease BN [Desulfomicrobium baculatum DSM 4028]
          Length = 460

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 47/265 (17%), Positives = 98/265 (36%), Gaps = 1/265 (0%)

Query: 4   YFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI 63
           +   +   +  A   F    G   AS ++   LLS+ P       +A   G  Q +   +
Sbjct: 32  FVIRLLRTLLFATRDFQNRQGSLQASALTFYTLLSLVPLAAMAFGIAKGFGLEQLLEKEL 91

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
              F A  EV+ + I      +       +  I  +   +     +  +  + NR + V 
Sbjct: 92  LRNFAAQQEVVLQVIAFARNMLDNTKGGLIAGIGVIILFWSVIKVLGRIEQNFNRIWAV- 150

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
             RS           +L+A + L++     V I   +  +       G L   +  G  +
Sbjct: 151 PSRSMSRRLSDYLAIMLIAPLLLILSGSATVFIASQVRAISNQVGMPGMLDPAVSLGLGF 210

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
           A  L L+     ++L +P  + +    L   I    ++ +  V +  + +  ++Y+ +Y 
Sbjct: 211 APYLLLWALFTLLYLIMPNTRVQFAGALLAGILAGSAYQLLQVSYIAFQINVASYNAIYG 270

Query: 244 GLASIMTCLVFLYMLGVFFILGAEL 268
             A++   L++L +     + GAE+
Sbjct: 271 SFAALPLFLIWLQLSWHIVLFGAEI 295


>gi|167551491|ref|ZP_02345246.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205323791|gb|EDZ11630.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
          Length = 290

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 49/279 (17%), Positives = 97/279 (34%), Gaps = 10/279 (3%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-T 61
            +   V   +    +   E++   +A +++  +LLS+ P I     L         V   
Sbjct: 11  RHTRPVRAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSDVSIQ 70

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           +   +F  +       I   I Q +A   K +  + A      +   + A+  +LN  +R
Sbjct: 71  LRHFIFANFMPATGDVIQRYIEQFVANSNK-MTAVGACGLIVTALLLMYAIDSALNTIWR 129

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
               R    +  + +  + L  +       +   +               +L  +I N  
Sbjct: 130 SKRTRPKVYSFAVYWMILTLGPLLAGASLAISSYLLSLR--------WASDLNTVIDNVL 181

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
               +L  +I    ++  +P  +      L G     + +  G   F  YI  F +Y  +
Sbjct: 182 RILPLLLSWISFWLLYSIVPTTRVPNRDALIGAFVAALLFEAGKKGFALYITMFPSYQLI 241

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           Y  LA I    V++Y      +LGAE+  ++  Y   K+
Sbjct: 242 YGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQ 280


>gi|39931647|sp|Q7MQ07|Y203_VIBVY RecName: Full=UPF0761 membrane protein VV0203
          Length = 313

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 36/270 (13%), Positives = 95/270 (35%), Gaps = 8/270 (2%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID-VVFGA 69
            +   I     +     A +++   LLS+ P +    ++       + V +V+   +   
Sbjct: 22  FVRYLIARMNHDRINVNAGYLAYITLLSIVPMLTVLLSILSKFSVFENVGSVLQSFIINN 81

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           +       +   + + +A     +  + A      +   +  +  +LN  +RV + R   
Sbjct: 82  FVPASGDAVHAALQEFIAN-TGKMTAVGAAFLFVAALMLISNIDKNLNYIWRVKKKRRAV 140

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
            +  + +  + L  + +         I                +  +      +   +  
Sbjct: 141 FSFSMYWMVLTLGPILVGASIAATSYITSL------RLLDSEAISTVYDQLLRWLPFILS 194

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
               + ++L +P  K +    + G +   + + +    F  YI  F +Y  +Y  LA+I 
Sbjct: 195 SSAFVGLYLLVPNKKVQFSHAVVGAMIAAVLFELSKKGFAAYITQFPSYQLIYGALAAIP 254

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
              V++Y+  +  ++GAE+ A++      +
Sbjct: 255 ILFVWVYLCWLIVLIGAEVTAALGEREHWR 284


>gi|15893776|ref|NP_347125.1| tRNA-processing ribonuclease BN [Clostridium acetobutylicum ATCC
           824]
 gi|15023345|gb|AAK78465.1|AE007563_5 TRNA-processing ribonuclease BN [Clostridium acetobutylicum ATCC
           824]
 gi|325507899|gb|ADZ19535.1| TRNA-processing ribonuclease BN [Clostridium acetobutylicum EA
           2018]
          Length = 283

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 55/281 (19%), Positives = 123/281 (43%), Gaps = 3/281 (1%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M      + + +   I+  +++   A++S ++ S + + FPF++F   L GF        
Sbjct: 1   MSAKLLRIKNYVSVFIKRLIDDGIIALSSQLAYSLIFAFFPFLIFLMTLVGFSSIKS--S 58

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            V++ +    P  +   + + + +V+      L ++S + + +   +G  A+   LN +Y
Sbjct: 59  DVLEAMRKVVPYQVYGLVKNIVKEVVDTKNGKLLSVSLITSIWSCVSGFNAVIRGLNNSY 118

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIW-N 179
           +  E RS+   +LIS  +     +T+     + V   +    + K F         +W  
Sbjct: 119 KDNERRSFLKVQLISIIFTFGLIITIFFAMLLIVFGDINEELIIKKFGINEFFGYGVWDL 178

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
            +     + +      ++ + PA K K   + PG + + + WV+ ++ FT+Y+  F  YS
Sbjct: 179 IKYGILTIGMIFSFAALYRYTPANKHKWKMVFPGAVISALGWVISSICFTYYVNNFGNYS 238

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            +Y  + +++  + +L+++    I G E+NA         K
Sbjct: 239 KVYGSIGAVIVLMTWLFIISFIIICGGEINAVYFEIKNPNK 279


>gi|78046524|ref|YP_362699.1| ribonuclease BN/unknown domain fusion protein [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|325929450|ref|ZP_08190578.1| tRNA-processing RNAse BN [Xanthomonas perforans 91-118]
 gi|123730411|sp|Q3BX14|Y968_XANC5 RecName: Full=UPF0761 membrane protein XCV0968
 gi|78034954|emb|CAJ22599.1| ribonuclease BN [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|325540225|gb|EGD11839.1| tRNA-processing RNAse BN [Xanthomonas perforans 91-118]
          Length = 425

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 41/266 (15%), Positives = 98/266 (36%), Gaps = 8/266 (3%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV-PTVIDVVFGAWP 71
                 F+++  +  A+ ++ + + ++ P  +    +     A       + D +F  + 
Sbjct: 25  RFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLSAFPAFNEWKDALTDFIFNNFV 84

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
              A+ + + + + L            +A        + ++  + N  +RV   R     
Sbjct: 85  PGAARSVQNYLNRSLED-LGKFTVAGMVALVASLLITLHSIEQTFNSIWRVAAARPKVTR 143

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
            LI +  + L ++       +   +     +       L             A M   F+
Sbjct: 144 FLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTEGQWLAEFAW------RLAPMAVEFV 197

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
            ++ ++  +P    ++   LPG +   I   +    F  Y+  F TY  +Y  L+++   
Sbjct: 198 CIVLIYRVVPQHVVRLRHALPGALLAVILMEIVKWGFGFYLGNFQTYQRIYGALSALPIL 257

Query: 252 LVFLYMLGVFFILGAELNASMIIYYW 277
           L+++Y+  V  +LGA L +SM  + +
Sbjct: 258 LLWIYLSWVSVLLGASLASSMSAFRY 283


>gi|332534549|ref|ZP_08410385.1| ribonuclease BN [Pseudoalteromonas haloplanktis ANT/505]
 gi|332036039|gb|EGI72517.1| ribonuclease BN [Pseudoalteromonas haloplanktis ANT/505]
          Length = 301

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 45/259 (17%), Positives = 95/259 (36%), Gaps = 8/259 (3%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVIDVVFGAWPEVI 74
               +++     A +++   LLS+ P I  G  +       +     +   +F  +    
Sbjct: 27  FNRCIDDQITVNAGYLAYVTLLSLVPLIAVGVAIFSAFPGFESTRMEIESFLFTNFVPTS 86

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
              I + I        + +  +     A  +   +  +  +LNR +R+ + R   I+  +
Sbjct: 87  TDVIREHISSFAGNANQ-MTAVGIGFLAAIALLLIRNVDATLNRIWRIKKKRPMMISFAV 145

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLI 194
            +  + L  V L     V   I   +++  +  P                      +G I
Sbjct: 146 YWMVLSLGPVLLGASIGVTSYIVSLVSFADQGIPGFSGF------LLKLLPYGISMVGFI 199

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++  +P  +    + +PG  F  + + +    F  YI  F +Y  +Y  +A+I    V+
Sbjct: 200 MLYTLVPNTRVSFRAAIPGAFFAALLFELTKKGFALYISHFPSYEVIYGAVATIPILFVW 259

Query: 255 LYMLGVFFILGAELNASMI 273
           +Y+  V  +LGAE  A + 
Sbjct: 260 VYLSWVVVLLGAEFTACIS 278


>gi|188992885|ref|YP_001904895.1| ribonuclease BN/unknown domain fusion protein [Xanthomonas
           campestris pv. campestris str. B100]
 gi|226737462|sp|B0RUB3|Y3490_XANCB RecName: Full=UPF0761 membrane protein xcc-b100_3490
 gi|167734645|emb|CAP52855.1| Ribonuclease BN,probable [Xanthomonas campestris pv. campestris]
          Length = 425

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 41/266 (15%), Positives = 98/266 (36%), Gaps = 8/266 (3%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV-PTVIDVVFGAWP 71
                 F+++  +  A+ ++ + + ++ P  +    +     A       + D +F  + 
Sbjct: 25  RFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLSAFPAFNEWKDALTDFIFNNFV 84

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
              A+ + + + + L            +A        + ++  + N  +RV   R     
Sbjct: 85  PGAARSVQNYLNRSLED-LGKFTVAGMVALVASLLITLHSIEQTFNSIWRVAAARPKVTR 143

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
            LI +  + L ++       +   +     +       L             A M   F+
Sbjct: 144 FLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTEGQWLAEFAW------RLAPMAVEFV 197

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
            ++ ++  +P    ++   LPG +   I   +    F  Y+  F TY  +Y  L+++   
Sbjct: 198 CIVLIYRVVPQHAVRLRHALPGALLAVILMEIVKWGFGFYLGNFQTYQRIYGALSALPIL 257

Query: 252 LVFLYMLGVFFILGAELNASMIIYYW 277
           L+++Y+  V  +LGA L +SM  + +
Sbjct: 258 LLWIYLSWVSVLLGASLASSMSAFRY 283


>gi|262370530|ref|ZP_06063855.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262314330|gb|EEY95372.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 416

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 41/280 (14%), Positives = 99/280 (35%), Gaps = 4/280 (1%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +  Y    F  +   +  F  +     A  ++ + L +V P +     +   + A +   
Sbjct: 9   LPFYEKTWFQFVLFVLRRFEADRCREQAGSLTYTTLFAVVPMLTVFLVIISSIKALEPAR 68

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
             +  +  +          D+ L      +  L  I  L     +   + ++    NR +
Sbjct: 69  QQLQQLIYSNFLPKTTIAFDKALNAFTDKSSNLTIIGILFLFVTTVMMLTSIEKVFNRIW 128

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R   I  +  +  + L  + L     +   +         F     N   ++   
Sbjct: 129 RVRETRGGIIGFMRYWTIISLGPILLGSAFVISSTMASLNVLSNNFAGYELNGAFVL--- 185

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
               +     +G   ++  +P     I S L   +F+ + + +   LF   +  F++Y  
Sbjct: 186 -WLISFCLTVLGFFILNWTIPNRSVPIKSALIAGLFSAVVFELLKNLFGFIMSNFTSYEV 244

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +Y   A+I   L+++++     ++G E++ ++  +   K+
Sbjct: 245 VYGAFAAIPIFLLWIFLSWNIVLIGVEISYALTAFTSHKE 284


>gi|161505480|ref|YP_001572592.1| ribonuclease BN [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|189039570|sp|A9MIA4|YIHY_SALAR RecName: Full=UPF0761 membrane protein yihY
 gi|160866827|gb|ABX23450.1| hypothetical protein SARI_03639 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 290

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 48/279 (17%), Positives = 97/279 (34%), Gaps = 10/279 (3%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-T 61
            +   V   +    +   E++   +A +++  +LLS+ P I     L         V   
Sbjct: 11  RHTRPVRAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSDVSIQ 70

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           +   +F  +       I   I Q +A   K +  + A      +   + A+  +LN  +R
Sbjct: 71  LRHFIFANFMPATGDVIQRYIEQFVANSNK-MTAVGACGLIVTALLLMYAIDSALNTIWR 129

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
               R    +  + +  + L  +       +   +               +L  +I N  
Sbjct: 130 SKRTRPKVYSFAVYWMILTLGPLLAGASLAISSYLLSLR--------WASDLNTVIDNVL 181

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
               +L  +I    ++  +P  +      + G     + +  G   F  YI  F +Y  +
Sbjct: 182 RVLPLLLSWISFWLLYSIVPTTRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLI 241

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           Y  LA I    V++Y      +LGAE+  ++  Y   K+
Sbjct: 242 YGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQ 280


>gi|239631810|ref|ZP_04674841.1| ribonuclease BN [Lactobacillus paracasei subsp. paracasei 8700:2]
 gi|239526275|gb|EEQ65276.1| ribonuclease BN [Lactobacillus paracasei subsp. paracasei 8700:2]
          Length = 308

 Score =  139 bits (349), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 66/269 (24%), Positives = 121/269 (44%), Gaps = 2/269 (0%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
            +  AI    E +    A+ ++   LLS+FP I+F AN   + G       +   +  A 
Sbjct: 15  FVKLAINRITESNIGQSAAALAYYTLLSLFPLILFVANALPYFGL--TYKGLAAYLTQAI 72

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           P  +   +   I  +L   + GL  I A+A  + +S GV  L++  N+ Y V   +++ I
Sbjct: 73  PSNVMNWLDPVIANLLDSSSGGLLGIGAVATLWAASLGVNGLKMGFNQIYGVESSQNFII 132

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            RL+S        + +  +  VF      L ++        + L      R   T+ ALF
Sbjct: 133 QRLLSMLMTFTLIIVMGAILIVFAFGRQFLEWLIPLLRLNDDWLRTFNTLRWPVTITALF 192

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           + ++F++ FLP  K ++ ++LPG  FT   W++ A  F+ Y+  F T    Y  + + + 
Sbjct: 193 VIIMFLNYFLPNVKIRMWTVLPGTAFTVAGWLLIAQAFSLYMKYFGTRYLSYGTIGTFIA 252

Query: 251 CLVFLYMLGVFFILGAELNASMIIYYWRK 279
            +++L    +  + GA +NA    Y+  +
Sbjct: 253 IMLWLNFSALVLLWGAVINALTAEYFIGR 281


>gi|124007383|ref|ZP_01692090.1| ribonuclease BN [Microscilla marina ATCC 23134]
 gi|123987216|gb|EAY26956.1| ribonuclease BN [Microscilla marina ATCC 23134]
          Length = 370

 Score =  139 bits (349), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 65/296 (21%), Positives = 124/296 (41%), Gaps = 25/296 (8%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFL-------- 53
           + +    + II     +  ++     A  I+ S  LS+FP I+F   L  F         
Sbjct: 28  KHHQVSWYRIIKTLWLNINDKPLHQQARAIAFSFTLSLFPAIIFLFTLIPFFVPYIVTYI 87

Query: 54  -------GAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSS 106
                          +  ++    P  I K   D I+ +L  P   L +   L A Y ++
Sbjct: 88  PDIVTTGQDIDMKQQIDALLLEFMPGEIYKYTHDTIVNILTQPRTNLLSFGVLLALYTAT 147

Query: 107 NGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKF 166
           NGV  +  + NR Y+  E R++   RL++ G  +L +  LVI+  V V    A+ +V ++
Sbjct: 148 NGVIEMMDTFNRNYKFAEKRNFLRKRLLAAGLAILFAFILVIVVIVLVVTEFAVEFVLEY 207

Query: 167 FPALGNLL----------LIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIF 216
                +             ++   +++    A  +G+  ++   PA K +      G I 
Sbjct: 208 LYEWTSWAMLHKDQVLGYYLLTGFKVFVLFSAFLLGIALIYNLAPARKKEWRFFSLGAIS 267

Query: 217 TWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASM 272
             I  ++    F+ Y+  F+ Y+ +Y  + +++  + +LY++   F+LG E+N SM
Sbjct: 268 ASILAMLSTTGFSFYLSNFANYNKLYGSIGTLIALMFWLYLIAWVFLLGFEINVSM 323


>gi|288940217|ref|YP_003442457.1| ribonuclease BN [Allochromatium vinosum DSM 180]
 gi|288895589|gb|ADC61425.1| ribonuclease BN [Allochromatium vinosum DSM 180]
          Length = 439

 Score =  139 bits (349), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 39/256 (15%), Positives = 99/256 (38%), Gaps = 2/256 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            +++       + +    A  +  + LLS+ P +    ++    G H  +  ++      
Sbjct: 35  RLVHAVARDLTQGNLTLYAMSLVYTTLLSLVPLLAVSFSVLKGFGVHNQIEPLLANALEP 94

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
             E   +     I  V  +    L  +      Y   + ++ +  S N  +RV E+R + 
Sbjct: 95  LGESGVEITQQLIGFVDRMQVGVLGALGVGMLFYTVVSLIQKIEQSFNHVWRVDEVRPFA 154

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
                    + +  V       V  ++      + +       +  ++   R+ A  L +
Sbjct: 155 QRFTQYLSVLTIGPVLFFSAVGVSASLG--GNPLLRSVLDYEPVSWLMELARLVAPYLMI 212

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
                F++ F+P  + +++S L G +   + W     LF H++   + Y+ +Y+ LA ++
Sbjct: 213 SATFAFIYRFVPNTQVRLVSALIGGLVAGLLWQSVGALFAHFMAGSTQYTAIYSSLAILI 272

Query: 250 TCLVFLYMLGVFFILG 265
             ++++Y+  +  ++G
Sbjct: 273 LLMIWIYLGWLILLVG 288


>gi|16767292|ref|NP_462907.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|167991551|ref|ZP_02572650.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|197261775|ref|ZP_03161849.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|32699646|sp|Q8ZKT5|YIHY_SALTY RecName: Full=UPF0761 membrane protein yihY
 gi|16422590|gb|AAL22866.1| tRNA processing exoribonuclease BN [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|197240030|gb|EDY22650.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|205330040|gb|EDZ16804.1| tRNA-processing ribonuclease BN [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|261249143|emb|CBG27004.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267996313|gb|ACY91198.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301160533|emb|CBW20063.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312915139|dbj|BAJ39113.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|321225312|gb|EFX50370.1| Ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|323132367|gb|ADX19797.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|332990855|gb|AEF09838.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 290

 Score =  139 bits (349), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 49/279 (17%), Positives = 98/279 (35%), Gaps = 10/279 (3%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-T 61
            +   V   +    +   E++   +A +++  +LLS+ P I     L         V   
Sbjct: 11  RHTRPVRAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSDVSIQ 70

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           +   +F  +       I   I Q +A   K +  + A      +   + A+  +LN  +R
Sbjct: 71  LRHFIFANFMPATGDVIQRYIEQFVANSNK-MTAVGACGLIVTALLLMYAIDSALNTIWR 129

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
               R    +  + +  + L  +   +   +   +               +L  +I N  
Sbjct: 130 SKRTRPKVYSFAVYWMILTLGPLLAGVSLAISSYLLSLR--------WASDLNTVIDNVL 181

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
               +L  +I    ++  +P  +      L G     + +  G   F  YI  F +Y  +
Sbjct: 182 HILPLLLSWISFWLLYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQLI 241

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           Y  LA I    V++Y      +LGAE+  ++  Y   K+
Sbjct: 242 YGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQ 280


>gi|111219991|ref|YP_710785.1| putative tRNA processing ribonuclease [Frankia alni ACN14a]
 gi|111147523|emb|CAJ59176.1| putative tRNA processing ribonuclease [Frankia alni ACN14a]
          Length = 379

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 47/273 (17%), Positives = 103/273 (37%), Gaps = 8/273 (2%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
                +               +AS ++  A+LS+FP  +    + G + + Q V   I  
Sbjct: 42  RGWLAVAKRVKSQLAILSIPLIASGVAFWAILSIFPAAIAVLTVYGLVASPQTVSNQIAD 101

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAA---YFSSNGVEALRISLNRAYRV 122
           +  +     +  + D +  +++    GL     L+ A   +  S+G + L  ++  A+  
Sbjct: 102 LSDSLSPSTSAVLRDWLNGIVSTNHSGLGLGLLLSLAGVLWAVSSGTQNLIKAVTVAFEQ 161

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E R     R ++    L   V     + + V    A   +     A G + +++   + 
Sbjct: 162 EETRGPVRLRGLAVAMSLGGVVV----AVLIVGGITAGGSLLSHHVADGTVRVVLTVVQW 217

Query: 183 YATMLALFIGLIFVHLFLP-AAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
               + +   +  ++ F P    +       G +   ++ +V +V F+ Y+  F  Y+  
Sbjct: 218 LVLAMIVMAAVATLYRFGPAHTPANWRWASVGAVVATVALIVASVAFSFYVRAFGHYNKT 277

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMII 274
           Y  L  ++  +++LY      ++GA LNA    
Sbjct: 278 YGALGGVVILMLWLYYAVTVVLIGALLNAEAAR 310


>gi|187935176|ref|YP_001887555.1| YihY family protein [Clostridium botulinum B str. Eklund 17B]
 gi|187723329|gb|ACD24550.1| YihY family protein [Clostridium botulinum B str. Eklund 17B]
          Length = 282

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 67/269 (24%), Positives = 130/269 (48%), Gaps = 2/269 (0%)

Query: 9   FDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFG 68
             ++   I     +D +A+AS ++   LLS FPFI+F   L GF         +++ +  
Sbjct: 12  LRLLLHLIVKIKNDDIFALASQLAYYLLLSFFPFIIFLITLVGFSNMDSI--QILNGIKA 69

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
             PE +    +  I++V      GL  IS L A + SS+G  A+   +N+AY   E RS+
Sbjct: 70  VVPEAVFDLTSSTIIEVFDKQYTGLLEISILLALWTSSSGFRAVIKGVNKAYDFKENRSF 129

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
               +IS   V+  ++T+++   + V   +   Y+ K  P    ++++    R    ++ 
Sbjct: 130 IKRLIISMISVIALALTIILALSMLVFGNVIENYIIKIIPFTKLVVILWNICRYVFVVII 189

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
           +      ++ F P+ + K   ++PG IF+ + W++ +  F+ YI  F  +S  Y  L ++
Sbjct: 190 MVFIFASIYRFTPSKRLKWRDVIPGSIFSTVGWIITSYGFSFYIDNFRNFSRFYGSLGAV 249

Query: 249 MTCLVFLYMLGVFFILGAELNASMIIYYW 277
              + +L+++ + FILG E+N  +  +  
Sbjct: 250 FILMTWLFLVSILFILGVEINCVLEQFKK 278


>gi|110635357|ref|YP_675565.1| putative ribonuclease BN [Mesorhizobium sp. BNC1]
 gi|110286341|gb|ABG64400.1| putative ribonuclease BN [Chelativorans sp. BNC1]
          Length = 283

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 116/278 (41%), Positives = 173/278 (62%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV 62
                +  I+ DA  HF  +DGWAMASH+++SA++++FPF++F A LA FLGA  F  T 
Sbjct: 2   RKLVALRRIVRDAFGHFNADDGWAMASHLAVSAIMALFPFLIFAAALASFLGADAFADTA 61

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
           + +VF  WP+ +A+P+  E+  VL V    + T   + AA+F+SNGVEALR+SLNRAYRV
Sbjct: 62  VHIVFDTWPKEVAEPLAREVRNVLGVRRGDVLTFGVVLAAFFASNGVEALRLSLNRAYRV 121

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E RS    RL S G+VL+A++    +S + V  P+A          +   +  I   R 
Sbjct: 122 EERRSMIFLRLQSLGFVLIATLGFTAISVLLVIAPVAANIAVSRIEWIEPYMGTITLWRY 181

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
              ++ L   L+ VH++LPA   K+  I+PG+IFT + W+ G+ +F  Y+  FS+Y+T Y
Sbjct: 182 IVAVVVLVFALVVVHIWLPAGSRKLTDIIPGIIFTLLGWIAGSSIFAAYLGRFSSYTTTY 241

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           AGLASIM  +VFLY++   FILG E+NA+++ Y   ++
Sbjct: 242 AGLASIMVAVVFLYIISAIFILGGEINAAIMRYREARR 279


>gi|331649730|ref|ZP_08350810.1| tRNA-processing ribonuclease BN (RNase BN) [Escherichia coli M605]
 gi|330908203|gb|EGH36722.1| ribonuclease BN [Escherichia coli AA86]
 gi|331041363|gb|EGI13513.1| tRNA-processing ribonuclease BN (RNase BN) [Escherichia coli M605]
          Length = 290

 Score =  138 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 46/280 (16%), Positives = 98/280 (35%), Gaps = 10/280 (3%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP- 60
           R     ++  +    +   E++   +A +++  +LLS+ P +     L         V  
Sbjct: 10  RHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSI 69

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            +   +F  +       I   I Q +A   K +  + A      +   + ++  +LN  +
Sbjct: 70  QLRHFIFANFLPATGDVIQRYIEQFVANSNK-MTAVGACGLIVTALLLMYSIDSALNTIW 128

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           R    R    +  + +  + L  +       +   +               +L  +I N 
Sbjct: 129 RSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLR--------WASDLNTVIDNV 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                +L  +I    ++  +P  +      + G     + +  G   F  YI  F +Y  
Sbjct: 181 LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +Y  LA I    V++Y      +LGAE+  ++  Y   K+
Sbjct: 241 IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQ 280


>gi|300931681|ref|ZP_07146988.1| YihY family protein [Escherichia coli MS 187-1]
 gi|300460520|gb|EFK24013.1| YihY family protein [Escherichia coli MS 187-1]
          Length = 290

 Score =  138 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 46/280 (16%), Positives = 98/280 (35%), Gaps = 10/280 (3%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP- 60
           R     ++  +    +   E++   +A +++  +LLS+ P +     L         V  
Sbjct: 10  RHRPRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSI 69

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            +   +F  +       I   I Q +A   K +  + A      +   + ++  +LN  +
Sbjct: 70  QLRHFIFANFLPATGDVIQRYIEQFVANSNK-MTAVGACGLIVTALLLMYSIDSALNTIW 128

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           R    R    +  + +  + L  +       +   +               +L  +I N 
Sbjct: 129 RSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLR--------WASDLNTVIDNV 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                +L  +I    ++  +P  +      + G     + +  G   F  YI  F +Y  
Sbjct: 181 LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +Y  LA I    V++Y      +LGAE+  ++  Y   K+
Sbjct: 241 IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQ 280


>gi|27364333|ref|NP_759861.1| hypothetical protein VV1_0885 [Vibrio vulnificus CMCP6]
 gi|320157725|ref|YP_004190104.1| ribonuclease BN [Vibrio vulnificus MO6-24/O]
 gi|32699637|sp|Q8DDS2|Y885_VIBVU RecName: Full=UPF0761 membrane protein VV1_0885
 gi|27360451|gb|AAO09388.1| Ribonuclease BN [Vibrio vulnificus CMCP6]
 gi|319933037|gb|ADV87901.1| ribonuclease BN [Vibrio vulnificus MO6-24/O]
          Length = 313

 Score =  138 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 36/270 (13%), Positives = 95/270 (35%), Gaps = 8/270 (2%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID-VVFGA 69
            +   I     +     A +++   LLS+ P +    ++       + V +V+   +   
Sbjct: 22  FVRYLIARMNHDRINVNAGYLAYITLLSIVPMLTVLLSILSKFSVFENVGSVLQSFIINN 81

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           +       +   + + +A     +  + A      +   +  +  +LN  +RV + R   
Sbjct: 82  FVPASGDAVHAALQEFIAN-TGKMTAVGAAFLFVAALMLISNIDKNLNYIWRVKKKRRAV 140

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
            +  + +  + L  + +         I                +  +      +   +  
Sbjct: 141 FSFSMYWMVLTLGPILVGASIAATSYITSL------RLLDSEAISTVYDQLLRWLPFILS 194

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
               + ++L +P  K +    + G +   + + +    F  YI  F +Y  +Y  LA+I 
Sbjct: 195 SSAFVGLYLLVPNKKVQFSHAVVGAMIAAVLFELSKKGFAAYITQFPSYQLIYGALAAIP 254

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRK 279
              V++Y+  +  ++GAE+ A++      +
Sbjct: 255 ILFVWVYLCWLIVLIGAEVTAALGEREHWR 284


>gi|332967833|gb|EGK06932.1| YihY family protein [Kingella kingae ATCC 23330]
          Length = 410

 Score =  138 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 41/264 (15%), Positives = 95/264 (35%), Gaps = 10/264 (3%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH-QFVPTVIDVVFG 68
             +   +  F E      A  ++ + LL++ P +     +            + +D V  
Sbjct: 19  RFLLFLVHRFGEAGISQTAGSLTFTTLLALIPLLTVMLVVITAFPMFGDVSASFMDFVHR 78

Query: 69  AWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSW 128
                 A  +   + +   + A  + TI  LA    S   +  +  + NR +RV + RS 
Sbjct: 79  TIVPSGASAVASYLDEFK-MQAGKMTTIGVLAMMVTSIMLIHTIDATFNRIWRVQKQRSM 137

Query: 129 YITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLA 188
            +   + +G + L  + + +      ++      V               + +    ++ 
Sbjct: 138 LVRLPVYWGLLTLGPIFVGVSLSASASLLHFGQAVEPN--------WFTSSLQSLGQIVL 189

Query: 189 LFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASI 248
             + L+  +  +P     +     G     + + +    F  YI  F++Y+ +Y   A+I
Sbjct: 190 NALILLLFYYGVPNCYVPLRDAAIGASVASVLFTLAKYGFGLYISNFNSYALIYGAFAAI 249

Query: 249 MTCLVFLYMLGVFFILGAELNASM 272
              L++L ++    + GA + AS+
Sbjct: 250 PIFLIWLNLVWTIILGGALIAASI 273


>gi|319949392|ref|ZP_08023458.1| ribonuclease BN [Dietzia cinnamea P4]
 gi|319436939|gb|EFV91993.1| ribonuclease BN [Dietzia cinnamea P4]
          Length = 341

 Score =  138 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 44/260 (16%), Positives = 101/260 (38%), Gaps = 3/260 (1%)

Query: 23  DGWAMASHISLSALLSVFPFIVFGANLAGFLGA-HQFVPTVIDVVFGAWPEVIAKPITDE 81
            G  +A  ++   +LS+FP ++   +L G  G   + V  V+D++    P  +  P+   
Sbjct: 1   RGPDLAGSLTYYGVLSLFPAVLVVVSLLGVFGQGSRTVDAVMDMLSDVAPPEVLDPVRGP 60

Query: 82  ILQVLAVPA-KGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVL 140
           +  ++  PA      +    A + +S  V AL  ++N  + + E R  +           
Sbjct: 61  VEALVTTPAAGTALIVGTAVALWSASRYVRALGRAMNAMFGIEEGRPPWRLLPAGLALTA 120

Query: 141 LASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFL 200
           L  V + +              V  +       L +    +  A ++A+ + L  ++ F 
Sbjct: 121 LLIVLVAVGGVALAFSGPVAETVGDWIGLGDTALAVWGVAKWPAAVIAVILALAILYRFA 180

Query: 201 PAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLG 259
           P     +   +  G         V     + ++  F  ++ +Y  LA ++  L++L+++ 
Sbjct: 181 PNISGRRFSWVSLGAAAALAIMGVATAGLSFFVSNFGNFNRVYGSLAGVIVFLLWLWLVN 240

Query: 260 VFFILGAELNASMIIYYWRK 279
           +  + G  L+A ++     +
Sbjct: 241 MAVVFGVRLDAEVLRVRQLR 260


>gi|161617147|ref|YP_001591112.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|189039571|sp|A9MZA1|YIHY_SALPB RecName: Full=UPF0761 membrane protein yihY
 gi|161366511|gb|ABX70279.1| hypothetical protein SPAB_04987 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 290

 Score =  138 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 49/279 (17%), Positives = 97/279 (34%), Gaps = 10/279 (3%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-T 61
            +   V   +    +   E++   +A +++  +LLS+ P I     L         V   
Sbjct: 11  RHTRPVRAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSDVSIQ 70

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           +   +F  +       I   I Q +A   K +  + A      +   + A+  +LN  +R
Sbjct: 71  LRHFIFANFMPATGDVIQRYIEQFVANSNK-MTAVGACGLIVTALLLMYAIDSALNTIWR 129

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
               R    +  + +  + L  +       +   +               +L  +I N  
Sbjct: 130 SKRTRPKVYSFAVYWMILTLGPLLAGASLAISSYLLSLR--------WASDLNTVIDNVL 181

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
               +L  +I    ++  +P  +      L G     + +  G   F  YI  F +Y  +
Sbjct: 182 RILPLLLSWISFWLLYSIVPTTRVPNRDALVGAFVAALLFESGKKGFALYITMFPSYQLI 241

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           Y  LA I    V++Y      +LGAE+  ++  Y   K+
Sbjct: 242 YGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQ 280


>gi|88810285|ref|ZP_01125542.1| Ribonuclease BN [Nitrococcus mobilis Nb-231]
 gi|88791915|gb|EAR23025.1| Ribonuclease BN [Nitrococcus mobilis Nb-231]
          Length = 466

 Score =  138 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 42/259 (16%), Positives = 94/259 (36%), Gaps = 2/259 (0%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
            V  + Y  +           A+ +  + LLS+ P +    ++    G H  +   ++  
Sbjct: 32  FVLRLGYAVLRDLSRGQLMLQATSLVYTTLLSLVPLLAVSFSVLKAFGVHNQIEPALNQF 91

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
                   A+     I  V  V    L ++      Y     ++ +  + N  + +   R
Sbjct: 92  LAPLGPKGAEITQRIIEFVENVQVGVLGSLGLALLLYTVVGLMQKIERAFNELWHIRHQR 151

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           +           +L+  V +     +     +  +   +   A+  L L I         
Sbjct: 152 APAQLFSDYLSVLLVGPVLIFTALGITA--AVFGSETVQQLSAVQPLGLAIELITRIVPF 209

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           L +     F++ F+P  + ++ S L G +   I W +   +F   I T S Y+ +Y+  A
Sbjct: 210 LLIIGAFTFIYAFVPNTRVQVSSALVGGMVAGILWQITGWIFAAVIATSSKYTAIYSAFA 269

Query: 247 SIMTCLVFLYMLGVFFILG 265
            ++  +++LY+  +  ++G
Sbjct: 270 GLILFMMWLYLSWLILLIG 288


>gi|94310076|ref|YP_583286.1| tRNA-processing RNAse BN [Cupriavidus metallidurans CH34]
 gi|93353928|gb|ABF08017.1| ribonuclease BN [Cupriavidus metallidurans CH34]
          Length = 447

 Score =  138 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 41/277 (14%), Positives = 96/277 (34%), Gaps = 8/277 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI- 63
              V  +   A+    E+    +++ ++ + +L+V P +     L       +     I 
Sbjct: 15  LQKVRALARYALRRAGEDRLPQVSASLTFTTVLAVVPVLTVAFALLAAFPVFRDFRGQIE 74

Query: 64  -DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
             +     P           +   +  A+GL  +        S   +  +  +LN  +RV
Sbjct: 75  MFLFQNLIPGGNISDSVSRYIGQFSRSARGLTALGLAGLMVTSVLTMLTVEDALNAIWRV 134

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
              R +    L+ +  + L  V +     V   +           P        +     
Sbjct: 135 RRRRPFAQRVLVFWAVLTLGPVLIGASLSVSSYLMSVSMGYVGNLPFG------VGFVIS 188

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
              +L   +   F+++ +P A  +    +   I   +++ V    F ++I    TY+ +Y
Sbjct: 189 LVPVLLSALAFAFLYMAVPNAYVEWRDAIVAGIVAAVAFEVAKRGFGYFITHIPTYTAVY 248

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
              A +   L+++Y+  +  +LGA + A++ +     
Sbjct: 249 GTFAVLPLFLLWMYVSWLVTLLGATIAANLPVIREGH 285


>gi|195940496|ref|ZP_03085878.1| ribonuclease BN [Escherichia coli O157:H7 str. EC4024]
          Length = 293

 Score =  138 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 45/276 (16%), Positives = 102/276 (36%), Gaps = 10/276 (3%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVID 64
             +   +        E++   +A +++  +LLS+ P +     L         V   +  
Sbjct: 14  RPLRAWLKLLWHRIDEDNMTTLAGNLAYVSLLSLVPLVAVIFALFSAFPMFADVSMQLRH 73

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
            VF  +       I + I Q +A  +K +  + A      +   + ++  +LN  +R  +
Sbjct: 74  FVFANFIPATGDVIQNYIEQFVANSSK-MTAVGACGLIVTALLLMYSIDSALNTIWRSKK 132

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
           +R    +  + +  + L  +       +   +               +L  +I N     
Sbjct: 133 VRPKVYSFAVYWMILTLGPLLAGASLAISSYLLSLC--------WATDLNSVIDNVLRIF 184

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
            ++  ++    ++  +P  +      + G +   + + +G   F  YI  F +Y  +Y  
Sbjct: 185 PLILSWLSFWLLYSVVPTTRVPNRDAVVGALVAALLFELGKKGFALYITMFPSYQLIYGV 244

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           LA I    V++Y      +LGAE+  ++ +Y   KK
Sbjct: 245 LAVIPILFVWVYWTWCIVLLGAEITVTLGVYRELKK 280


>gi|215489214|ref|YP_002331645.1| ribonuclease BN [Escherichia coli O127:H6 str. E2348/69]
 gi|312969373|ref|ZP_07783575.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|254789778|sp|B7UNK3|YIHY_ECO27 RecName: Full=UPF0761 membrane protein yihY
 gi|215267286|emb|CAS11735.1| predicted inner membrane protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312285920|gb|EFR13838.1| conserved hypothetical protein [Escherichia coli 2362-75]
          Length = 290

 Score =  138 bits (348), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 45/280 (16%), Positives = 98/280 (35%), Gaps = 10/280 (3%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP- 60
           +     ++  +    +   E++   +A +++  +LLS+ P +     L         V  
Sbjct: 10  KHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSI 69

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            +   +F  +       I   I Q +A   K +  + A      +   + ++  +LN  +
Sbjct: 70  QLRHFIFANFLPATGDVIQRYIEQFVANSNK-MTAVGACGLIVTALLLMYSIDSALNTIW 128

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           R    R    +  + +  + L  +       +   +               +L  +I N 
Sbjct: 129 RSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLR--------WASDLNTVIDNV 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                +L  +I    ++  +P  +      + G     + +  G   F  YI  F +Y  
Sbjct: 181 LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +Y  LA I    V++Y      +LGAE+  ++  Y   K+
Sbjct: 241 IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQ 280


>gi|326629522|gb|EGE35865.1| ribonuclease BN [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 290

 Score =  138 bits (348), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 49/279 (17%), Positives = 96/279 (34%), Gaps = 10/279 (3%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-T 61
            +   V   +    +   E++   +A +++  +LLS+ P I     L         V   
Sbjct: 11  RHTRPVRAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAAFPMFSDVSIQ 70

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           +   +F  +       I   I Q +A   K +  + A      +   + A+  +LN  +R
Sbjct: 71  LRHFIFANFMPATGDVIQRYIEQFVANSNK-MTAVGACGLIVTALLLMYAIDSALNTIWR 129

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
               R    +  + +  + L  +       +   +               +L  +I N  
Sbjct: 130 SKRTRPKVYSFAVYWMILTLGPLLAGASLAISSYLLSLR--------WASDLNTVIDNVL 181

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
               +L  +I    ++  +P  +      L G     +    G   F  YI  F +Y  +
Sbjct: 182 RILPLLLSWISFWLLYSIVPTTRVPNRDALVGAFVAALLXEAGKKGFALYITMFPSYQLI 241

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           Y  LA I    V++Y      +LGAE+  ++  Y   K+
Sbjct: 242 YGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQ 280


>gi|218782337|ref|YP_002433655.1| ribonuclease BN [Desulfatibacillum alkenivorans AK-01]
 gi|218763721|gb|ACL06187.1| ribonuclease BN [Desulfatibacillum alkenivorans AK-01]
          Length = 450

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 42/262 (16%), Positives = 98/262 (37%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVV 66
               +   A+  F+ ++ W  AS ++  +LL + P +     +A  +G    +  ++   
Sbjct: 37  RFLRVPALAVNDFLRDNCWMRASALTYYSLLGIVPLLAMIMGIARGMGFEARIEELLLHE 96

Query: 67  FGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
           FGA   V+ K +      +       +  +  L   +        + I+ N+ +   + R
Sbjct: 97  FGAQELVLTKVLEFAKAMLSNTRGGVVNGLWMLLLLWTVIRLFGNIEIAFNQIWGFAKGR 156

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S     +      LL  V  +  S   V I   +    ++        +I +    +   
Sbjct: 157 SQARKVIDYLAVALLMPVLWLPASSAQVLIASQIEAYTQWAFLQNVGDIIQFTLLFFLPF 216

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
             +++    +++F+P       S +   I    ++ +    +  + V  +  + +Y   A
Sbjct: 217 AMIWVLFSCLYIFMPNGSVSWTSGIVAGIVAGSAFQLFQRFYIEFQVGVARNNAIYGSFA 276

Query: 247 SIMTCLVFLYMLGVFFILGAEL 268
           ++   L++LYM  V  + GAE+
Sbjct: 277 ALPLFLIWLYMSWVIVLFGAEI 298


>gi|163789761|ref|ZP_02184198.1| ribonuclease BN, putative [Carnobacterium sp. AT7]
 gi|159874983|gb|EDP69050.1| ribonuclease BN, putative [Carnobacterium sp. AT7]
          Length = 329

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 54/279 (19%), Positives = 125/279 (44%), Gaps = 3/279 (1%)

Query: 2   REYFCIVFDIIYDAIE-HFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +  F   F  + + ++ ++   +  + A+ ++   LLS+FP ++  AN+      +    
Sbjct: 7   QASFKDKFKSLIEVVKPNWARAEVSSNAAELAYFTLLSLFPILLVIANIIPLFPINA--S 64

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            ++ ++  A P  I   +   +   L+  + G  +I  + + + +S    AL+  LN  Y
Sbjct: 65  DILPMLETAVPPDIYNVLAPVLESYLSSSSGGAISIGLITSLWSASKAFNALQNVLNDVY 124

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
            V +  ++ I RL+SF   L+    +  + F+FV     L +++ F     +L+L ++  
Sbjct: 125 GVEKRNNFIIVRLVSFLVQLVIVAIVGALIFIFVFGEQILLFIQDFIGIDLSLILQVFGY 184

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           +    ++ L + +  V+  +P  +  I   LPG IF  + W++ +  FT Y+      + 
Sbjct: 185 KWLVLLVVLILVITMVYFLVPNHRLHIKYALPGAIFATVGWLILSQAFTLYVKYAGGEAA 244

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             A     +  +++LY+  +  ++G  +N     +   +
Sbjct: 245 ASATFGVFIVLMLWLYLSAIILLIGGLINTIYFEFKTGR 283


>gi|24375881|ref|NP_719924.1| ribonuclease BN [Shewanella oneidensis MR-1]
 gi|32699638|sp|Q8E985|Y4401_SHEON RecName: Full=UPF0761 membrane protein SO_4401
 gi|24350851|gb|AAN57368.1|AE015873_11 ribonuclease BN [Shewanella oneidensis MR-1]
          Length = 295

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 49/276 (17%), Positives = 104/276 (37%), Gaps = 8/276 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +R     ++  +    +  VE+     A H++   LLS+ P +    ++       + + 
Sbjct: 10  IRVLLLGIWHFLLHLRQRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVFKGIR 69

Query: 61  -TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +   V+  +       +   I + +   +KG   +   A    +   + A+  SLN  
Sbjct: 70  GQIEAFVYENFLPAAGDTVQVYINEFVGNASKG-TAVGIAALVVVAIMLISAIDKSLNNI 128

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +R  E RS  +   + +  + L  V +         +     +       +  L      
Sbjct: 129 WRTKEKRSVVVAFSMYWMVITLGPVLVGASLVATSYVVSLKLFEGDALSGMMPL------ 182

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
                 +L      + +++ +P  K K    L G +   + + +G   F  Y+  F +Y 
Sbjct: 183 FIERLPLLFSVAAFLLLYMVVPNQKVKFWHALLGAVVAALLFELGKKGFAFYVTKFPSYE 242

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
            +Y  LA+I    V++Y+  +  +LGAE+ A+M  Y
Sbjct: 243 AIYGALATIPILFVWVYLSWMIVLLGAEITAAMPEY 278


>gi|289663480|ref|ZP_06485061.1| ribonuclease BN/unknown domain fusion protein [Xanthomonas
           campestris pv. vasculorum NCPPB702]
          Length = 425

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/266 (15%), Positives = 98/266 (36%), Gaps = 8/266 (3%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV-PTVIDVVFGAWP 71
                 F+++  +  A+ ++ + + ++ P  +    +     A       + D +F  + 
Sbjct: 25  RFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLSAFPAFNEWKDALTDFIFNNFV 84

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
              A+ + + + + L            +A        + ++  + N  +RV   R     
Sbjct: 85  PGAARSVQNYLNRSLED-LGKFTVAGMVALVASLLITLHSIEQTFNSIWRVAAARPKVTR 143

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
            LI +  + L ++       +   +     +       L             A M   F+
Sbjct: 144 FLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTEGQWLAEFAW------RLAPMAVEFV 197

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
            ++ ++  +P    ++   LPG +   I   +    F  Y+  F TY  +Y  L+++   
Sbjct: 198 CIVLIYRVVPQHVVRLRHALPGALLAVILMEIVKWGFGFYLGNFQTYQRIYGALSALPIL 257

Query: 252 LVFLYMLGVFFILGAELNASMIIYYW 277
           L+++Y+  V  +LGA L +SM  + +
Sbjct: 258 LLWIYLSWVSVLLGASLASSMAAFRY 283


>gi|24115176|ref|NP_709686.1| ribonuclease BN [Shigella flexneri 2a str. 301]
 gi|32699633|sp|Q83MJ2|YIHY_SHIFL RecName: Full=UPF0761 membrane protein yihY
 gi|24054456|gb|AAN45393.1| tRNA processing exoribonuclease BN [Shigella flexneri 2a str. 301]
          Length = 290

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 46/280 (16%), Positives = 98/280 (35%), Gaps = 10/280 (3%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP- 60
           R     ++  +    +   E++   +A +++  +LLS+ P +     L         V  
Sbjct: 10  RHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSI 69

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            +   +F  +       I   I Q +A   K +  + A      +   + ++  +LN  +
Sbjct: 70  QLRHFIFANFLPATGDVIQRYIEQFVANSNK-MTAVGACGLIVTALLLMYSIDSALNTIW 128

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           R    R    +  + +  + L  +       +   +               +L  +I N 
Sbjct: 129 RSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLPLR--------WASDLNTVIDNV 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                +L  +I    ++  +P  +      + G     + +  G   F  YI  F +Y  
Sbjct: 181 LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +Y  LA I    V++Y      +LGAE+  ++  Y   K+
Sbjct: 241 IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQ 280


>gi|288559246|sp|A9BMQ0|Y4966_DELAS RecName: Full=UPF0761 membrane protein Daci_4966
          Length = 417

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 51/260 (19%), Positives = 99/260 (38%), Gaps = 9/260 (3%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI--DVVFGAWPEVI 74
           E F E+     AS ++ + +L++ PF      L         V  V+   ++    PE I
Sbjct: 30  ERFREDRLGVTASSLTFTTVLALVPFFTVALALFTAFPIFSRVQIVLERWLIDSLIPETI 89

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
           A+ +   + Q  A  A  L           +   +  +  +LN  +RV ++R      LI
Sbjct: 90  ARQVLGYLTQF-ASKASQLGMAGFSILVITAVALILTIDRTLNNIWRVRQLRPLGQRVLI 148

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLI 194
            +  + L  + L +   +   +  A   +    P        +         LAL  G+ 
Sbjct: 149 YWAAITLGPLVLGLSLVLSSYVMSASRGLVNALPEG------LRFIFDSIEYLALAAGMA 202

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++ ++P    +      G +F      +       Y+ +  TYS +Y   A++   L++
Sbjct: 203 GLYHYVPNTAVRWRHAWVGGLFVATCMELAKKALGLYLASVPTYSVIYGTFATLPILLIW 262

Query: 255 LYMLGVFFILGAELNASMII 274
           +YM  +  +LGA + A + I
Sbjct: 263 IYMAWIIVLLGAVVTAYLPI 282


>gi|15804472|ref|NP_290512.1| ribonuclease BN [Escherichia coli O157:H7 EDL933]
 gi|15834063|ref|NP_312836.1| ribonuclease BN [Escherichia coli O157:H7 str. Sakai]
 gi|16131726|ref|NP_418322.1| predicted inner membrane protein [Escherichia coli str. K-12
           substr. MG1655]
 gi|26250648|ref|NP_756688.1| ribonuclease BN [Escherichia coli CFT073]
 gi|30064825|ref|NP_838996.1| ribonuclease BN [Shigella flexneri 2a str. 2457T]
 gi|82778941|ref|YP_405290.1| ribonuclease BN [Shigella dysenteriae Sd197]
 gi|89110142|ref|AP_003922.1| tRNA processing exoribonuclease BN [Escherichia coli str. K-12
           substr. W3110]
 gi|91213427|ref|YP_543413.1| ribonuclease BN [Escherichia coli UTI89]
 gi|110644224|ref|YP_671954.1| ribonuclease BN [Escherichia coli 536]
 gi|110807428|ref|YP_690948.1| ribonuclease BN [Shigella flexneri 5 str. 8401]
 gi|157154769|ref|YP_001465370.1| ribonuclease BN [Escherichia coli E24377A]
 gi|157163356|ref|YP_001460674.1| ribonuclease BN [Escherichia coli HS]
 gi|168748830|ref|ZP_02773852.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC4113]
 gi|168755559|ref|ZP_02780566.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC4401]
 gi|168761742|ref|ZP_02786749.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC4501]
 gi|168768176|ref|ZP_02793183.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC4486]
 gi|168775292|ref|ZP_02800299.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC4196]
 gi|168780792|ref|ZP_02805799.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC4076]
 gi|168799547|ref|ZP_02824554.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC508]
 gi|170022102|ref|YP_001727056.1| ribonuclease BN [Escherichia coli ATCC 8739]
 gi|170083358|ref|YP_001732678.1| inner membrane protein [Escherichia coli str. K-12 substr. DH10B]
 gi|170682650|ref|YP_001746216.1| ribonuclease BN [Escherichia coli SMS-3-5]
 gi|187732965|ref|YP_001882581.1| ribonuclease BN [Shigella boydii CDC 3083-94]
 gi|188494355|ref|ZP_03001625.1| YihY family protein [Escherichia coli 53638]
 gi|191166407|ref|ZP_03028238.1| tRNA-processing ribonuclease BN [Escherichia coli B7A]
 gi|191173894|ref|ZP_03035414.1| tRNA-processing ribonuclease BN [Escherichia coli F11]
 gi|193063932|ref|ZP_03045018.1| tRNA-processing ribonuclease BN [Escherichia coli E22]
 gi|193067967|ref|ZP_03048932.1| tRNA-processing ribonuclease BN [Escherichia coli E110019]
 gi|194433276|ref|ZP_03065557.1| tRNA-processing ribonuclease BN [Shigella dysenteriae 1012]
 gi|194438282|ref|ZP_03070373.1| tRNA-processing ribonuclease BN [Escherichia coli 101-1]
 gi|195937525|ref|ZP_03082907.1| ribonuclease BN [Escherichia coli O157:H7 str. EC4024]
 gi|208807855|ref|ZP_03250192.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC4206]
 gi|208812015|ref|ZP_03253344.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC4045]
 gi|208820357|ref|ZP_03260677.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC4042]
 gi|209398243|ref|YP_002273403.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC4115]
 gi|209921360|ref|YP_002295444.1| ribonuclease BN [Escherichia coli SE11]
 gi|217326271|ref|ZP_03442355.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           TW14588]
 gi|218556446|ref|YP_002389360.1| ribonuclease BN [Escherichia coli IAI1]
 gi|218692171|ref|YP_002400383.1| ribonuclease BN [Escherichia coli ED1a]
 gi|218697598|ref|YP_002405265.1| ribonuclease BN [Escherichia coli 55989]
 gi|218707513|ref|YP_002415032.1| ribonuclease BN [Escherichia coli UMN026]
 gi|227885379|ref|ZP_04003184.1| ribonuclease BN [Escherichia coli 83972]
 gi|237702915|ref|ZP_04533396.1| tRNA-processing ribonuclease BN [Escherichia sp. 3_2_53FAA]
 gi|238902953|ref|YP_002928749.1| putative inner membrane protein [Escherichia coli BW2952]
 gi|253775478|ref|YP_003038309.1| ribonuclease BN [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254039095|ref|ZP_04873145.1| tRNA-processing ribonuclease BN [Escherichia sp. 1_1_43]
 gi|254163837|ref|YP_003046945.1| ribonuclease BN [Escherichia coli B str. REL606]
 gi|254795880|ref|YP_003080717.1| ribonuclease BN [Escherichia coli O157:H7 str. TW14359]
 gi|256021525|ref|ZP_05435390.1| ribonuclease BN [Shigella sp. D9]
 gi|256026080|ref|ZP_05439945.1| ribonuclease BN [Escherichia sp. 4_1_40B]
 gi|260846346|ref|YP_003224124.1| putative inner membrane protein [Escherichia coli O103:H2 str.
           12009]
 gi|260857716|ref|YP_003231607.1| putative inner membrane protein [Escherichia coli O26:H11 str.
           11368]
 gi|260870602|ref|YP_003237004.1| putative inner membrane protein [Escherichia coli O111:H- str.
           11128]
 gi|291285297|ref|YP_003502115.1| tRNA-processing ribonuclease BN [Escherichia coli O55:H7 str.
           CB9615]
 gi|293407508|ref|ZP_06651427.1| rbn [Escherichia coli FVEC1412]
 gi|293413318|ref|ZP_06655979.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293417348|ref|ZP_06659972.1| rbn [Escherichia coli B185]
 gi|293470196|ref|ZP_06664607.1| rbn [Escherichia coli B088]
 gi|297520785|ref|ZP_06939171.1| ribonuclease BN [Escherichia coli OP50]
 gi|298383251|ref|ZP_06992844.1| rbn [Escherichia coli FVEC1302]
 gi|300819266|ref|ZP_07099466.1| YihY family protein [Escherichia coli MS 107-1]
 gi|300823708|ref|ZP_07103834.1| YihY family protein [Escherichia coli MS 119-7]
 gi|300896426|ref|ZP_07114958.1| YihY family protein [Escherichia coli MS 198-1]
 gi|300906204|ref|ZP_07123916.1| YihY family protein [Escherichia coli MS 84-1]
 gi|300919073|ref|ZP_07135615.1| YihY family protein [Escherichia coli MS 115-1]
 gi|300925924|ref|ZP_07141759.1| YihY family protein [Escherichia coli MS 182-1]
 gi|300938446|ref|ZP_07153189.1| YihY family protein [Escherichia coli MS 21-1]
 gi|300948144|ref|ZP_07162276.1| YihY family protein [Escherichia coli MS 116-1]
 gi|300957275|ref|ZP_07169503.1| YihY family protein [Escherichia coli MS 175-1]
 gi|300976515|ref|ZP_07173498.1| YihY family protein [Escherichia coli MS 45-1]
 gi|300985945|ref|ZP_07177651.1| YihY family protein [Escherichia coli MS 200-1]
 gi|301023861|ref|ZP_07187593.1| YihY family protein [Escherichia coli MS 69-1]
 gi|301046693|ref|ZP_07193819.1| YihY family protein [Escherichia coli MS 185-1]
 gi|301303357|ref|ZP_07209481.1| YihY family protein [Escherichia coli MS 124-1]
 gi|301328203|ref|ZP_07221331.1| YihY family protein [Escherichia coli MS 78-1]
 gi|301648465|ref|ZP_07248194.1| YihY family protein [Escherichia coli MS 146-1]
 gi|306813852|ref|ZP_07448028.1| ribonuclease BN [Escherichia coli NC101]
 gi|307140581|ref|ZP_07499937.1| ribonuclease BN [Escherichia coli H736]
 gi|307313992|ref|ZP_07593606.1| ribonuclease BN [Escherichia coli W]
 gi|309783810|ref|ZP_07678455.1| YihY family protein [Shigella dysenteriae 1617]
 gi|309796591|ref|ZP_07690997.1| YihY family protein [Escherichia coli MS 145-7]
 gi|312971829|ref|ZP_07786003.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|331644617|ref|ZP_08345736.1| tRNA-processing ribonuclease BN (RNase BN) [Escherichia coli H736]
 gi|331655572|ref|ZP_08356564.1| tRNA-processing ribonuclease BN (RNase BN) [Escherichia coli M718]
 gi|331660435|ref|ZP_08361369.1| tRNA-processing ribonuclease BN (RNase BN) [Escherichia coli TA206]
 gi|331665534|ref|ZP_08366432.1| tRNA-processing ribonuclease BN (RNase BN) [Escherichia coli TA143]
 gi|331670730|ref|ZP_08371566.1| tRNA-processing ribonuclease BN (RNase BN) [Escherichia coli TA271]
 gi|331675343|ref|ZP_08376093.1| tRNA-processing ribonuclease BN (RNase BN) [Escherichia coli TA280]
 gi|331679995|ref|ZP_08380657.1| tRNA-processing ribonuclease BN (RNase BN) [Escherichia coli H591]
 gi|331685622|ref|ZP_08386205.1| tRNA-processing ribonuclease BN (RNase BN) [Escherichia coli H299]
 gi|332282764|ref|ZP_08395177.1| tRNA-processing ribonuclease BN [Shigella sp. D9]
 gi|67471903|sp|P0A8K8|YIHY_ECOLI RecName: Full=UPF0761 membrane protein yihY
 gi|67471904|sp|P0A8K9|YIHY_ECOL6 RecName: Full=UPF0761 membrane protein yihY
 gi|67471905|sp|P0A8L0|YIHY_ECO57 RecName: Full=UPF0761 membrane protein yihY
 gi|122421687|sp|Q1R432|YIHY_ECOUT RecName: Full=UPF0761 membrane protein yihY
 gi|123047804|sp|Q0SZ72|YIHY_SHIF8 RecName: Full=UPF0761 membrane protein yihY
 gi|123343373|sp|Q0TAH6|YIHY_ECOL5 RecName: Full=UPF0761 membrane protein yihY
 gi|123561253|sp|Q32A56|YIHY_SHIDS RecName: Full=UPF0761 membrane protein yihY
 gi|166918687|sp|A7ZU91|YIHY_ECO24 RecName: Full=UPF0761 membrane protein yihY
 gi|166918688|sp|A8A6Y7|YIHY_ECOHS RecName: Full=UPF0761 membrane protein yihY
 gi|189039569|sp|B1IVJ2|YIHY_ECOLC RecName: Full=UPF0761 membrane protein yihY
 gi|226737440|sp|B5YZ23|YIHY_ECO5E RecName: Full=UPF0761 membrane protein yihY
 gi|226737442|sp|B7M685|YIHY_ECO8A RecName: Full=UPF0761 membrane protein yihY
 gi|226737443|sp|B1XB54|YIHY_ECODH RecName: Full=UPF0761 membrane protein yihY
 gi|226737444|sp|B7NFI5|YIHY_ECOLU RecName: Full=UPF0761 membrane protein yihY
 gi|226737445|sp|B6I4M3|YIHY_ECOSE RecName: Full=UPF0761 membrane protein yihY
 gi|226737446|sp|B1LMS0|YIHY_ECOSM RecName: Full=UPF0761 membrane protein yihY
 gi|226737459|sp|B2TVN0|YIHY_SHIB3 RecName: Full=UPF0761 membrane protein yihY
 gi|254789779|sp|B7L9D9|YIHY_ECO55 RecName: Full=UPF0761 membrane protein yihY
 gi|254789780|sp|B7N2M7|YIHY_ECO81 RecName: Full=UPF0761 membrane protein yihY
 gi|259552135|sp|C5A054|YIHY_ECOBW RecName: Full=UPF0761 membrane protein yihY
 gi|12518772|gb|AAG59076.1|AE005619_9 tRNA processing exoribonuclease BN [Escherichia coli O157:H7 str.
           EDL933]
 gi|26111079|gb|AAN83262.1|AE016770_62 Ribonuclease BN [Escherichia coli CFT073]
 gi|304990|gb|AAB03019.1| ORF_o290 [Escherichia coli str. K-12 substr. MG1655]
 gi|1790319|gb|AAD13448.1| predicted inner membrane protein [Escherichia coli str. K-12
           substr. MG1655]
 gi|13364285|dbj|BAB38232.1| tRNA processing exoribonuclease BN [Escherichia coli O157:H7 str.
           Sakai]
 gi|30043085|gb|AAP18807.1| tRNA processing exoribonuclease BN [Shigella flexneri 2a str.
           2457T]
 gi|81243089|gb|ABB63799.1| tRNA processing exoribonuclease BN [Shigella dysenteriae Sd197]
 gi|85676173|dbj|BAE77423.1| tRNA processing exoribonuclease BN [Escherichia coli str. K12
           substr. W3110]
 gi|91075001|gb|ABE09882.1| tRNA processing exoribonuclease BN [Escherichia coli UTI89]
 gi|110345816|gb|ABG72053.1| ribonuclease BN [Escherichia coli 536]
 gi|110616976|gb|ABF05643.1| tRNA processing exoribonuclease BN [Shigella flexneri 5 str. 8401]
 gi|157069036|gb|ABV08291.1| tRNA-processing ribonuclease BN [Escherichia coli HS]
 gi|157076799|gb|ABV16507.1| tRNA-processing ribonuclease BN [Escherichia coli E24377A]
 gi|169757030|gb|ACA79729.1| ribonuclease BN [Escherichia coli ATCC 8739]
 gi|169891193|gb|ACB04900.1| predicted inner membrane protein [Escherichia coli str. K-12
           substr. DH10B]
 gi|170520368|gb|ACB18546.1| tRNA-processing ribonuclease BN [Escherichia coli SMS-3-5]
 gi|187429957|gb|ACD09231.1| tRNA-processing ribonuclease BN [Shigella boydii CDC 3083-94]
 gi|187769224|gb|EDU33068.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC4196]
 gi|188016749|gb|EDU54871.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC4113]
 gi|188489554|gb|EDU64657.1| YihY family protein [Escherichia coli 53638]
 gi|189001480|gb|EDU70466.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC4076]
 gi|189357179|gb|EDU75598.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC4401]
 gi|189362765|gb|EDU81184.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC4486]
 gi|189367868|gb|EDU86284.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC4501]
 gi|189378076|gb|EDU96492.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC508]
 gi|190903507|gb|EDV63225.1| tRNA-processing ribonuclease BN [Escherichia coli B7A]
 gi|190905852|gb|EDV65471.1| tRNA-processing ribonuclease BN [Escherichia coli F11]
 gi|192929397|gb|EDV83005.1| tRNA-processing ribonuclease BN [Escherichia coli E22]
 gi|192958587|gb|EDV89025.1| tRNA-processing ribonuclease BN [Escherichia coli E110019]
 gi|194418560|gb|EDX34648.1| tRNA-processing ribonuclease BN [Shigella dysenteriae 1012]
 gi|194422719|gb|EDX38715.1| tRNA-processing ribonuclease BN [Escherichia coli 101-1]
 gi|208727656|gb|EDZ77257.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC4206]
 gi|208733292|gb|EDZ81979.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC4045]
 gi|208740480|gb|EDZ88162.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC4042]
 gi|209159643|gb|ACI37076.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           EC4115]
 gi|209752628|gb|ACI74621.1| D-Tyr-tRNATyr deacylase [Escherichia coli]
 gi|209752630|gb|ACI74622.1| D-Tyr-tRNATyr deacylase [Escherichia coli]
 gi|209752632|gb|ACI74623.1| D-Tyr-tRNATyr deacylase [Escherichia coli]
 gi|209752634|gb|ACI74624.1| D-Tyr-tRNATyr deacylase [Escherichia coli]
 gi|209752636|gb|ACI74625.1| D-Tyr-tRNATyr deacylase [Escherichia coli]
 gi|209914619|dbj|BAG79693.1| tRNA processing exoribonuclease BN [Escherichia coli SE11]
 gi|217322492|gb|EEC30916.1| tRNA-processing ribonuclease BN [Escherichia coli O157:H7 str.
           TW14588]
 gi|218354330|emb|CAV01054.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli 55989]
 gi|218363215|emb|CAR00857.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli IAI1]
 gi|218429735|emb|CAR10696.2| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli ED1a]
 gi|218434610|emb|CAR15541.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli UMN026]
 gi|222035599|emb|CAP78344.1| tRNA-processing ribonuclease BN [Escherichia coli LF82]
 gi|226838531|gb|EEH70560.1| tRNA-processing ribonuclease BN [Escherichia sp. 1_1_43]
 gi|226902852|gb|EEH89111.1| tRNA-processing ribonuclease BN [Escherichia sp. 3_2_53FAA]
 gi|227837637|gb|EEJ48103.1| ribonuclease BN [Escherichia coli 83972]
 gi|238862583|gb|ACR64581.1| predicted inner membrane protein [Escherichia coli BW2952]
 gi|242379423|emb|CAQ34237.1| predicted inner membrane protein [Escherichia coli BL21(DE3)]
 gi|253326522|gb|ACT31124.1| ribonuclease BN [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975738|gb|ACT41409.1| ribonuclease BN [Escherichia coli B str. REL606]
 gi|253979894|gb|ACT45564.1| ribonuclease BN [Escherichia coli BL21(DE3)]
 gi|254595280|gb|ACT74641.1| predicted inner membrane protein [Escherichia coli O157:H7 str.
           TW14359]
 gi|257756365|dbj|BAI27867.1| predicted inner membrane protein [Escherichia coli O26:H11 str.
           11368]
 gi|257761493|dbj|BAI32990.1| predicted inner membrane protein [Escherichia coli O103:H2 str.
           12009]
 gi|257766958|dbj|BAI38453.1| predicted inner membrane protein [Escherichia coli O111:H- str.
           11128]
 gi|260451278|gb|ACX41700.1| ribonuclease BN [Escherichia coli DH1]
 gi|281603274|gb|ADA76258.1| tRNA-processing ribonuclease BN [Shigella flexneri 2002017]
 gi|290765170|gb|ADD59131.1| tRNA-processing ribonuclease BN [Escherichia coli O55:H7 str.
           CB9615]
 gi|291321406|gb|EFE60845.1| rbn [Escherichia coli B088]
 gi|291425425|gb|EFE98464.1| rbn [Escherichia coli FVEC1412]
 gi|291430868|gb|EFF03864.1| rbn [Escherichia coli B185]
 gi|291468066|gb|EFF10564.1| conserved hypothetical protein [Escherichia coli B354]
 gi|294491225|gb|ADE89981.1| tRNA-processing ribonuclease BN [Escherichia coli IHE3034]
 gi|298276285|gb|EFI17805.1| rbn [Escherichia coli FVEC1302]
 gi|300301332|gb|EFJ57717.1| YihY family protein [Escherichia coli MS 185-1]
 gi|300306481|gb|EFJ61001.1| YihY family protein [Escherichia coli MS 200-1]
 gi|300315964|gb|EFJ65748.1| YihY family protein [Escherichia coli MS 175-1]
 gi|300359699|gb|EFJ75569.1| YihY family protein [Escherichia coli MS 198-1]
 gi|300396868|gb|EFJ80406.1| YihY family protein [Escherichia coli MS 69-1]
 gi|300402006|gb|EFJ85544.1| YihY family protein [Escherichia coli MS 84-1]
 gi|300410087|gb|EFJ93625.1| YihY family protein [Escherichia coli MS 45-1]
 gi|300413812|gb|EFJ97122.1| YihY family protein [Escherichia coli MS 115-1]
 gi|300418028|gb|EFK01339.1| YihY family protein [Escherichia coli MS 182-1]
 gi|300452331|gb|EFK15951.1| YihY family protein [Escherichia coli MS 116-1]
 gi|300456599|gb|EFK20092.1| YihY family protein [Escherichia coli MS 21-1]
 gi|300523770|gb|EFK44839.1| YihY family protein [Escherichia coli MS 119-7]
 gi|300528152|gb|EFK49214.1| YihY family protein [Escherichia coli MS 107-1]
 gi|300841311|gb|EFK69071.1| YihY family protein [Escherichia coli MS 124-1]
 gi|300845340|gb|EFK73100.1| YihY family protein [Escherichia coli MS 78-1]
 gi|301073461|gb|EFK88267.1| YihY family protein [Escherichia coli MS 146-1]
 gi|305852850|gb|EFM53297.1| ribonuclease BN [Escherichia coli NC101]
 gi|306906309|gb|EFN36825.1| ribonuclease BN [Escherichia coli W]
 gi|307556027|gb|ADN48802.1| tRNA processing ribonuclease BN [Escherichia coli ABU 83972]
 gi|307628959|gb|ADN73263.1| ribonuclease BN [Escherichia coli UM146]
 gi|308119747|gb|EFO57009.1| YihY family protein [Escherichia coli MS 145-7]
 gi|308928181|gb|EFP73643.1| YihY family protein [Shigella dysenteriae 1617]
 gi|309704312|emb|CBJ03661.1| tRNA-processing ribonuclease BN [Escherichia coli ETEC H10407]
 gi|310334206|gb|EFQ00411.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|312948458|gb|ADR29285.1| ribonuclease BN [Escherichia coli O83:H1 str. NRG 857C]
 gi|313647073|gb|EFS11528.1| hypothetical protein SF2457T_4439 [Shigella flexneri 2a str. 2457T]
 gi|315138454|dbj|BAJ45613.1| tRNA-processing ribonuclease BN [Escherichia coli DH1]
 gi|315254252|gb|EFU34220.1| YihY family protein [Escherichia coli MS 85-1]
 gi|315289589|gb|EFU48982.1| YihY family protein [Escherichia coli MS 110-3]
 gi|315292759|gb|EFU52111.1| YihY family protein [Escherichia coli MS 153-1]
 gi|315300238|gb|EFU59475.1| YihY family protein [Escherichia coli MS 16-3]
 gi|315618746|gb|EFU99330.1| tRNA-processing ribonuclease BN [Escherichia coli 3431]
 gi|320176398|gb|EFW51453.1| Ribonuclease BN [Shigella dysenteriae CDC 74-1112]
 gi|320182310|gb|EFW57211.1| Ribonuclease BN [Shigella boydii ATCC 9905]
 gi|320191022|gb|EFW65672.1| Ribonuclease BN [Escherichia coli O157:H7 str. EC1212]
 gi|320196892|gb|EFW71514.1| Ribonuclease BN [Escherichia coli WV_060327]
 gi|320198915|gb|EFW73513.1| Ribonuclease BN [Escherichia coli EC4100B]
 gi|320639225|gb|EFX08852.1| hypothetical protein ECO5101_06694 [Escherichia coli O157:H7 str.
           G5101]
 gi|320644613|gb|EFX13667.1| hypothetical protein ECO9389_05543 [Escherichia coli O157:H- str.
           493-89]
 gi|320649937|gb|EFX18445.1| hypothetical protein ECO2687_16032 [Escherichia coli O157:H- str. H
           2687]
 gi|320655243|gb|EFX23189.1| hypothetical protein ECO7815_15024 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320660870|gb|EFX28316.1| hypothetical protein ECO5905_07501 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320666030|gb|EFX33049.1| hypothetical protein ECOSU61_21657 [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323155113|gb|EFZ41301.1| YihY family protein [Escherichia coli EPECa14]
 gi|323161218|gb|EFZ47135.1| YihY family protein [Escherichia coli E128010]
 gi|323174380|gb|EFZ60006.1| YihY family protein [Escherichia coli LT-68]
 gi|323177896|gb|EFZ63480.1| tRNA-processing ribonuclease BN [Escherichia coli 1180]
 gi|323182405|gb|EFZ67812.1| tRNA-processing ribonuclease BN [Escherichia coli 1357]
 gi|323189693|gb|EFZ74972.1| tRNA-processing ribonuclease BN [Escherichia coli RN587/1]
 gi|323380763|gb|ADX53031.1| ribonuclease BN [Escherichia coli KO11]
 gi|323934374|gb|EGB30787.1| YihY family protein [Escherichia coli E1520]
 gi|323939056|gb|EGB35273.1| YihY family protein [Escherichia coli E482]
 gi|323943715|gb|EGB39813.1| YihY family protein [Escherichia coli H120]
 gi|323954343|gb|EGB50128.1| YihY family protein [Escherichia coli H263]
 gi|323959347|gb|EGB55008.1| YihY family protein [Escherichia coli H489]
 gi|323964234|gb|EGB59717.1| YihY family protein [Escherichia coli M863]
 gi|323969752|gb|EGB65035.1| YihY family protein [Escherichia coli TA007]
 gi|323974289|gb|EGB69418.1| YihY family protein [Escherichia coli TW10509]
 gi|324006834|gb|EGB76053.1| YihY family protein [Escherichia coli MS 57-2]
 gi|324012555|gb|EGB81774.1| YihY family protein [Escherichia coli MS 60-1]
 gi|324020468|gb|EGB89687.1| YihY family protein [Escherichia coli MS 117-3]
 gi|324115620|gb|EGC09558.1| YihY family protein [Escherichia coli E1167]
 gi|326338109|gb|EGD61939.1| Ribonuclease BN [Escherichia coli O157:H7 str. 1044]
 gi|326342596|gb|EGD66369.1| Ribonuclease BN [Escherichia coli O157:H7 str. 1125]
 gi|327250516|gb|EGE62224.1| tRNA-processing ribonuclease BN [Escherichia coli STEC_7v]
 gi|331036079|gb|EGI08315.1| tRNA-processing ribonuclease BN (RNase BN) [Escherichia coli H736]
 gi|331046673|gb|EGI18758.1| tRNA-processing ribonuclease BN (RNase BN) [Escherichia coli M718]
 gi|331052384|gb|EGI24421.1| tRNA-processing ribonuclease BN (RNase BN) [Escherichia coli TA206]
 gi|331057219|gb|EGI29209.1| tRNA-processing ribonuclease BN (RNase BN) [Escherichia coli TA143]
 gi|331061985|gb|EGI33908.1| tRNA-processing ribonuclease BN (RNase BN) [Escherichia coli TA271]
 gi|331067403|gb|EGI38808.1| tRNA-processing ribonuclease BN (RNase BN) [Escherichia coli TA280]
 gi|331072321|gb|EGI43654.1| tRNA-processing ribonuclease BN (RNase BN) [Escherichia coli H591]
 gi|331077093|gb|EGI48308.1| tRNA-processing ribonuclease BN (RNase BN) [Escherichia coli H299]
 gi|332084115|gb|EGI89320.1| tRNA-processing ribonuclease BN [Shigella boydii 5216-82]
 gi|332085137|gb|EGI90315.1| tRNA-processing ribonuclease BN [Shigella dysenteriae 155-74]
 gi|332105116|gb|EGJ08462.1| tRNA-processing ribonuclease BN [Shigella sp. D9]
 gi|332345878|gb|AEE59212.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gi|332751472|gb|EGJ81873.1| tRNA-processing ribonuclease BN [Shigella flexneri K-671]
 gi|332751634|gb|EGJ82033.1| tRNA-processing ribonuclease BN [Shigella flexneri 4343-70]
 gi|332752525|gb|EGJ82911.1| tRNA-processing ribonuclease BN [Shigella flexneri 2747-71]
 gi|332764587|gb|EGJ94819.1| tRNA-processing ribonuclease BN [Shigella flexneri 2930-71]
 gi|332997673|gb|EGK17285.1| tRNA-processing ribonuclease BN [Shigella flexneri VA-6]
 gi|332998478|gb|EGK18076.1| tRNA-processing ribonuclease BN [Shigella flexneri K-272]
 gi|332998557|gb|EGK18154.1| tRNA-processing ribonuclease BN [Shigella flexneri K-218]
 gi|333013897|gb|EGK33259.1| tRNA-processing ribonuclease BN [Shigella flexneri K-304]
 gi|333013974|gb|EGK33335.1| tRNA-processing ribonuclease BN [Shigella flexneri K-227]
          Length = 290

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 46/280 (16%), Positives = 98/280 (35%), Gaps = 10/280 (3%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP- 60
           R     ++  +    +   E++   +A +++  +LLS+ P +     L         V  
Sbjct: 10  RHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSI 69

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            +   +F  +       I   I Q +A   K +  + A      +   + ++  +LN  +
Sbjct: 70  QLRHFIFANFLPATGDVIQRYIEQFVANSNK-MTAVGACGLIVTALLLMYSIDSALNTIW 128

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           R    R    +  + +  + L  +       +   +               +L  +I N 
Sbjct: 129 RSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLR--------WASDLNTVIDNV 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                +L  +I    ++  +P  +      + G     + +  G   F  YI  F +Y  
Sbjct: 181 LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +Y  LA I    V++Y      +LGAE+  ++  Y   K+
Sbjct: 241 IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQ 280


>gi|73540945|ref|YP_295465.1| tRNA-processing RNAse BN [Ralstonia eutropha JMP134]
 gi|72118358|gb|AAZ60621.1| tRNA-processing RNAse BN [Ralstonia eutropha JMP134]
          Length = 444

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/276 (14%), Positives = 95/276 (34%), Gaps = 7/276 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAH-QFVPTVI 63
              +  +   A+    E     +A+ ++ +  LSV P +     L        +F   + 
Sbjct: 15  LQKLRALSRYALRRAGEGRLPQVAASLTFTTFLSVVPVLTVAFALLAAFPVFREFRSDIE 74

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +F               L   +  A+GL  +        S   +  +  +LN  +RV 
Sbjct: 75  TFLFQNLIPGNVSESISRYLGQFSKSARGLTAMGLGGLMLTSVLTMLTVEDALNGIWRVK 134

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R +    L+ +  +    V +     V   +    A      P        +      
Sbjct: 135 QRRPFAQRVLMFWAVLTFGPVLIGASLSVSSYLISVSAGYVGNMPIG------LGLLVSA 188

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
             ++   +   F++  +P A  +    +   +   I++      F ++I    TY+ +Y 
Sbjct: 189 TPIVLSALAFAFLYTAVPNAYVEWRDAIAAGLVAAIAFEFAKRGFGYFITHIPTYTAVYG 248

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
             A++   L+++Y+  +  +LGA + A++ +     
Sbjct: 249 TFAALPIFLLWIYLSWLVTLLGATIAANLPVVRQGH 284


>gi|325922977|ref|ZP_08184686.1| tRNA-processing RNAse BN [Xanthomonas gardneri ATCC 19865]
 gi|325546536|gb|EGD17681.1| tRNA-processing RNAse BN [Xanthomonas gardneri ATCC 19865]
          Length = 425

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/266 (15%), Positives = 98/266 (36%), Gaps = 8/266 (3%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV-PTVIDVVFGAWP 71
                 F+++  +  A+ ++ + + ++ P  +    +     A       + D +F  + 
Sbjct: 25  RFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLSAFPAFNEWKDALTDFIFNNFV 84

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
              A+ + + + + L            +A        + ++  + N  +RV   R     
Sbjct: 85  PGAARSVQNYLNRSLED-LGKFTVAGMVALVASLLITLHSIEQTFNSIWRVAAARPKVTR 143

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
            LI +  + L ++       +   +     +       L             A M   F+
Sbjct: 144 FLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTEGQWLAEFAW------RLAPMAVEFV 197

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
            ++ ++  +P    ++   LPG +   I   +    F  Y+  F TY  +Y  L+++   
Sbjct: 198 CIVLIYRVVPQHGVRLRHALPGALLAVILMEIVKWGFGFYLGNFQTYQRIYGALSALPIL 257

Query: 252 LVFLYMLGVFFILGAELNASMIIYYW 277
           L+++Y+  V  +LGA L +SM  + +
Sbjct: 258 LLWIYLSWVSVLLGASLASSMAAFRY 283


>gi|207724035|ref|YP_002254433.1| ribonuclease bn protein [Ralstonia solanacearum MolK2]
 gi|206589243|emb|CAQ36205.1| ribonuclease bn protein [Ralstonia solanacearum MolK2]
          Length = 436

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 48/273 (17%), Positives = 101/273 (36%), Gaps = 9/273 (3%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI--D 64
            +  ++  A+    E+    +A  ++ + +LS+ P +     L       Q     I   
Sbjct: 15  KLRALLRYALRRAGEDSLPQVAGSLTFTTVLSLVPVLTVAFALFTAFPMFQSFRAAIESY 74

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
           +     P  I++PI   + Q  +  AKGL     +     S   +  +  +LN  +RV +
Sbjct: 75  LFSNLVPGNISRPILTYLNQF-SHNAKGLTAAGLVGLVVTSVMTMLTIENALNAIWRVHQ 133

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R      L+ +  V    V +     V   +    A      P        +       
Sbjct: 134 RRPLTQRVLVFWALVSFGPVLIGASLSVSSYLVSISAGYVAKLPYG------LGVVVGMV 187

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
            +L   I    +++F+P             +   +++ +    F +Y+  F TY+ +Y  
Sbjct: 188 PILLSAIAFAMLYVFVPNTLVAWRDAFLAGLVAAVAFEIAKRGFGYYVARFPTYTAVYGT 247

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
            A++   L+++Y+  +  +LGA + A++ I   
Sbjct: 248 FAALPIFLLWIYVSWLVTLLGATIAATLPIVRQ 280


>gi|257893552|ref|ZP_05673205.1| ribonuclease BN [Enterococcus faecium 1,231,408]
 gi|314940015|ref|ZP_07847208.1| YihY family protein [Enterococcus faecium TX0133a04]
 gi|314941893|ref|ZP_07848757.1| YihY family protein [Enterococcus faecium TX0133C]
 gi|314952420|ref|ZP_07855426.1| YihY family protein [Enterococcus faecium TX0133A]
 gi|314993211|ref|ZP_07858591.1| YihY family protein [Enterococcus faecium TX0133B]
 gi|314997801|ref|ZP_07862713.1| YihY family protein [Enterococcus faecium TX0133a01]
 gi|257829931|gb|EEV56538.1| ribonuclease BN [Enterococcus faecium 1,231,408]
 gi|313588173|gb|EFR67018.1| YihY family protein [Enterococcus faecium TX0133a01]
 gi|313592292|gb|EFR71137.1| YihY family protein [Enterococcus faecium TX0133B]
 gi|313595463|gb|EFR74308.1| YihY family protein [Enterococcus faecium TX0133A]
 gi|313599318|gb|EFR78163.1| YihY family protein [Enterococcus faecium TX0133C]
 gi|313640748|gb|EFS05328.1| YihY family protein [Enterococcus faecium TX0133a04]
          Length = 326

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 68/271 (25%), Positives = 132/271 (48%), Gaps = 2/271 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
             I    +   + +    +  ++   LLS+FP I+   N+  FL   Q   TV+  +   
Sbjct: 15  RFIETTQKRITDSEMSTTSVVVAYYLLLSLFPLIIAFGNILPFLHIDQ--ETVLTYLREV 72

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            PE + + I   I  +L   + GL ++SALAA + +S  + AL+I++N+AY V   +++ 
Sbjct: 73  IPETVYQFIGPAIKDLLTQSSGGLLSVSALAALWSASQSINALQIAMNKAYGVENRKNFL 132

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           I R  S   ++L  + +  ++ V     L L  ++       N +      +   T++AL
Sbjct: 133 IVRFFSLIVIVLFMIAISGVTIVLGLGQLILDAIQPIVQIPVNFIDQFQTLKWPITLVAL 192

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           F+ +  ++L +P A+ K+ +I+PG IF  + W++ + +F+ Y   F+T  + Y  + S +
Sbjct: 193 FVIMFLIYLIVPNAQLKLKTIIPGTIFATVGWMLLSQVFSIYARYFATRISGYQIIGSFI 252

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             +++L       ILG  +NA +  Y    +
Sbjct: 253 VLMLWLNFAATIIILGGIINAVVQEYVTGHQ 283


>gi|241765077|ref|ZP_04763069.1| ribonuclease BN [Acidovorax delafieldii 2AN]
 gi|241365314|gb|EER60136.1| ribonuclease BN [Acidovorax delafieldii 2AN]
          Length = 416

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 48/258 (18%), Positives = 97/258 (37%), Gaps = 9/258 (3%)

Query: 17  EHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI--DVVFGAWPEVI 74
           E F E+     AS ++ + +L++ PF+     +         +  V+   +V    P+ I
Sbjct: 33  ERFREDRLGLTASSLTFTTVLALVPFVTVALAVFTAFPIFGKLQGVLQRWLVDSLVPDSI 92

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
           ++ +   + Q  A  A  L           +   +  +  +LN  +RV  +R      LI
Sbjct: 93  SRQVLGYLTQF-AAQASRLGVAGVSVLLVTALALILTIDRTLNNIWRVRRLRPLGQRVLI 151

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLI 194
            +  + L  V L     +   +  A   + +  P        +           L  G+ 
Sbjct: 152 YWAAITLGPVVLGASLALTSYVMSASGGLVRAVPDG------VRLLFDSIEFFVLAAGMA 205

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++ ++P    K      G +F  +   +   +   Y+    TYS +Y   A++   LV+
Sbjct: 206 ALYHYVPNTPVKWQHAWAGGLFVAVCIELAKKVLAIYLGKVPTYSVVYGTFATLPILLVW 265

Query: 255 LYMLGVFFILGAELNASM 272
           +Y+  V  +LGA + A +
Sbjct: 266 IYVAWVIVLLGAVVTAYL 283


>gi|288559248|sp|Q31UA7|YIHY_SHIBS RecName: Full=UPF0761 membrane protein yihY
          Length = 290

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 46/280 (16%), Positives = 99/280 (35%), Gaps = 10/280 (3%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP- 60
           R     ++  +    +   E++   +A +++  +LLS+ P +     L         V  
Sbjct: 10  RHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSI 69

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            +   +F  +       I   I Q +A   K +  + A      +   + ++  +LN  +
Sbjct: 70  QLRHFIFANFLPATGDVIQRYIEQFVANSNK-MTAVGACGLIVTALLLMYSIDSALNTIW 128

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           R    R    +  + +  + L  +       +   +               +L  +I N 
Sbjct: 129 RSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLR--------WASDLNTVIDNV 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                +L  +I    ++  +P  +      + G     + +  G   F  YI  F +Y  
Sbjct: 181 LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +Y  LA I    V++Y      +LGAE+  ++  Y+  K+
Sbjct: 241 IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYHKLKQ 280


>gi|262377264|ref|ZP_06070488.1| tRNA-processing ribonuclease BN(RNase BN) [Acinetobacter lwoffii
           SH145]
 gi|262307717|gb|EEY88856.1| tRNA-processing ribonuclease BN(RNase BN) [Acinetobacter lwoffii
           SH145]
          Length = 415

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/275 (14%), Positives = 101/275 (36%), Gaps = 4/275 (1%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +  Y    F  +   +  F  +     A  ++ + L +V P +     +   + A +   
Sbjct: 9   LPFYEKHWFQFVLFVLRRFETDRCREQAGSLTYTTLFAVVPMLTVFLVIISSIKALEPAR 68

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
             +  +  +          D+ L      +  L  I  L     +   + ++    NR +
Sbjct: 69  QQLQQLIYSNFLPKTTIAFDKALNAFTDKSSNLTIIGILFLFVTTVLMLSSIETVFNRIW 128

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R   +  +  +  + L  + L     +   +         F     +   ++W  
Sbjct: 129 RVTETRGGIMGFMRYWTIISLGPILLGSAFVISSTVASMSILSNNFAGYELDGAFVLWAI 188

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
               T+L  FI    ++  +P     + S     +F+ + + +   LF + +  F++Y  
Sbjct: 189 SFSLTVLGFFI----LNWTIPNRSVPLKSAFIAGLFSAVVFELLKNLFGYIMSNFTSYEI 244

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           +Y   A++   L+++Y+  +  +LG E++ ++  +
Sbjct: 245 VYGAFAAVPIFLLWIYLSWIIVLLGVEISYALTAF 279


>gi|29827757|ref|NP_822391.1| ribonuclease BN family membrane protein [Streptomyces avermitilis
           MA-4680]
 gi|29604858|dbj|BAC68926.1| putative membrane protein, ribonuclease BN-like family
           [Streptomyces avermitilis MA-4680]
          Length = 339

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/271 (15%), Positives = 101/271 (37%), Gaps = 3/271 (1%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
           +         +D    A+ ++  A+L++ P ++   +L G + + +    +I  V    P
Sbjct: 63  LRRTPVSMWRDDVSDWAAALTYYAILALLPAMLMAVSLIGLV-SPRVTDDLIAHVTAWAP 121

Query: 72  EVIAKPITDEILQVLAVPAKGLFTI--SALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
                 +   +  +    +  L       ++A + +S+ +   R +L+  + + + R   
Sbjct: 122 AESGNTLHGSLRHLAGERSAALTVAIGGGVSALWSASSYLAVFRRALHAQHGIEDTRPAL 181

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
            T        +     L + + + V     L  + +     G         R  A +  +
Sbjct: 182 RTAPRILLTAVTLLALLFVSALLLVLSGSLLEALGRRAGLGGAGAAAWTLLRWPALLALV 241

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            + ++ +    P    ++   LPG +   + W+  +  FT Y      YS +Y  LA ++
Sbjct: 242 ALLVLVLFRTGPREVRELRHALPGGMLAALLWLTASAGFTAYASGLGAYSKLYGSLAGVI 301

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
             LV+L++  +  + GA+  A +       +
Sbjct: 302 VFLVWLWVSNLALLAGAQFTAELTRAERAAQ 332


>gi|295095034|emb|CBK84124.1| tRNA-processing RNAse BN [Enterobacter cloacae subsp. cloacae NCTC
           9394]
          Length = 293

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 45/276 (16%), Positives = 102/276 (36%), Gaps = 10/276 (3%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVID 64
             +   +        E++   +A +++  +LLS+ P +     L         V   +  
Sbjct: 14  RPLRAWLKLLWHRIDEDNMTTLAGNLAYVSLLSLVPLVAVIFALFSAFPMFADVSMQLRH 73

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
            VF  +       I + I Q +A  +K +  + A      +   + ++  +LN  +R  +
Sbjct: 74  FVFANFIPATGDVIQNYIEQFVANSSK-MTAVGACGLIVTALLLMYSIDSALNTIWRSKK 132

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
           +R    +  + +  + L  +       +   +               +L  +I N     
Sbjct: 133 VRPKVYSFAVYWMILTLGPLLAGASLAISSYLLSLR--------WATDLNSVIDNVLRIF 184

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
            ++  ++    ++  +P  +      + G +   + + +G   F  YI  F +Y  +Y  
Sbjct: 185 PLILSWLSFWLLYSVVPTTRVPNRDAVVGALVAALLFELGKKGFALYITMFPSYQLIYGV 244

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           LA I    V++Y      +LGAE+  ++ +Y   KK
Sbjct: 245 LAVIPILFVWVYWTWCIVLLGAEITVTLGVYRELKK 280


>gi|21241707|ref|NP_641289.1| ribonuclease BN/unknown domain fusion protein [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|32699643|sp|Q8PNV2|Y937_XANAC RecName: Full=UPF0761 membrane protein XAC0937
 gi|21107075|gb|AAM35825.1| ribonuclease BN [Xanthomonas axonopodis pv. citri str. 306]
          Length = 422

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/266 (15%), Positives = 98/266 (36%), Gaps = 8/266 (3%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV-PTVIDVVFGAWP 71
                 F+++  +  A+ ++ + + ++ P  +    +     A       + D +F  + 
Sbjct: 22  RFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLSAFPAFNEWKDALTDFIFNNFV 81

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
              A+ + + + + L            +A        + ++  + N  +RV   R     
Sbjct: 82  PGAARSVQNYLNRSLED-LGKFTVAGMVALVASLLITLHSIEQTFNSIWRVAAARPKVTR 140

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
            LI +  + L ++       +   +     +       L             A M   F+
Sbjct: 141 FLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTEGQWLAEFAW------RLAPMAVEFV 194

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
            ++ ++  +P    ++   LPG +   I   +    F  Y+  F TY  +Y  L+++   
Sbjct: 195 CIVLIYRVVPQHVVRLRHALPGALLAVILMEIVKWGFGFYLGNFQTYQRIYGALSALPIL 254

Query: 252 LVFLYMLGVFFILGAELNASMIIYYW 277
           L+++Y+  V  +LGA L +SM  + +
Sbjct: 255 LLWIYLSWVSVLLGASLASSMSAFRY 280


>gi|294626113|ref|ZP_06704720.1| ribonuclease BN domain fusion protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294666019|ref|ZP_06731281.1| ribonuclease BN domain fusion protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292599562|gb|EFF43692.1| ribonuclease BN domain fusion protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292604211|gb|EFF47600.1| ribonuclease BN domain fusion protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 425

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/266 (15%), Positives = 98/266 (36%), Gaps = 8/266 (3%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV-PTVIDVVFGAWP 71
                 F+++  +  A+ ++ + + ++ P  +    +     A       + D +F  + 
Sbjct: 25  RFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLSAFPAFNEWKDALTDFIFNNFV 84

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
              A+ + + + + L            +A        + ++  + N  +RV   R     
Sbjct: 85  PGAARSVQNYLNRSLED-LGKFTVAGMVALVASLLITLHSIEQTFNSIWRVAAARPKVTR 143

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
            LI +  + L ++       +   +     +       L             A M   F+
Sbjct: 144 FLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTEGQWLAEFAW------RLAPMAVEFV 197

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
            ++ ++  +P    ++   LPG +   I   +    F  Y+  F TY  +Y  L+++   
Sbjct: 198 CIVLIYRVVPQHVVRLRHALPGALLAVILMEIVKWGFGFYLGNFQTYQRIYGALSALPIL 257

Query: 252 LVFLYMLGVFFILGAELNASMIIYYW 277
           L+++Y+  V  +LGA L +SM  + +
Sbjct: 258 LLWIYLSWVSVLLGASLASSMSAFRY 283


>gi|218551132|ref|YP_002384923.1| ribonuclease BN [Escherichia fergusonii ATCC 35469]
 gi|226737447|sp|B7LVG3|YIHY_ESCF3 RecName: Full=UPF0761 membrane protein yihY
 gi|218358673|emb|CAQ91327.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia fergusonii ATCC 35469]
 gi|324111499|gb|EGC05480.1| YihY family protein [Escherichia fergusonii B253]
 gi|325499413|gb|EGC97272.1| ribonuclease BN [Escherichia fergusonii ECD227]
          Length = 290

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 46/280 (16%), Positives = 100/280 (35%), Gaps = 10/280 (3%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP- 60
           R +   ++  +    +   E++   +A +++  +LLS+ P +     L         V  
Sbjct: 10  RHHTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSI 69

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            +   +F  +       I   I Q +A   K +  + A      +   + ++  +LN  +
Sbjct: 70  QLRHFIFANFLPATGDVIQQYIEQFVANSNK-MTAVGACGLIVTALLLMYSIDSALNAIW 128

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           R   +R    +  + +  + L  +       +   +               +L  +I N 
Sbjct: 129 RSKRVRPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLR--------WASDLNTVIDNV 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                +L  +I    ++  +P  +      + G     + +  G   F  YI  F +Y  
Sbjct: 181 LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +Y  LA I    V++Y      +LGAE+  ++  Y   K+
Sbjct: 241 IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQ 280


>gi|218701414|ref|YP_002409043.1| ribonuclease BN [Escherichia coli IAI39]
 gi|226737441|sp|B7NUY5|YIHY_ECO7I RecName: Full=UPF0761 membrane protein yihY
 gi|218371400|emb|CAR19233.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli IAI39]
          Length = 290

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 46/280 (16%), Positives = 98/280 (35%), Gaps = 10/280 (3%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP- 60
           R     ++  +    +   E++   +A +++  +LLS+ P +     L         V  
Sbjct: 10  RHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSI 69

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            +   +F  +       I   I Q +A   K +  + A      +   + ++  +LN  +
Sbjct: 70  QLRHFIFANFLPATGDVIQRYIEQFVANSNK-MTAVGACGLIVTALLLMYSIDSALNAIW 128

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           R    R    +  + +  + L  +       +   +               +L  +I N 
Sbjct: 129 RSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLR--------WASDLNTVIDNV 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                +L  +I    ++  +P  +      + G     + +  G   F  YI  F +Y  
Sbjct: 181 LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +Y  LA I    V++Y      +LGAE+  ++  Y   K+
Sbjct: 241 IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQ 280


>gi|297621313|ref|YP_003709450.1| putative phosphoesterase, RecJ-like protein [Waddlia chondrophila
           WSU 86-1044]
 gi|297376614|gb|ADI38444.1| putative phosphoesterase, RecJ-like protein [Waddlia chondrophila
           WSU 86-1044]
          Length = 414

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/273 (15%), Positives = 100/273 (36%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV 62
            +   +F++   +I  F ++  +  AS ++   LLS+ PF+     +A   G  Q +   
Sbjct: 2   RFLKYIFNVAKLSISGFFKDQCFLHASSLTFYTLLSIVPFLAVAFGVAKGFGFEQTLEDE 61

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
           +   F    +V+   +      +  V    +  +  +    F  +    +  S+N  ++V
Sbjct: 62  LHQRFSEHEQVLKLVLEFARSLLEQVEGSFITGVGVIFLFLFVMSLFWTIETSMNVIWKV 121

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            + R         F  ++       + S   V +   L         L       +    
Sbjct: 122 KKTRRPVRMLTDYFVMMIFFPFIFAVASSSMVYVTTVLHQAALESELLQKASPYFFMFYK 181

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
              ++ +++    + +F+P  K +    L   I    ++ +   +   + +  S YS +Y
Sbjct: 182 GLALVMIWLLFAALFIFMPNKKVEWKYGLIAGILAGSAYYLIQQVMIIFQIGVSQYSAIY 241

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
              A++   L++L +  V  ++GA++   +   
Sbjct: 242 GSFAALPIFLLWLQISWVTVLMGAQVAYHLEHL 274


>gi|262373473|ref|ZP_06066751.1| tRNA-processing ribonuclease BN(RNase BN) [Acinetobacter junii
           SH205]
 gi|262311226|gb|EEY92312.1| tRNA-processing ribonuclease BN(RNase BN) [Acinetobacter junii
           SH205]
          Length = 416

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/275 (14%), Positives = 100/275 (36%), Gaps = 4/275 (1%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
              F  I   +  F  +     A  ++ + L +V P +     +   + A +     +  
Sbjct: 15  KTWFQFIVFVLRRFEADRCREQAGSLTYTTLFAVVPMLTVFLVIISSIKALEPARQQLQQ 74

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           +  +     +    D+ L      +  L  I  L     +   + ++    NR +RV E 
Sbjct: 75  LIYSNFLPKSTIAFDKALNAFTEKSSNLTVIGVLFLFVTTVLMLTSIETVFNRIWRVKET 134

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R+  +  +  +  + L  + L     +   +         F     +  LI+       +
Sbjct: 135 RTGLVGFMRYWTIISLGPIVLGSAFVLSSTVASMNVLSNNFAGYQLDGALIL----WLIS 190

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
            +   +G   ++  +P     I S +    F+   + +   LF   +  F++Y  +Y   
Sbjct: 191 FILTIVGFFILYWTIPNRTVPIFSAVIAACFSATVFEILKHLFGWIMSNFTSYEIVYGAF 250

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           A++   L+++Y+     +LG E++ ++  ++  K+
Sbjct: 251 AAVPIFLLWIYLSWNIILLGVEVSYALTAFHSGKE 285


>gi|74314388|ref|YP_312807.1| ribonuclease BN [Shigella sonnei Ss046]
 gi|123615669|sp|Q3YV90|YIHY_SHISS RecName: Full=UPF0761 membrane protein yihY
 gi|73857865|gb|AAZ90572.1| tRNA processing exoribonuclease BN [Shigella sonnei Ss046]
 gi|323167513|gb|EFZ53220.1| YihY family protein [Shigella sonnei 53G]
          Length = 290

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 46/280 (16%), Positives = 98/280 (35%), Gaps = 10/280 (3%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP- 60
           R     ++  +    +   E++   +A +++  +LLS+ P +     L         V  
Sbjct: 10  RHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSI 69

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            +   +F  +       I   I Q +A   K +  + A      +   + ++  +LN  +
Sbjct: 70  QLRHFIFANFLPATGDVIQRYIEQFVANSNK-MTAVGACGLIVTALLLMYSIDSALNTIW 128

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           R    R    +  + +  + L  +       +   +               +L  +I N 
Sbjct: 129 RSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLFSLR--------WASDLNTVIDNV 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                +L  +I    ++  +P  +      + G     + +  G   F  YI  F +Y  
Sbjct: 181 LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +Y  LA I    V++Y      +LGAE+  ++  Y   K+
Sbjct: 241 IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQ 280


>gi|325914257|ref|ZP_08176607.1| tRNA-processing RNAse BN [Xanthomonas vesicatoria ATCC 35937]
 gi|325539512|gb|EGD11158.1| tRNA-processing RNAse BN [Xanthomonas vesicatoria ATCC 35937]
          Length = 425

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/266 (15%), Positives = 98/266 (36%), Gaps = 8/266 (3%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV-PTVIDVVFGAWP 71
                 F+++  +  A+ ++ + + ++ P  +    +     A       + D +F  + 
Sbjct: 25  RFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLSAFPAFNEWKDALTDFIFNNFV 84

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
              A+ + + + + L            +A        + ++  + N  +RV   R     
Sbjct: 85  PGAARSVQNYLNRSLED-LGKFTVAGMVALVASLLITLHSIEQTFNSIWRVAAARPKVTR 143

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
            LI +  + L ++       +   +     +       L             A M   F+
Sbjct: 144 FLIYWTVLTLGTMLAAAAMAMAAYVFALPLFRTTEGQWLAGFAW------RLAPMAVEFV 197

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
            ++ ++  +P    ++   LPG +   I   +    F  Y+  F TY  +Y  L+++   
Sbjct: 198 CIVLIYRVVPQHVVRLRHALPGALLAVILMEIVKWGFGFYLGNFQTYQRIYGALSALPIL 257

Query: 252 LVFLYMLGVFFILGAELNASMIIYYW 277
           L+++Y+  V  +LGA L +SM  + +
Sbjct: 258 LLWIYLSWVSVLLGASLASSMSAFRY 283


>gi|323698038|ref|ZP_08109950.1| ribonuclease BN [Desulfovibrio sp. ND132]
 gi|323457970|gb|EGB13835.1| ribonuclease BN [Desulfovibrio desulfuricans ND132]
          Length = 461

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 36/271 (13%), Positives = 103/271 (38%), Gaps = 4/271 (1%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV 62
             +     ++Y     F+++     A+ ++ + +LS+ PF+    +++   G        
Sbjct: 31  RIWRGACRLVYLIGFSFIKDQTIIRAAALTFTTILSIVPFLAVAFSISKGFGFQNTGK-- 88

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
           +  +         +     I  +     + L  +  +   +   + V  +  + N  + V
Sbjct: 89  MRDLILHLTTGQPEVADKIIEYIDRTNVQALGWVGVVTLLFTVLSLVGTIEKAFNVIWSV 148

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            + RS +      F  +L   + L + S    ++      +     +L  +  +      
Sbjct: 149 DKGRSAWRRITDFFPIILFGPIFLFVASSFNFSLQN--QEMISRVMSLKAIGYLETAFLK 206

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
               L + +    ++ F+P  + ++ + + G +   + W +   L+ ++ +    Y+ +Y
Sbjct: 207 TVPYLLIIMAFSMMYAFIPNTRVRLRAAIIGGVVGGVLWQMAQWLYINWQIGAVKYNAIY 266

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMI 273
              A +   LV++Y+  V  +LGA+++ +  
Sbjct: 267 GSFAQLPLLLVWIYLSWVIVLLGAQVSHAWQ 297


>gi|17230885|ref|NP_487433.1| hypothetical protein alr3393 [Nostoc sp. PCC 7120]
 gi|17132488|dbj|BAB75092.1| alr3393 [Nostoc sp. PCC 7120]
          Length = 314

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 47/282 (16%), Positives = 98/282 (34%), Gaps = 11/282 (3%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGF-LGAHQFVPTVI 63
              ++ +  +A + + ++    +A+ ++   + S+ P ++    +AG   G       ++
Sbjct: 15  LKAIWQLFQEAFQEWNDDKASRLAAALAYYTVFSIAPLLIIVIAIAGAVFGEEAARGEIV 74

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKG-LFTISALAAAYFSSNGVEALRISLNRAYRV 122
             + G      A+ I   I  V           IS       ++     L+ SLN  + V
Sbjct: 75  QQIQGLVGRDGAEFIETAIQNVDRPKTGTIASLISIALLLLGATGVFIELQDSLNTIWEV 134

Query: 123 VEMR-----SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLII 177
                    + +  R +SFG VL     L++   +   +   + Y     P +     + 
Sbjct: 135 QPKPGRGVKNIFRQRFLSFGMVLGIGFLLLVSLVISTVLSTLVNYFGGLLPGVD---FLW 191

Query: 178 WNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST 237
                  +     +    +   LP  +     +L G I T I + +G  L   Y+   + 
Sbjct: 192 QLVNFIISFAITTLLFALIFKVLPDVRITWNDVLVGAILTSILFSIGRFLLGQYLGN-AG 250

Query: 238 YSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           + + Y    S++  L ++Y        GAE        Y R+
Sbjct: 251 FGSAYGAAGSVVLILAWVYYTAQILFFGAEFTQVYARKYGRR 292


>gi|126462086|ref|YP_001043200.1| putative ribonuclease BN [Rhodobacter sphaeroides ATCC 17029]
 gi|126103750|gb|ABN76428.1| putative ribonuclease BN [Rhodobacter sphaeroides ATCC 17029]
          Length = 324

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 57/273 (20%), Positives = 120/273 (43%), Gaps = 8/273 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI         E+    +A+ ++   LL++FP +    +L G       +    + + G 
Sbjct: 30  DIALRVWRSIDEDRVMLVAAGVTFYLLLALFPALAAFVSLYGLFADPAVIAEQAESLRGV 89

Query: 70  WPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P      +T+++  + +  +  L     +S L A + +++G++AL  ++N A+   E R
Sbjct: 90  IPAEGLDLLTEQLRTLASGESSSLTFSFVLSFLIAFWSANSGMKALIEAMNIAHEEREKR 149

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+    L+SF   L A V  V M    +     +  V   F        ++W  R    +
Sbjct: 150 SFVKLTLLSFALTLGAMVLAVTM----IVAVAVVPAVLAVFDLGSVATAVVWLVRWPLLL 205

Query: 187 LALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           L +   +  ++ + P+  +     +  G     + W++ ++ FT Y+  F+ YS  Y  L
Sbjct: 206 LLVATAMAGLYRWAPSRNAPEWRWVTWGSGLATLVWLIASIAFTIYLENFANYSATYGSL 265

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            +++  L+++++  +  I+GAE+N+ M     R
Sbjct: 266 GALVGLLLWVWIAVMILIVGAEVNSEMEHQTAR 298


>gi|239832980|ref|ZP_04681309.1| YihY family protein [Ochrobactrum intermedium LMG 3301]
 gi|239825247|gb|EEQ96815.1| YihY family protein [Ochrobactrum intermedium LMG 3301]
          Length = 306

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 129/280 (46%), Positives = 184/280 (65%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MR+    +  I +D I HF  +DGWA ASHI+LS L+++FPF++F   LA FLG  +F  
Sbjct: 21  MRKIRRFLRQITWDVIGHFSSDDGWAFASHIALSGLMALFPFLIFATTLASFLGTKEFAD 80

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T + V+F  WP  IA PI +E++ VL V   GL T+S +AAAYF+SNGVEALRI+LNRAY
Sbjct: 81  TAVHVIFDMWPSNIAAPIANEVMNVLTVQRSGLLTLSVIAAAYFASNGVEALRIALNRAY 140

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV + RS    RL S G+VL+ +++L+ +SF+ V  PLA+    ++FP +      I   
Sbjct: 141 RVTDQRSIIFCRLQSLGFVLVGTLSLMAISFLLVLAPLAVRIAEQWFPDIAPFTGTIAFW 200

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R    +  L + L  VH++LPA +  +  ILPG++ T I+W+  A+ F  Y+ TF+ Y T
Sbjct: 201 RYTVAVAVLVLALFMVHIWLPAGRRSLGDILPGILVTLIAWLAAAMAFAKYLETFANYVT 260

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            YAGLASIM  +VFLYML   FI+GAE+NA+++I+  R++
Sbjct: 261 TYAGLASIMVAIVFLYMLSAIFIIGAEINAAIMIFRKREQ 300


>gi|15893462|ref|NP_346811.1| T-RNA-processing ribonuclease BN [Clostridium acetobutylicum ATCC
           824]
 gi|15022998|gb|AAK78151.1|AE007530_2 T-RNA-processing ribonuclease BN [Clostridium acetobutylicum ATCC
           824]
 gi|325507577|gb|ADZ19213.1| T-RNA-processing ribonuclease BN [Clostridium acetobutylicum EA
           2018]
          Length = 273

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 62/265 (23%), Positives = 126/265 (47%), Gaps = 2/265 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
            ++ D I  F E+D  A+ S ++   +LS FPFI+F   L G+   +     ++ V+   
Sbjct: 3   RLLLDLISRFNEDDVPALGSQLAYYLVLSFFPFIIFIMTLIGYTSLNN--KEILMVLSRI 60

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
            PE     I   + +V++     L ++S +   + +S G  A+   LN+AY V E R++ 
Sbjct: 61  MPESAFNLIHAAVAEVISTKHSQLMSLSLVLTIWSASAGFTAVIKGLNKAYGVQEARNFI 120

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
             R +S    +  +  ++ M F+ +   + L Y+         ++ +    R    +   
Sbjct: 121 KVRFVSILCTIGVAFIILTMMFLLILGRIILNYLAYKLGFSHKVIAVWEAVRYLIFVSTA 180

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
                 ++ + P  K   + +LPG +F+ ++ ++ +  F +Y+  F+ YS +Y  + +I+
Sbjct: 181 IFIFTALYRYAPCKKLMWIEVLPGSLFSTLNLILASFGFAYYVNNFANYSVIYGSIGAII 240

Query: 250 TCLVFLYMLGVFFILGAELNASMII 274
             L +L+++ V  ILG E+NA +  
Sbjct: 241 ILLTWLFLVAVIVILGGEINAVLSQ 265


>gi|117626154|ref|YP_859477.1| ribonuclease BN [Escherichia coli APEC O1]
 gi|166199577|sp|A1AI63|YIHY_ECOK1 RecName: Full=UPF0761 membrane protein yihY
 gi|115515278|gb|ABJ03353.1| tRNA processing exoribonuclease BN [Escherichia coli APEC O1]
 gi|323949375|gb|EGB45264.1| YihY family protein [Escherichia coli H252]
          Length = 290

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 46/280 (16%), Positives = 98/280 (35%), Gaps = 10/280 (3%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP- 60
           R     ++  +    +   E++   +A +++  +LLS+ P +     L         V  
Sbjct: 10  RHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSI 69

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            +   +F  +       I   I Q +A   K +  + A      +   + ++  +LN  +
Sbjct: 70  QLRHFIFANFLPATGDVIQRYIEQFVANSNK-MTAVGACGLIVTALLLMYSIDSALNTIW 128

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           R    R    +  + +  + L  +       +   +               +L  +I N 
Sbjct: 129 RSKRARPKIYSFAVYWMILTLGPLLAGASLAISAYLLSLR--------WASDLNTVIDNV 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                +L  +I    ++  +P  +      + G     + +  G   F  YI  F +Y  
Sbjct: 181 LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +Y  LA I    V++Y      +LGAE+  ++  Y   K+
Sbjct: 241 IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQ 280


>gi|295702560|ref|YP_003595635.1| YihY family protein [Bacillus megaterium DSM 319]
 gi|294800219|gb|ADF37285.1| YihY family protein [Bacillus megaterium DSM 319]
          Length = 279

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 62/275 (22%), Positives = 124/275 (45%), Gaps = 2/275 (0%)

Query: 4   YFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI 63
           Y   +     + +     ++  ++++ ++   LLS+FPF++F   L GFL        ++
Sbjct: 5   YINNIVRFGKELMGRIHRDELPSLSAELAYYLLLSLFPFLIFLITLIGFLPLEST--DLL 62

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
           D+V    P+     I   +  ++    + L +   +A  + +SNG+ A+  + NRAY V 
Sbjct: 63  DLVENVAPQQTLHMIESNVSHIIGSHNEKLLSFGIIATMWSASNGINAIVRAFNRAYHVQ 122

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R + + R ++          +++   + V   +   Y+   F      L +    R  
Sbjct: 123 ENRPFLVARGMAVLLTFAMIFVIIVALLLPVFGHMIGLYLSSTFGFSETFLALWSASRWI 182

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            + L LF     ++ F P  K  I +++ G  F  + W V ++LF +Y+  F+ Y+  Y 
Sbjct: 183 ISGLILFTVFTGLYYFAPNKKLLIRNVVKGAAFATVGWTVVSMLFAYYVNHFNNYTATYG 242

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            L  I+  L++LY+ G+  ++G E+NA       +
Sbjct: 243 SLGGIIILLIWLYLSGMIIVIGGEINAIFYDRRVK 277


>gi|83748282|ref|ZP_00945307.1| Ribonuclease BN [Ralstonia solanacearum UW551]
 gi|207742928|ref|YP_002259320.1| ribonuclease bn protein [Ralstonia solanacearum IPO1609]
 gi|83725014|gb|EAP72167.1| Ribonuclease BN [Ralstonia solanacearum UW551]
 gi|206594323|emb|CAQ61250.1| ribonuclease bn protein [Ralstonia solanacearum IPO1609]
          Length = 441

 Score =  137 bits (346), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 48/273 (17%), Positives = 101/273 (36%), Gaps = 9/273 (3%)

Query: 7   IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI--D 64
            +  ++  A+    E+    +A  ++ + +LS+ P +     L       Q     I   
Sbjct: 15  KLRALLRYALRRAGEDSLPQVAGSLTFTTVLSLVPILTVAFALFTAFPMFQSFRAAIESY 74

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVE 124
           +     P  I++PI   + Q  +  AKGL     +     S   +  +  +LN  +RV +
Sbjct: 75  LFSNLVPGNISRPILTYLNQF-SHNAKGLTAAGLVGLVVTSVMTMLTVENALNAIWRVHQ 133

Query: 125 MRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYA 184
            R      L+ +  V    V +     V   +    A      P        +       
Sbjct: 134 RRPLTQRVLVFWALVSFGPVLIGASLSVSSYLVSISAGYVAKLPYG------LGVVVGVV 187

Query: 185 TMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAG 244
            +L   I    +++F+P             +   +++ +    F +Y+  F TY+ +Y  
Sbjct: 188 PILLSAIAFAMLYVFVPNTLVAWRDAFLAGLVAAVAFEIAKRGFGYYVARFPTYTAVYGT 247

Query: 245 LASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
            A++   L+++Y+  +  +LGA + A++ I   
Sbjct: 248 FAALPIFLLWIYVSWLVTLLGATIAATLPIVRQ 280


>gi|284923988|emb|CBG37087.1| tRNA-processing ribonuclease BN [Escherichia coli 042]
          Length = 290

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 46/280 (16%), Positives = 98/280 (35%), Gaps = 10/280 (3%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP- 60
           R     ++  +    +   E++   +A +++  +LLS+ P +     L         V  
Sbjct: 10  RHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSI 69

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            +   +F  +       I   I Q +A   K +  + A      +   + ++  +LN  +
Sbjct: 70  QLRHFIFANFLPATGDVIQRYIEQFVANSNK-MTAVGACGLIVTALLLMYSIDSALNTIW 128

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           R    R    +  + +  + L  +       +   +               +L  +I N 
Sbjct: 129 RSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLR--------WASDLNTVIDNV 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                +L  +I    ++  +P  +      + G     + +  G   F  YI  F +Y  
Sbjct: 181 LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFVLYITMFPSYQL 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +Y  LA I    V++Y      +LGAE+  ++  Y   K+
Sbjct: 241 IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQ 280


>gi|294497189|ref|YP_003560889.1| YihY family protein [Bacillus megaterium QM B1551]
 gi|294347126|gb|ADE67455.1| YihY family protein [Bacillus megaterium QM B1551]
          Length = 279

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 62/275 (22%), Positives = 124/275 (45%), Gaps = 2/275 (0%)

Query: 4   YFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI 63
           Y   +     + +     ++  ++++ ++   LLS+FPF++F   L GFL        ++
Sbjct: 5   YMNNIVRFGKELMGRIHRDELPSLSAELAYYLLLSLFPFLIFLITLIGFLPLEST--DLL 62

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
           D+V    P+     I   +  ++    + L +   +A  + +SNG+ A+  + NRAY V 
Sbjct: 63  DLVENVAPQQTLHMIESNVSHIIGSHNEKLLSFGIIATMWSASNGINAIVRAFNRAYHVQ 122

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R + + R ++          +++   + V   +   Y+   F      L +    R  
Sbjct: 123 ENRPFLVARGMAVLLTFAMIFVIIVALLLPVFGHMIGLYLSSTFGFSETFLALWSASRWI 182

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            + L LF     ++ F P  K  I +++ G  F  + W V ++LF +Y+  F+ Y+  Y 
Sbjct: 183 ISGLILFTVFTGLYYFAPNKKLLIRNVVKGAAFATVGWTVVSMLFAYYVNHFNNYTATYG 242

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            L  I+  L++LY+ G+  ++G E+NA       +
Sbjct: 243 SLGGIIILLIWLYLSGMIIVIGGEINAIFYDRRVK 277


>gi|218887767|ref|YP_002437088.1| ribonuclease BN [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218758721|gb|ACL09620.1| ribonuclease BN [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 561

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/272 (15%), Positives = 106/272 (38%), Gaps = 4/272 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R     +    + A   FV++     AS ++++ +LS+ PF+    ++   LG H    T
Sbjct: 33  RRGLVWLVRRAFLAALGFVDDQCLLRASALTMTFVLSMVPFLAVVFSITKGLGVHNAEAT 92

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
            + ++           +   +  V    A  +  +SA      +   +  +  S N  ++
Sbjct: 93  QMLLLR--LAAGNPDTVARILEYVERTSAGRMGAVSAAFLLVTAGMLMANIERSFNAIWK 150

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V + RS +      F  +L+  + +     +  ++      V      +  +  +     
Sbjct: 151 VRQGRSAWRKFTDFFSVMLVCPLLMGTAFTLGASLR--SGKVLGRLLEVAPVGAVYLLLL 208

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
               +  +F+ L+F++ ++P  + +  + + G +   ++W      +  +   F++Y  +
Sbjct: 209 KLVPLFMVFVVLLFLYSYIPNTRVRPRAAMAGALLAAMAWQGAEYAYMVWQARFASYGLI 268

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
           Y   A +   L++LY+     + G E+  ++ 
Sbjct: 269 YGSFAQVPLFLMWLYVSWAVVLFGVEVCHAVQ 300


>gi|258620385|ref|ZP_05715423.1| tRNA processing ribonuclease BN [Vibrio mimicus VM573]
 gi|262170328|ref|ZP_06038006.1| ribonuclease BN [Vibrio mimicus MB-451]
 gi|258587264|gb|EEW11975.1| tRNA processing ribonuclease BN [Vibrio mimicus VM573]
 gi|261891404|gb|EEY37390.1| ribonuclease BN [Vibrio mimicus MB-451]
          Length = 309

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 38/269 (14%), Positives = 86/269 (31%), Gaps = 6/269 (2%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPE 72
              +     +     A +++   LLS+ P +    ++            VI         
Sbjct: 20  RYLLTRMKHDRVNVNAGYLAYITLLSMVPMLTVLLSILSSFSIFASAGDVIQDFVITHFV 79

Query: 73  VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
             A  +    L         +  +        +   +  +  +LN  +RV   R    + 
Sbjct: 80  PAAGEVVKTALVEFVANTGKMTAVGGAFLFVAAIMLISNIDKNLNYIWRVQRKRRAVFSF 139

Query: 133 LISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIG 192
            + +  + L  + +         I                L         +   +  F  
Sbjct: 140 SMYWMILTLGPILVGASIAATSYITSL------KILDNEALSGAYNLFLRWLPFVLSFCA 193

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
            + ++L +P  K ++   + G +   + + +    F  YI  F +Y  +Y  LA+I    
Sbjct: 194 FVGLYLLVPNKKVRLPHAMAGALIAAVLFELSKKGFAAYITQFPSYQLIYGALAAIPILF 253

Query: 253 VFLYMLGVFFILGAELNASMIIYYWRKKP 281
           V++Y+  +  ++GAE+ A++        P
Sbjct: 254 VWVYLCWLIVLVGAEVTAALGEREHWSDP 282


>gi|120555963|ref|YP_960314.1| putative ribonuclease BN [Marinobacter aquaeolei VT8]
 gi|120325812|gb|ABM20127.1| tRNA-processing RNAse BN [Marinobacter aquaeolei VT8]
          Length = 451

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 49/264 (18%), Positives = 102/264 (38%), Gaps = 2/264 (0%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
              Y  I   +       A  +  + LLS+ P +    ++   LG HQ +   +   F  
Sbjct: 37  RSAYALIRDVISGQLTLHAMSLVYTTLLSIVPLLALSFSVLKALGVHQRMEPFLYQFFQP 96

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
                 +     +  V  +    L ++      Y   + V+ +  S N  +RV EMRS  
Sbjct: 97  MGPQGVEVAERILGFVDNMKVGVLGSVGLALLVYTVISLVQKIERSFNMIWRVPEMRSMA 156

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
                    +++  + +V  S + V   +  + + +   A+     +I     +     +
Sbjct: 157 QRFSNYLSVIMVGPLLMV--SAIGVTATIFSSEIAQNLMAIEPFGSLIVLASRFTPFFLV 214

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
                FV++F+P  + K+       +   +SW  G +LF  ++   + Y+ +Y+G A  +
Sbjct: 215 VGAFTFVYIFIPNTRVKLRYAFIAGLVAGVSWQAGGMLFASFVAGSAKYAAIYSGFAVGI 274

Query: 250 TCLVFLYMLGVFFILGAELNASMI 273
             L++ Y+  +  +LGA L   + 
Sbjct: 275 ILLIWTYLNWMILLLGASLAFYLQ 298


>gi|262380305|ref|ZP_06073459.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
 gi|262297751|gb|EEY85666.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
          Length = 414

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/273 (14%), Positives = 101/273 (36%), Gaps = 4/273 (1%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
              F  I   I  F  +    +A  ++ + L ++ P +     +   + A +     +  
Sbjct: 13  KTWFKFILFVIRRFEADRCRELAGSLTYTTLFAIVPMLTVFLVIISSIQALEPARQQLQQ 72

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           +  +     +    D++L      +  L  I  L     +   +  +  + NR +RV E 
Sbjct: 73  LIYSNFLPKSTIAFDKMLNAFTEKSSNLTVIGVLFLFVTTIMMLSTIETAFNRIWRVKET 132

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R   +  +  +  + L  + L     +  A+         F     +   ++       +
Sbjct: 133 RGGIVGFMRYWTIISLGPIVLGSAFVISSALASLSILSNNFAGYEMDGAFLLS----LLS 188

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +     G   ++  +P     +++     +F+ I + +   LF   +  F++Y  +Y   
Sbjct: 189 IALTIAGFFIIYWTIPNRNVPMIAAALAGVFSAIVFEMLKNLFGTIMSNFTSYEIVYGAF 248

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
           A+I   L+++Y+     +LG E++ ++  ++ R
Sbjct: 249 AAIPIFLLWIYLSWNIVLLGVEVSFAITAFHSR 281


>gi|119776536|ref|YP_929276.1| ribonuclease BN [Shewanella amazonensis SB2B]
 gi|119769036|gb|ABM01607.1| tRNA-processing RNAse BN [Shewanella amazonensis SB2B]
          Length = 303

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/265 (16%), Positives = 97/265 (36%), Gaps = 8/265 (3%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP-TVIDVVFGAW 70
           +   +    E+     A H++   LLS+ P +    ++       Q +  T+   V+   
Sbjct: 1   MLHLVSRLKEDQINVRAGHLTYVTLLSLVPMVAVTMSVLSAFPVFQGIRGTIETFVYENM 60

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
                  +   I + +   +KG   +        +   + A+  SLN  +R  E R + +
Sbjct: 61  IPAAGDTVQTYINEFVKNASKG-TAVGIGFLVVVAIMLISAIDKSLNAIWRTKEKRRFMV 119

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
              + +  + L  V +     V   +               ++  ++        ++   
Sbjct: 120 AFSMYWMVLTLGPVLMGASIAVTSYLVSLKVLSEA------DVYGVVPMLIEKLPLMFSV 173

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
              + +++ +P  K K +  L G +   + +  G   F  Y+ TF +Y  +Y  LA+I  
Sbjct: 174 AAFLLLYMAVPNQKVKFLHALLGALVAALLFEAGKRGFALYVTTFPSYEAIYGTLATIPI 233

Query: 251 CLVFLYMLGVFFILGAELNASMIIY 275
             V++Y+     + G  + A++  Y
Sbjct: 234 LFVWVYLSWTIVLFGGVIAAALPEY 258


>gi|153802917|ref|ZP_01957503.1| YihY family protein [Vibrio cholerae MZO-3]
 gi|254285936|ref|ZP_04960898.1| YihY family protein [Vibrio cholerae AM-19226]
 gi|124121530|gb|EAY40273.1| YihY family protein [Vibrio cholerae MZO-3]
 gi|150424118|gb|EDN16057.1| YihY family protein [Vibrio cholerae AM-19226]
          Length = 309

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/275 (13%), Positives = 90/275 (32%), Gaps = 6/275 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +++   +  +     +     +     A +++   LLS+ P +    ++           
Sbjct: 8   IKQQARLGLNFFRYLLARMNHDRVNVNAGYLAYITLLSMVPMLTVLLSILSSFALFANAG 67

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            VI           A  +    L         +  +        +   +  +  +LN  +
Sbjct: 68  EVIQDFVITHFVPAAGEVVKTALVEFVANTGKMTAVGGAFLFVAAIMLISNIDKNLNYIW 127

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV + R    +  + +  + L  + +         I                L  +    
Sbjct: 128 RVPQKRRAVFSFSMYWMILTLGPILVGASIAATSYITSL------KILDNEALSGVYNLF 181

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
             +   +  +   + ++L +P  K      + G +   I + +    F  YI  F +Y  
Sbjct: 182 LRWLPFVLSYCAFVGLYLLVPNKKVHWQHAMLGALIAAILFELSKKGFAAYITQFPSYQL 241

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           +Y  LA+I    V++Y+  +  ++GAE+ A++   
Sbjct: 242 IYGALAAIPILFVWVYLCWLIVLVGAEVTAALGER 276


>gi|229524719|ref|ZP_04414124.1| ribonuclease BN [Vibrio cholerae bv. albensis VL426]
 gi|229338300|gb|EEO03317.1| ribonuclease BN [Vibrio cholerae bv. albensis VL426]
          Length = 309

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/275 (13%), Positives = 90/275 (32%), Gaps = 6/275 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +++   +  +     +     +     A +++   LLS+ P +    ++           
Sbjct: 8   IKQQARLGLNFFRYLLARMNHDRVNVNAGYLAYITLLSMVPMLTVLLSILSSFALFANAG 67

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            VI           A  +    L         +  +        +   +  +  +LN  +
Sbjct: 68  EVIQDFVITHFVPAAGEVVKTALIEFVANTGKMTAVGGAFLFVAAIMLISNIDKNLNYIW 127

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV + R    +  + +  + L  + +         I                L  +    
Sbjct: 128 RVQQKRRAVFSFSMYWMILTLGPILVGASIAATSYITSL------KVLDNEALSGVYNLF 181

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
             +   +  +   + ++L +P  K      + G +   I + +    F  YI  F +Y  
Sbjct: 182 LRWLPFVLSYCAFVGLYLLVPNKKVHWQHAMLGALIAAILFELSKKGFAAYITQFPSYQL 241

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           +Y  LA+I    V++Y+  +  ++GAE+ A++   
Sbjct: 242 IYGALAAIPILFVWVYLCWLIVLVGAEVTAALGER 276


>gi|227543996|ref|ZP_03974045.1| ribonuclease BN [Lactobacillus reuteri CF48-3A]
 gi|300909547|ref|ZP_07127008.1| YihY family protein [Lactobacillus reuteri SD2112]
 gi|227186025|gb|EEI66096.1| ribonuclease BN [Lactobacillus reuteri CF48-3A]
 gi|300893412|gb|EFK86771.1| YihY family protein [Lactobacillus reuteri SD2112]
          Length = 298

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 67/269 (24%), Positives = 127/269 (47%), Gaps = 2/269 (0%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAW 70
            I   I+H       + A+ ++   LLS+FP ++   NL   +G      T++  +  A 
Sbjct: 11  FIALLIQHITMAQISSSAAVLAYYTLLSIFPAVMVVGNLLPMIGIDA--KTILAYLSTAI 68

Query: 71  PEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           PE +   I   I   L   + G+ T  AL A + +S G+ A + S+N AY + E ++  +
Sbjct: 69  PESVYDFIQPLIYDFLRRGSGGVLTTGALIALWSTSQGIAAFQRSVNHAYGIAENQNPVM 128

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            R++SF ++++  V + I+  ++      L  ++  F    + + +  + R   T   LF
Sbjct: 129 NRIVSFVWMIVVLVIIFIIIILYGFGEQVLKSIQPIFNFRRDYISLFSSLRWPVTFGVLF 188

Query: 191 IGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMT 250
           I L  ++ F+P AK ++   L G     + W+  + LF+ Y + FS     Y  + + + 
Sbjct: 189 IALTLLYYFVPNAKVRLRYALAGSFLASLLWMGLSRLFSFYTILFSHSVISYKTIGAFIA 248

Query: 251 CLVFLYMLGVFFILGAELNASMIIYYWRK 279
            +V+L   G   +LGA LNA++   +  +
Sbjct: 249 MMVWLDFSGYIIMLGAALNAALQECHEGE 277


>gi|254381013|ref|ZP_04996378.1| conserved hypothetical protein [Streptomyces sp. Mg1]
 gi|194339923|gb|EDX20889.1| conserved hypothetical protein [Streptomyces sp. Mg1]
          Length = 337

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 50/262 (19%), Positives = 104/262 (39%), Gaps = 6/262 (2%)

Query: 12  IYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWP 71
           +         ++    A+ ++  A+L++ P ++   +L G  GA      +I  +    P
Sbjct: 64  LRGTAVRLWNDNIADYAAALTYYAVLALVPALLVSVSLVGLAGA-GTRERLILDLTSYAP 122

Query: 72  EVIAKPITDEILQVLAVPAK--GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
              A+ + + +  + + P+    L     L+A + +S+ +   R +L+  +R+ + R   
Sbjct: 123 PQSAQVLREALDGLTSKPSSLWVLLVSGVLSALWSASSYLAVFRRALHTMHRLPDTRPPL 182

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
               I      +    LV  +   VA       +       G   + +   R    ++ +
Sbjct: 183 RAAHILVLTAGVLLALLVAGAASLVATGPVARRLAAAAGHSGTEAMAL--LRWPVLLVIV 240

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
              ++ ++   PA    +    PG       W+  + LFT Y   F TYS +Y  LA ++
Sbjct: 241 TALILILYRTGPAEARGVRRGFPGGALAAFLWLGASALFTLY-TQFGTYSRLYGSLAGVV 299

Query: 250 TCLVFLYMLGVFFILGAELNAS 271
             LV+L+   +  + GA+ NA 
Sbjct: 300 VFLVWLWFTNLALLAGAQFNAV 321


>gi|194428664|ref|ZP_03061201.1| tRNA-processing ribonuclease BN [Escherichia coli B171]
 gi|194413247|gb|EDX29532.1| tRNA-processing ribonuclease BN [Escherichia coli B171]
          Length = 290

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 46/280 (16%), Positives = 99/280 (35%), Gaps = 10/280 (3%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP- 60
           R     ++  +    +   E++   +A +++  +LLS+ P +     L         V  
Sbjct: 10  RHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSI 69

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            +   +F  +       I   I Q +A   K +  + A      +   + ++  +LN  +
Sbjct: 70  QLRHFIFANFLPATGDVIQRYIEQFVANSNK-MTAVGACGLIVTALLLMYSIDSALNTIW 128

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           R    R    +  + +  + L  +       +   +               +L  +I N 
Sbjct: 129 RSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLR--------WASDLNTVIDNV 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                +L  +I    ++  +P  +    + + G     + +  G   F  YI  F +Y  
Sbjct: 181 LRIFPLLLSWISFWLLYSIVPTIRVPNRNAIVGAFVAALLFEAGKQGFALYITMFPSYQL 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +Y  LA I    V++Y      +LGAE+  ++  Y   K+
Sbjct: 241 IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQ 280


>gi|58583238|ref|YP_202254.1| ribonuclease BN/unknown domain fusion protein [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|84625074|ref|YP_452446.1| fused ribonuclease BN/uncharacterized domain-containing protein
           [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188575458|ref|YP_001912387.1| ribonuclease BN/unknown domain fusion protein [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|67460605|sp|Q5GWQ2|Y3615_XANOR RecName: Full=UPF0761 membrane protein XOO3615
 gi|123521141|sp|Q2NZV5|Y3417_XANOM RecName: Full=UPF0761 membrane protein XOO3417
 gi|226737463|sp|B2SQM8|Y4555_XANOP RecName: Full=UPF0761 membrane protein PXO_04555
 gi|58427832|gb|AAW76869.1| ribonuclease BN [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84369014|dbj|BAE70172.1| ribonuclease BN [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188519910|gb|ACD57855.1| tRNA-processing ribonuclease BN [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 425

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 42/266 (15%), Positives = 98/266 (36%), Gaps = 8/266 (3%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV-PTVIDVVFGAWP 71
                 F+++  +  A+ ++ + + ++ P  +    +     A       + D +F  + 
Sbjct: 25  RFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLSAFPAFNEWKDALTDFIFTNFV 84

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
              A+ + + + + L            +A        + ++  + N  +RV   R     
Sbjct: 85  PGAARSVQNYLNRSLED-LGKFTVAGMVALVASLLITLHSIEQTFNSIWRVAAARPKVTR 143

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
            LI +  + L ++       +   +     +       L             A M   FI
Sbjct: 144 FLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTEGQWLAEFAW------RLAPMAVEFI 197

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
            ++ ++  +P    ++   LPG +   I   +    F  Y+  F TY  +Y  L+++   
Sbjct: 198 CIVLIYRVVPQHVVRLRHALPGALLAVILMEIVKWGFGVYLGNFQTYQRIYGALSALPIL 257

Query: 252 LVFLYMLGVFFILGAELNASMIIYYW 277
           L+++Y+  V  +LGA L +SM  + +
Sbjct: 258 LLWIYLSWVSVLLGASLASSMAAFRY 283


>gi|221639073|ref|YP_002525335.1| Ribonuclease BN family protein [Rhodobacter sphaeroides KD131]
 gi|221159854|gb|ACM00834.1| Ribonuclease BN family protein [Rhodobacter sphaeroides KD131]
          Length = 322

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 57/273 (20%), Positives = 120/273 (43%), Gaps = 8/273 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI         E+    +A+ ++   LL++FP +    +L G       +    + + G 
Sbjct: 28  DIALRVWRSIDEDRVMLVAAGVTFYLLLALFPALAAFVSLYGLFADPAVIAEQAESLRGV 87

Query: 70  WPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P      +T+++  + +  +  L     +S L A + +++G++AL  ++N A+   E R
Sbjct: 88  IPAEGLDLLTEQLRTLASGESSSLTFSFVLSFLIAFWSANSGMKALIEAMNIAHEEREKR 147

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+    L+SF   L A V  V M    +     +  V   F        ++W  R    +
Sbjct: 148 SFVKLTLLSFALTLGAMVLAVTM----IVAVAVVPAVLAVFDLGSVATAVVWLVRWPLLL 203

Query: 187 LALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           L +   +  ++ + P+  +     +  G     + W++ ++ FT Y+  F+ YS  Y  L
Sbjct: 204 LLVATAMAGLYRWAPSRNAPEWRWVTWGSGIATLVWLIASIAFTIYLENFANYSATYGSL 263

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            +++  L+++++  +  I+GAE+N+ M     R
Sbjct: 264 GALVGLLLWVWIAVMILIVGAEVNSEMEHQTAR 296


>gi|229521815|ref|ZP_04411233.1| ribonuclease BN [Vibrio cholerae TM 11079-80]
 gi|229341409|gb|EEO06413.1| ribonuclease BN [Vibrio cholerae TM 11079-80]
          Length = 309

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/275 (13%), Positives = 89/275 (32%), Gaps = 6/275 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +++   +        +     +     A +++   LLS+ P +    ++           
Sbjct: 8   IKQQARLGLHFFRYLLARMNHDRVNVNAGYLAYITLLSMVPMLTVLLSILSSFALFANAG 67

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            VI           A  +    L         +  +        +   +  +  +LN  +
Sbjct: 68  EVIQDFVITHFVPAAGEVVKTALIEFVANTGKMTAVGGAFLFVAAIMLISNIDKNLNYIW 127

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV + R    +  + +  + L  + +         I                L  +    
Sbjct: 128 RVQQKRRAVFSFSMYWMILTLGPILVGASIAATSYITSL------KILDNEALSGVYNLF 181

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
             +   +  +   + ++L +P  K      + G +   I + +    F  YI  F +Y  
Sbjct: 182 LRWLPFVLSYCAFVGLYLLVPNKKVHWQHAMLGALIAAILFELSKKGFAAYITQFPSYQL 241

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           +Y  LA+I    V++Y+  +  ++GAE+ A++   
Sbjct: 242 IYGALAAIPILFVWVYLCWLIVLVGAEVTAALGER 276


>gi|229495956|ref|ZP_04389680.1| ribonuclease BN [Porphyromonas endodontalis ATCC 35406]
 gi|229317048|gb|EEN82957.1| ribonuclease BN [Porphyromonas endodontalis ATCC 35406]
          Length = 436

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 47/272 (17%), Positives = 106/272 (38%), Gaps = 3/272 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R  +      +Y AI+ FV+ D  + AS ++ S +L++ P +     +A   G    +  
Sbjct: 13  RRIYINSLKSLYMAIKGFVQGDLTSKASALTYSTVLAIVPMLAVLVGIAKGFGVQDAISD 72

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
            +          I+K +      +  V       I  +   Y   N +  +  + NR + 
Sbjct: 73  FLIETLPTHTAEISKSLGFVENYLSQVKGGLFLGIGLVFLLYTVFNLLSTIENAFNRIWE 132

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             + R++       F  + L  V +V+ S + +A+        K F  LG++   + N  
Sbjct: 133 TTKGRTFKDKVTSYFTMIFLLPVLIVLSSGITIAMTTIKNTFMKDFFLLGSMTTFLINL- 191

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                +      + + + LP  K + +  L       +++    +L+   ++  S Y+ +
Sbjct: 192 --VPFVLTVFSFVAIFMALPNVKVRFVPALISGTLAGVAFQGFQMLYIGGMLWISRYNAI 249

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
           Y G A+    L+++ +  +  +  A+L  ++ 
Sbjct: 250 YGGFAAFPLLLLWMQLTWIITLFCAKLCYAIQ 281


>gi|218560956|ref|YP_002393869.1| ribonuclease BN [Escherichia coli S88]
 gi|226736461|sp|B7MI17|YIHY_ECO45 RecName: Full=UPF0761 membrane protein yihY
 gi|218367725|emb|CAR05514.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli S88]
          Length = 290

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 45/280 (16%), Positives = 97/280 (34%), Gaps = 10/280 (3%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP- 60
           R     ++  +    +   E++   +A +++  +LLS+ P +     L         V  
Sbjct: 10  RHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSI 69

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            +   +F  +       I   I Q +A   K +  + A      +   + ++  +LN  +
Sbjct: 70  QLRHFIFANFLPATGDVIQRYIEQFVANSNK-MTAVGACGLIVTALLLMYSIDSALNTIW 128

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           R    R    +  + +  + L  +       +   +               +L  +I N 
Sbjct: 129 RSKRARPKIYSFAVYWMILTLGPLLAGASLAISAYLLSLR--------WASDLNTVIDNV 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
                +L  +I    ++  +P  +      + G     + +      F  YI  F +Y  
Sbjct: 181 LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAEKKGFALYITMFPSYQL 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           +Y  LA I    V++Y      +LGAE+  ++  Y   K+
Sbjct: 241 IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQ 280


>gi|153825509|ref|ZP_01978176.1| YihY family protein [Vibrio cholerae MZO-2]
 gi|229513669|ref|ZP_04403133.1| ribonuclease BN [Vibrio cholerae TMA 21]
 gi|229527333|ref|ZP_04416725.1| ribonuclease BN [Vibrio cholerae 12129(1)]
 gi|254225457|ref|ZP_04919068.1| YihY family protein [Vibrio cholerae V51]
 gi|297581582|ref|ZP_06943505.1| yihY family protein [Vibrio cholerae RC385]
 gi|125622091|gb|EAZ50414.1| YihY family protein [Vibrio cholerae V51]
 gi|149740794|gb|EDM54885.1| YihY family protein [Vibrio cholerae MZO-2]
 gi|229334965|gb|EEO00450.1| ribonuclease BN [Vibrio cholerae 12129(1)]
 gi|229349546|gb|EEO14502.1| ribonuclease BN [Vibrio cholerae TMA 21]
 gi|297534420|gb|EFH73258.1| yihY family protein [Vibrio cholerae RC385]
          Length = 309

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/275 (13%), Positives = 90/275 (32%), Gaps = 6/275 (2%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           +++   +  +     +     +     A +++   LLS+ P +    ++           
Sbjct: 8   IKQQARLGLNFFRYLLARMNHDRVNVNAGYLAYITLLSMVPMLTVLLSILSSFALFANAG 67

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
            VI           A  +    L         +  +        +   +  +  +LN  +
Sbjct: 68  EVIQDFVITHFVPAAGEVVKTALIEFVANTGKMTAVGGAFLFVAAIMLISNIDKNLNYIW 127

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV + R    +  + +  + L  + +         I                L  +    
Sbjct: 128 RVQQKRRAVFSFSMYWMILTLGPILVGASIAATSYITSL------KILDNEALSGVYNLF 181

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
             +   +  +   + ++L +P  K      + G +   I + +    F  YI  F +Y  
Sbjct: 182 LRWLPFVLSYCAFVGLYLLVPNKKVHWQHAMLGALIAAILFELSKKGFAAYITQFPSYQL 241

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           +Y  LA+I    V++Y+  +  ++GAE+ A++   
Sbjct: 242 IYGALAAIPILFVWVYLCWLIVLVGAEVTAALGER 276


>gi|262402026|ref|ZP_06078591.1| ribonuclease BN [Vibrio sp. RC586]
 gi|262351998|gb|EEZ01129.1| ribonuclease BN [Vibrio sp. RC586]
          Length = 309

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 38/270 (14%), Positives = 86/270 (31%), Gaps = 6/270 (2%)

Query: 6   CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDV 65
             V       +     +     A +++   LLS+ P +    ++         V  VI  
Sbjct: 13  RQVVHFGRYLLIRMNHDRVNVNAGYLAYITLLSMVPMLTVLLSILSSFSIFANVGDVIQD 72

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
                    A  +    L         +  +        +   +  +  +LN  +RV   
Sbjct: 73  FVITHFVPAAGEVVKTTLMEFVANTGKMTAVGGAFLFVAAIMLISNIDKNLNYIWRVQRK 132

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R    +  + +  + L  + +         I                L         +  
Sbjct: 133 RRAVFSFSMYWMILTLGPILVGASIAATSYITSL------KILDNEALSGAYNLFLRWLP 186

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
            +  +   + ++L +P  K  +   + G +   + + +    F  YI  F +Y  +Y  L
Sbjct: 187 FVLSYCAFVGLYLLVPNKKVHLNHAMAGALIAAVLFELSKKGFAAYITQFPSYQLIYGAL 246

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           A+I    V++Y+  +  ++GAE+ A++   
Sbjct: 247 AAIPILFVWVYLCWLIVLVGAEVTAALGER 276


>gi|260466711|ref|ZP_05812898.1| ribonuclease BN [Mesorhizobium opportunistum WSM2075]
 gi|259029574|gb|EEW30863.1| ribonuclease BN [Mesorhizobium opportunistum WSM2075]
          Length = 283

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 120/279 (43%), Positives = 168/279 (60%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M      +  ++YDAI HF  +DGWAMASH+++++L+++FPF++F   L  FLGA  F  
Sbjct: 1   MLRNIVALRRVLYDAIGHFNTDDGWAMASHLAITSLMALFPFLIFATTLGSFLGAQAFAD 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T + +VF  WP+ IAKPI  E+L VL V    L T   L AAYF+SNG+EALR SLNRAY
Sbjct: 61  TAVHLVFDTWPDQIAKPIAHEVLNVLTVRRTDLLTYGVLLAAYFASNGIEALRTSLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R     R+ S  +VL+A+   + +S + V  PL        F  +      I   
Sbjct: 121 RVTETRGIIYRRVQSIFFVLIATAGFLAISVLLVFAPLLARLAEAHFEWIKPYTGTITLW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R       +  GL  VH +LPA K + +S++PG+IFT  +W++G+ +F  Y+  FS+Y T
Sbjct: 181 RYVIASAVIIGGLFAVHYWLPAGKRRFVSLVPGIIFTLAAWLIGSTIFATYLDHFSSYVT 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            YAGLASIM  +VFLY++   FILG ELNA++  Y   +
Sbjct: 241 TYAGLASIMIAVVFLYIVSAIFILGGELNAAISRYLEAR 279


>gi|332558089|ref|ZP_08412411.1| Ribonuclease BN family protein [Rhodobacter sphaeroides WS8N]
 gi|332275801|gb|EGJ21116.1| Ribonuclease BN family protein [Rhodobacter sphaeroides WS8N]
          Length = 322

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 57/273 (20%), Positives = 120/273 (43%), Gaps = 8/273 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           DI         E+    +A+ ++   LL++FP +    +L G       +    + + G 
Sbjct: 28  DIALRVWRSIDEDRVMLVAAGVTFYLLLALFPALAAFVSLYGLFADPAVIAEQAESLRGV 87

Query: 70  WPEVIAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
            P      +T+++  + +  +  L     +S L A + +++G++AL  ++N A+   E R
Sbjct: 88  IPAEGLDLLTEQLRTLASGESSSLTFSFVLSFLIAFWSANSGMKALIEAMNIAHEEREKR 147

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
           S+    L+SF   L A V  V M    +     +  V   F        ++W  R    +
Sbjct: 148 SFVKLTLLSFALTLGAMVLAVTM----IVAVAVVPAVLAVFDLGSVATAVVWLVRWPLLL 203

Query: 187 LALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           L +   +  ++ + P+  +     +  G     + W++ ++ FT Y+  F+ YS  Y  L
Sbjct: 204 LLVATAMAGLYRWAPSRNAPEWRWVTWGSGLATLVWLIASIAFTIYLENFANYSATYGSL 263

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
            +++  L+++++  +  I+GAE+N+ M     R
Sbjct: 264 GALVGLLLWVWIAVMILIVGAEVNSEMEHQTAR 296


>gi|170695903|ref|ZP_02887043.1| ribonuclease BN [Burkholderia graminis C4D1M]
 gi|170139201|gb|EDT07389.1| ribonuclease BN [Burkholderia graminis C4D1M]
          Length = 437

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 38/273 (13%), Positives = 98/273 (35%), Gaps = 5/273 (1%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQ-FVPTVI 63
              +  +   A +   E+    +A  ++ + +L++ P       L         F  ++ 
Sbjct: 9   LDTLKRLAQFAAKRSSEDRIAQVAGSLTFTTMLALVPLATVAFALFTAFPLFSSFQESLQ 68

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +              + L   A  AKGL TI  +         +  +  + N  +RV 
Sbjct: 69  FFLADHLMPAQLNSQIFKYLNQFASKAKGLTTIGMVLLFLTGVMTMMTIESAFNVIWRVR 128

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           + R      L+ +  + L  + + +   +   +          F A   +  +I      
Sbjct: 129 KARPIAQRILVYWAIITLGPILIGVSLSISSYLFTQSM----TFSAAQRMTPVIEFALAG 184

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
           A +    +    ++++LP  + +    + G +   I++ +    F +Y+    TY+ +Y 
Sbjct: 185 AALPLTALAFTILYVYLPNCRVEWRDAVIGGLTAAIAFELAKRGFGYYVRRMPTYTAVYG 244

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
             +++   L+++Y+     + GA + +++    
Sbjct: 245 AFSAVPLFLLWMYLCWFITLAGAMIASALPAIR 277


>gi|89054703|ref|YP_510154.1| ribonuclease BN, putative [Jannaschia sp. CCS1]
 gi|88864252|gb|ABD55129.1| ribonuclease BN putative [Jannaschia sp. CCS1]
          Length = 307

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 55/266 (20%), Positives = 102/266 (38%), Gaps = 8/266 (3%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
              +   E+    + + ++   LL++FP I     + G       +   +  +FG  P+ 
Sbjct: 16  RLRDDIAEDRVCLIVAGVAFYGLLALFPNITALIAVNGLPVEPSAIVDQLRSLFGVVPQE 75

Query: 74  IAKPITDEILQVLAVPAKGLF---TISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
           +   ITD+   +      G         L A Y +S G+ +L   +N AY   E R +  
Sbjct: 76  LIAIITDQATAIAGSREDGFGLAVVTGVLVALYSASKGMSSLMEGINIAYDEHEKRGFIR 135

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
            +L +F   +   + LVI     +  P AL          G +  +I  G   A  +   
Sbjct: 136 LKLATFAQTIFLILGLVITLLAMLGRPAALGIAD----LGGVVEPLISIGLFLALPVLTM 191

Query: 191 IGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           +GL  ++ + P+           G I   +  +  +  F  Y+  F +Y+     LA  +
Sbjct: 192 LGLSVLYPYAPSRDEPEWKWASLGRIERCLLRLAASAGFPFYVSNFGSYNDGIGALAGDI 251

Query: 250 TCLVFLYMLGVFFILGAELNASMIIY 275
             L + ++     + GAELNA +  +
Sbjct: 252 VVLTWFWISAFIILKGAELNAELEAH 277


>gi|13473007|ref|NP_104574.1| hypothetical protein mll3481 [Mesorhizobium loti MAFF303099]
 gi|14023755|dbj|BAB50360.1| mll3481 [Mesorhizobium loti MAFF303099]
          Length = 310

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 117/277 (42%), Positives = 167/277 (60%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV 62
                +  ++YDA+ HF  +DGWAMASH+++++L+++FPF++F   L  FLGA  F  T 
Sbjct: 30  RNIVALRRVLYDALGHFNTDDGWAMASHLAITSLMALFPFLIFATTLGSFLGAQAFADTA 89

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
           + +VF  WP+ IAKPI  E+L VL V    L T   L AAYF+SNG+EALR SLNRAYRV
Sbjct: 90  VHLVFDTWPDQIAKPIAHEVLNVLTVRRTDLLTYGVLLAAYFASNGIEALRTSLNRAYRV 149

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E R     R+ S  +VL+A+   + +S + V  PL        F  +      I   R 
Sbjct: 150 TETRGIIYRRVQSIFFVLIATAGFLAISVLLVFAPLLARLAEAHFEWIKPYTGTITLWRY 209

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
                 +  GL  VH +LPA K + +S++PG++FT  +W++G+ +F  Y+  FS+Y T Y
Sbjct: 210 VIASAVIIGGLFAVHYWLPAGKRRFVSLVPGIVFTLAAWLIGSTMFATYLDHFSSYVTTY 269

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           AGLASIM  +VFLY++   FILG ELNA++  Y   +
Sbjct: 270 AGLASIMIAVVFLYIVSAIFILGGELNAAISRYLEAR 306


>gi|319781313|ref|YP_004140789.1| ribonuclease BN [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167201|gb|ADV10739.1| ribonuclease BN [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 283

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 119/279 (42%), Positives = 169/279 (60%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           M      +  ++YDA+ HF  +DGWAMASH+++++L+++FPF++F   LA FLGA  F  
Sbjct: 1   MLRKIVALKRVLYDALGHFNTDDGWAMASHLAITSLMALFPFLIFATTLASFLGAQAFSD 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           T + +VF  WPE IAKPI  E+L VL V    L T   + AAYF+SNG+EALR SLNRAY
Sbjct: 61  TAVHLVFDTWPEQIAKPIAREVLNVLTVRRTDLLTYGVVLAAYFASNGIEALRTSLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RV E R     R+ S  +VL+A+   + +S + V  PL           +   +  I   
Sbjct: 121 RVSETRGIIYRRVQSIIFVLIATAGFLAISVLLVFAPLLARLAEAHIDWIKPYMGTITLW 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           R       +  GL  VH +LPA K + +S++PG++FT  +W++G+ +F  Y+  FS+Y T
Sbjct: 181 RYVIASAVIVGGLFAVHFWLPAGKRRFVSLVPGIVFTLAAWLIGSTIFATYLDHFSSYVT 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            YAGLASIM  +VFLYM+   FILG ELNA++  Y   +
Sbjct: 241 TYAGLASIMIAVVFLYMVSAIFILGGELNAAISRYLEAR 279


>gi|90581077|ref|ZP_01236877.1| ribonuclease BN [Vibrio angustum S14]
 gi|90437773|gb|EAS62964.1| ribonuclease BN [Vibrio angustum S14]
          Length = 303

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 46/266 (17%), Positives = 92/266 (34%), Gaps = 6/266 (2%)

Query: 10  DIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGA 69
           D     I+    +     A  ++   LLS+ P I    +    +     +   +      
Sbjct: 15  DYFSYLIQRVNHDRLTVTAGSMAYVTLLSLVPLITVVISALSAVPVFAGLGEQLQNFVIE 74

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
                A  +    L      A  +  +   A    +   + ++  SLN  +R+ + R W 
Sbjct: 75  NFVPAAGAVVKTYLNEFVSNAGKMTAVGIAALFVVAMMLISSIDTSLNYIWRIKKKRRWV 134

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
           I+  I +  + L  + L     V   +        +          ++     +   L  
Sbjct: 135 ISFSIYWMILTLGPILLGSSIAVSSYLGSLALLEHQALHG------LLQQSLRWFPSLMS 188

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
            +  + ++L +P  K      L G +   I + +    F  Y+  F +Y  +Y  LA+I 
Sbjct: 189 SLAFLLLYLLVPNCKVTFRHALIGSLSASILFELSKKGFAIYLAHFHSYQMIYGALAAIP 248

Query: 250 TCLVFLYMLGVFFILGAELNASMIIY 275
              V++Y+     +LGAE+ AS+   
Sbjct: 249 ILFVWIYLCWCIVLLGAEITASLGER 274


>gi|300774226|ref|ZP_07084093.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33861]
 gi|300758905|gb|EFK55734.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 322

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 58/268 (21%), Positives = 116/268 (43%), Gaps = 2/268 (0%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           ++ +     +    E     AS ++ + LL++FP I+F   +  ++    F   +++ + 
Sbjct: 34  LYTVGIFFFQEIARESILNKASSLAYNFLLAMFPAIIFLFTMIPYIPIDNFQEQLLEFLK 93

Query: 68  GAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRS 127
              P      I   +  ++     GL +   + AA+FS+NG+  L ++ N+A    E RS
Sbjct: 94  VIIPHNAFDVIQTTLEDIIKNQNGGLLSFGFVLAAFFSTNGMHTLMLAFNKASLTTENRS 153

Query: 128 WYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLL--IIWNGRIYAT 185
           W   RL++        V L +   +F    + + Y++       +     II   R    
Sbjct: 154 WIRQRLVALALSFTIIVALTVGMGIFTFAGIVINYLKSNISVDVSWFWTFIIKAARWIIL 213

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
               F  +  ++ F PA+  K     PG     I  ++    F +YI  F  Y+ +Y  +
Sbjct: 214 FGIYFFTVSCLYKFGPASNQKWKLFSPGATLATILAILTFSGFAYYINHFGAYNKLYGSI 273

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMI 273
            +I+  ++++Y+  +  ++G ELNAS+ 
Sbjct: 274 GTIIVIMIWMYLNSLILLVGYELNASIA 301


>gi|254488995|ref|ZP_05102200.1| YihY family protein [Roseobacter sp. GAI101]
 gi|214045864|gb|EEB86502.1| YihY family protein [Roseobacter sp. GAI101]
          Length = 316

 Score =  137 bits (344), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 87/267 (32%), Positives = 147/267 (55%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV 62
           + +   + ++ +A      +D + +A +++   LL+VFPF++F +++  F+G+      +
Sbjct: 31  KGWRGAWGVMREAGLRLWSDDAFGLAGNVAFRVLLAVFPFLIFTSSMTAFVGSQSMAEDL 90

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
           +  +    PE + +PI  E+ QV+ V   G+ +   L   +F+  GV+ +R+ LNRAY V
Sbjct: 91  VSFLLAIVPETLIEPIVSEVKQVMTVQRGGVLSTGILLTIWFALGGVDGVRVGLNRAYGV 150

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            E RSWY+   +    V++AS+ LV++ ++ V  P A +++   FP      + I   R 
Sbjct: 151 RETRSWYVVYPVMVLMVIIASLVLVLVGYLLVLAPRAGSWLHVLFPGFDPASVTIRLVRY 210

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
            A  + L   L   H+FLPA +++  SI PGV+FT  +W    V FT Y+  F+TY+T Y
Sbjct: 211 PAAAIILVFSLFLAHVFLPARRTRFSSIYPGVLFTVAAWTSLTVAFTFYLANFATYATYY 270

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELN 269
            GLA I+  L FLY+  +  I G ELN
Sbjct: 271 GGLAGIVAALYFLYLAALVLIFGGELN 297


>gi|163790741|ref|ZP_02185168.1| ribonuclease BN, putative [Carnobacterium sp. AT7]
 gi|159874042|gb|EDP68119.1| ribonuclease BN, putative [Carnobacterium sp. AT7]
          Length = 313

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 68/263 (25%), Positives = 126/263 (47%), Gaps = 2/263 (0%)

Query: 15  AIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEVI 74
            ++ + E + W   + IS   LLS+FP IV   N+  +         ++  +  A P   
Sbjct: 28  VVQKYREAEVWNSGAIISYYFLLSIFPVIVVIGNVLPYFRLDAA--ELLPYIENAVPNYF 85

Query: 75  AKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITRLI 134
              + D +       + G+ +I+ + A + +S G+ A+++S+N+AY V   R+  I RL 
Sbjct: 86  FDQVEDVLTSWFTRSSGGILSIAVIGALWSASRGMTAMQVSMNKAYGVEPRRNIVIIRLF 145

Query: 135 SFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIGLI 194
           S     L  V+++++  VF    L L Y+         +     + R   TM+ LFI   
Sbjct: 146 SLILTTLLIVSIMLLVIVFGFGQLILEYITPIIDIPLTISETFQSLRWPVTMIVLFIIFC 205

Query: 195 FVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVF 254
            ++ F+P AK    S+LPG  F+ I W++ + +F  Y+  F+  +  Y  + + M  L++
Sbjct: 206 LLYYFVPHAKIAFKSVLPGAAFSTIGWMLVSQVFAVYVEYFAIGTKSYGTIGTFMIMLIW 265

Query: 255 LYMLGVFFILGAELNASMIIYYW 277
           L ++G     GA +NA++ +Y  
Sbjct: 266 LQVIGALMTAGAVINAAIDVYQN 288


>gi|317495128|ref|ZP_07953498.1| ribonuclease BN family protein [Gemella moribillum M424]
 gi|316914550|gb|EFV36026.1| ribonuclease BN family protein [Gemella moribillum M424]
          Length = 301

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 65/274 (23%), Positives = 130/274 (47%), Gaps = 3/274 (1%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVF 67
           +   + +     + ++   +++++S   +LSVFP ++    L  +    Q    ++  + 
Sbjct: 21  IKKFVKEMYYRIMYDEISLLSANLSYYFILSVFPMLIVALALTPYFKIDQ--QFLLAKIQ 78

Query: 68  GAWPEVIAKPITDEILQVLAVPAK-GLFTISALAAAYFSSNGVEALRISLNRAYRVVEMR 126
              P  +   + + I +VL       + TI  +   + +SNG+  + I+ N A+RV + R
Sbjct: 79  TFAPGALGDYLFNMISEVLNSKNNNTIITIGVVFTLWSASNGIYGIIIAFNNAFRVRDGR 138

Query: 127 SWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATM 186
            W +T++IS  + +L  + + ++  + V        +   F        +         +
Sbjct: 139 IWIVTKIISIIFTVLFLIGMFLVLALVVFGKQLTYLLFHKFNLDEGFYTMWSYLSYSFPI 198

Query: 187 LALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLA 246
           L  FI  +F+++  P  K K +SILPG +F+ ISW + + LF +YI  FS+Y   Y  + 
Sbjct: 199 LFTFIVFVFLYILGPNLKLKSISILPGAVFSTISWTLVSRLFGYYIDHFSSYIKTYGTIG 258

Query: 247 SIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           ++M  +++LY+ G   I+GAE+NA    Y    +
Sbjct: 259 ALMAFIIWLYITGYILIIGAEINAIFHNYKIEHR 292


>gi|195977831|ref|YP_002123075.1| methionine aminopeptidase Map [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|195974536|gb|ACG62062.1| methionine aminopeptidase Map [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
          Length = 599

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 59/287 (20%), Positives = 119/287 (41%), Gaps = 10/287 (3%)

Query: 1   MREYF-----CIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA 55
           ++++         ++ I   + HF   +    A  ++   +L+ FP IV  AN+  +L  
Sbjct: 290 IKKFLDKVISKWQYEPIQAFMRHFQSAEMDLSAIAVAYYLILTAFPLIVIAANIFPYLNI 349

Query: 56  HQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRIS 115
              +  ++ ++    P+ I +  +  ++ + + P+ G+  I+ L   +  S  + +L+ +
Sbjct: 350 D--ISDLLRLMKEQLPKDIYRSASSIVVNIFSKPSGGVLGIATLTGLWTMSRSLASLQKA 407

Query: 116 LNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLL 175
            N+AY   E R + +  L+     LL    L            A+  + + +    N+  
Sbjct: 408 FNKAYDASEHRDFLLGHLVGLLTSLLILFLLTFALIFSTFSKAAIQVLDRHYHLNDNITT 467

Query: 176 IIWNGRIYATMLALFIGLIFVHLFLPAAKS-KIMSILPGVIFTWISWVVGAVLFTHYIVT 234
           +        T+L +FIGL+ ++  LP  K  KI  ILPG  FT    +  + +  +Y+V 
Sbjct: 468 LFLFLIQPITILIIFIGLMLLYFLLPNIKIKKIRYILPGTFFTTFVMIFLSNMVGNYVVH 527

Query: 235 FSTYSTMYAGLASIMTC--LVFLYMLGVFFILGAELNASMIIYYWRK 279
                       S+M    +++   L    I+GA  NA+       K
Sbjct: 528 NVERMVDIKTFGSVMVFIIMLWFIFLARILIMGAVFNATYQELSIGK 574


>gi|323494559|ref|ZP_08099663.1| hypothetical protein VIBR0546_13332 [Vibrio brasiliensis LMG 20546]
 gi|323311162|gb|EGA64322.1| hypothetical protein VIBR0546_13332 [Vibrio brasiliensis LMG 20546]
          Length = 304

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/272 (14%), Positives = 93/272 (34%), Gaps = 8/272 (2%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT-VIDVVFGA 69
                +     +     A +++   LLS+ P +    ++       +     + D V   
Sbjct: 13  FARYLLTRMGHDRVNVNAGYLAYITLLSIVPMLTVLLSVLSSFAIFENAGDAIQDFVITH 72

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           +       +   +L+ +A     +  +        +   +  +  +LN  +RV   R   
Sbjct: 73  FVPAAGDAVKGALLEFVAN-TGKMSAVGGAFLFVAALMLISNIDKNLNYIWRVKHKRRAV 131

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
            +  + +  + L  + +         +                +  +      +   L  
Sbjct: 132 FSFSMYWMVLTLGPILVGASIAATSYVTSL------KILESEAISGLYNQLLRWLPFLLS 185

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           F   + ++L +P  K +I   + G I   + +      F  YI  F +Y  +Y  LA+I 
Sbjct: 186 FFAFVGLYLLVPNKKVRISHAMVGAIIAALLFEASKKGFAAYITQFPSYQLIYGALAAIP 245

Query: 250 TCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
              V++Y+  +  ++GAE+ A++       +P
Sbjct: 246 ILFVWVYLCWLIVLVGAEVTAALGEREQWSEP 277


>gi|265750543|ref|ZP_06086606.1| ribonuclease BN [Bacteroides sp. 3_1_33FAA]
 gi|263237439|gb|EEZ22889.1| ribonuclease BN [Bacteroides sp. 3_1_33FAA]
          Length = 439

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/276 (14%), Positives = 90/276 (32%), Gaps = 4/276 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R        I   +I  F +      AS ++ S LLS+ P +     +A   G    + T
Sbjct: 29  RGILYNAIKIATLSIREFTQGRILNKASALTYSTLLSIIPILAILFAIARGFGFSNLLET 88

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
                           +      ++   +     +  +   +   +    +  + N  ++
Sbjct: 89  QFRSGLEGQSAAAETILGLIDSYLVHAKSGVFIGVGLVMLFWTILSLTYNIERTFNYIWQ 148

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V + R+ Y      F  +LL  + +V+ S + + +   +            L  ++    
Sbjct: 149 VKKPRTLYRKMTDYFSILLLLPLLIVLSSGLTIFMSTMVK----NMEDFVLLAPLMKFLV 204

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                +  +     + +F+P  K K+   +   I    ++     L+    +  S Y+ +
Sbjct: 205 RLVPFILTWAMFTGLFVFMPNTKVKLRYAIIPGIIAGTAFQAFQYLYIGSQIWVSRYNAI 264

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
           Y   A+I   L++  +     + GAEL         
Sbjct: 265 YGSFAAIPMFLLWAQISWGICLYGAELCYVAQNLRN 300


>gi|116334154|ref|YP_795681.1| ribonuclease BN-like family protein [Lactobacillus brevis ATCC 367]
 gi|116099501|gb|ABJ64650.1| Ribonuclease BN-like family enzyme [Lactobacillus brevis ATCC 367]
          Length = 303

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 58/272 (21%), Positives = 124/272 (45%), Gaps = 2/272 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R+    +  +I    +H+   +    A  ++   LLS+FP ++  A+L  +L       T
Sbjct: 6   RKRASQIKHVIQTISKHYQMANVSDSAVVLAYYTLLSLFPALLVIASLLPYLNIQ--TET 63

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           V++ +    PE I   +   I   L   + G+ +I  + A + SS  V A + ++N AY 
Sbjct: 64  VLESIEPMVPESIFSMLKPIIHSFLNTRSGGVLSIGVIVALWSSSRAVAAFQRTVNGAYG 123

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V + ++  + R+++F +++     L ++   F    + L  +  +      ++  I   +
Sbjct: 124 VAKNQNALVNRIVAFFWMVALIAFLFVLMLFFSFGQIILEQLAPYLHVPHEIIGYINAAK 183

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
              T L + + L+ +  F+P+AK K   + PG +   + W++ +  F+ Y+  F      
Sbjct: 184 WPVTFLVVLLVLMILLYFVPSAKLKWRFVWPGALTATVGWLLLSQAFSLYVKYFVHNMDS 243

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMI 273
           Y  + + +  + +L   G+  + GA LNA++ 
Sbjct: 244 YRTIGTFIVLMFWLDFTGLILMFGAVLNAAIQ 275


>gi|220935818|ref|YP_002514717.1| ribonuclease BN [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997128|gb|ACL73730.1| ribonuclease BN [Thioalkalivibrio sp. HL-EbGR7]
          Length = 439

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 42/265 (15%), Positives = 96/265 (36%), Gaps = 2/265 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +        I +       E      A  +  + LLS+ P +    ++    GAH  +  
Sbjct: 26  KRPLIGALRIAWGIGREVTEGQLTLRAMSLVYTTLLSMVPLLALSFSVLKAFGAHNQLEP 85

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
           ++  +         +   + I  V  +    L  I  +   Y     V+ +  + N  +R
Sbjct: 86  LLLSLLEPLGPQGVEVAENVIGFVDNMRVGVLGFIGLIFLIYTVIALVQKIESAFNYTWR 145

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           +   R            +L+  V +V    +  +I      V +    +  L   +    
Sbjct: 146 INGTRGLAQRFSNYLSVILVGPVLVVSALGITASIMATS--VMQQAMEVQLLGEAVQLAG 203

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                L +    +FV++F+P  + K++  L G +   + W     +F   +   + Y+ +
Sbjct: 204 RMVPYLLIMGAFMFVYVFVPNTRVKLLPALVGAVVAGLLWQSTGWIFAAMMAGSTRYAAI 263

Query: 242 YAGLASIMTCLVFLYMLGVFFILGA 266
           Y+  A ++  L+++Y+  +  ++GA
Sbjct: 264 YSSFAIMIMLLIWIYLSWLILLIGA 288


>gi|328957860|ref|YP_004375246.1| putative ribonuclease [Carnobacterium sp. 17-4]
 gi|328674184|gb|AEB30230.1| putative ribonuclease [Carnobacterium sp. 17-4]
          Length = 319

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 67/274 (24%), Positives = 130/274 (47%), Gaps = 2/274 (0%)

Query: 4   YFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI 63
              +V       I+ + E + W   + IS   LLS+FP +V  +N+  +L        ++
Sbjct: 17  IIRVVKKFGVILIQKYREAEVWNSGAIISYYLLLSIFPVMVVVSNVLPYLRLDAA--ELL 74

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
             +  A P      + + ++   +  + G+ +I+ + A + SS G+ A+++S+N+AY V 
Sbjct: 75  PYIENAVPTYFFHQLENLLMNWFSKSSGGILSIAVIGALWSSSRGMNAMQVSMNKAYGVE 134

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
             R+  I RL S        + ++++  +F    L L Y+   F     +     + R  
Sbjct: 135 PRRNIVIIRLFSLILTTSLILCIMVLVIIFGFGQLILEYITPVFELPLMISETFQSLRWP 194

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYA 243
            T+  LFI    ++ F+P AK  + S+LPG   + I W++ + +F  Y+  F+  +  Y 
Sbjct: 195 VTVSVLFIIFCVLYYFVPHAKVTLKSVLPGAAISTIGWMLVSQVFAIYVEYFAFGAKTYG 254

Query: 244 GLASIMTCLVFLYMLGVFFILGAELNASMIIYYW 277
            + + M  L++L ++G     GA +NAS+ +Y  
Sbjct: 255 TIGTFMIMLIWLQVIGSLMTAGAVINASIEVYQN 288


>gi|289670867|ref|ZP_06491942.1| ribonuclease BN/unknown domain fusion protein [Xanthomonas
           campestris pv. musacearum NCPPB4381]
          Length = 416

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 41/266 (15%), Positives = 98/266 (36%), Gaps = 8/266 (3%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV-PTVIDVVFGAWP 71
                 F+++  +  A+ ++ + + ++ P  +    +     A       + D +F  + 
Sbjct: 25  RFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLSAFPAFNEWKDALTDFIFNNFV 84

Query: 72  EVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYIT 131
              A+ + + + + L            +A        + ++  + N  +RV   R     
Sbjct: 85  PGAARSVQNYLNRSLED-LGKFTVAGMVALVASLLITLHSIEQTFNSIWRVAAARPKVTR 143

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
            LI +  + L ++       +   +     +       L             A M   F+
Sbjct: 144 FLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTEGQWLAEFAW------RLAPMAVEFV 197

Query: 192 GLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTC 251
            ++ ++  +P    ++   LPG +   I   +    F  Y+  F TY  +Y  L+++   
Sbjct: 198 CIVLIYRVVPQHVVRLRHALPGALLAVILMEIVKWGFGFYLGNFQTYQRIYGALSALPIL 257

Query: 252 LVFLYMLGVFFILGAELNASMIIYYW 277
           L+++Y+  V  +LGA L +SM  + +
Sbjct: 258 LLWIYLSWVSVLLGASLASSMAAFRY 283


>gi|56461547|ref|YP_156828.1| ribonuclease BN [Idiomarina loihiensis L2TR]
 gi|67460627|sp|Q5QV33|Y2447_IDILO RecName: Full=UPF0761 membrane protein IL2447
 gi|56180557|gb|AAV83279.1| Ribonuclease BN [Idiomarina loihiensis L2TR]
          Length = 284

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 44/275 (16%), Positives = 103/275 (37%), Gaps = 6/275 (2%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           + YF      +    + F  ++    A H++  ++LS+ P +V    +         +  
Sbjct: 7   KSYFNHTLGFLKYFGQRFNSDNTNITAGHLTYVSMLSLVPLLVVMFTVFSAFPMFDELKE 66

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
            ++    A     +    +E L      A  +  I        +   + A+  +LN  +R
Sbjct: 67  NLEQALFANLLPTSGEQLEEYLNEFVTNASKMTAIGVGFLFIVAIMLMSAIDKALNSIWR 126

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
               R W ++  + +  + L  V +         +     +  ++   + +         
Sbjct: 127 DSSSRHWLVSFAVYWMLLTLGPVLIGSGLAATSYLMSLSQFADEYVSGIQSF------VL 180

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
            +  ++  F+  + ++  +P  + K      G +   + + +   LF+ YI  F TY  +
Sbjct: 181 WFVPIVTSFVFFVLMYQLVPNRQVKFRYAAFGAVIAALLFELSKQLFSLYITFFPTYQAI 240

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           Y  LA+I   +V++Y+  +  ++GA L  S+  Y 
Sbjct: 241 YGALATIPILIVWIYLSWLIVLIGAVLTVSLEEYQ 275


>gi|330444867|ref|ZP_08308522.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489177|dbj|GAA03019.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 302

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 46/273 (16%), Positives = 94/273 (34%), Gaps = 6/273 (2%)

Query: 3   EYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTV 62
               ++ D     I+    +     A  ++   LLS+ P I    +    +     +   
Sbjct: 8   PRIRLMVDYFTYLIQRVNHDRLTVTAGSMAYVTLLSLVPLITVVISALSAVPVFAGLGEQ 67

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRV 122
           +           A  +    L      A  +  +   A    +   + ++  SLN  +R+
Sbjct: 68  LQNFVIENFVPAAGAVVKTYLNEFVSNAGKMTAVGIAALFVVAMMLISSIDTSLNYIWRI 127

Query: 123 VEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI 182
            + R W I+  I +  + L  + L     V   +        +          ++     
Sbjct: 128 KKKRRWIISFSIYWMILTLGPILLGSSIAVSSYLGSLALLEHQALHG------LLQQSLR 181

Query: 183 YATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMY 242
           +   L   +  + ++L +P  K      L G +   I + +    F  Y+  F +Y  +Y
Sbjct: 182 WFPSLMSSLAFLLLYLLVPNCKVTFRHALIGGLSASILFELSKKGFAIYLAHFHSYQMIY 241

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
             LA+I    V++Y+     +LGAE+ AS+   
Sbjct: 242 GALAAIPILFVWIYLCWCIVLLGAEITASLGER 274


>gi|78358104|ref|YP_389553.1| ribonuclease BN [Desulfovibrio desulfuricans subsp. desulfuricans
           str. G20]
 gi|78220509|gb|ABB39858.1| tRNA-processing RNAse BN [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 473

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 48/275 (17%), Positives = 106/275 (38%), Gaps = 4/275 (1%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           R     V   +Y  +  FV +     AS ++ + +LS+ P +    +++  LG       
Sbjct: 41  RRGILGVLRWLYLVVHGFVADQCLLRASALTYTTVLSIVPTLAVAFSISKGLGIQNT--E 98

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
            I V+           +T  +  V     K L  +  LA      + +  +  + N  + 
Sbjct: 99  FIRVLLMRIAAGREDTVTQILAYVDNTNVKTLGAVGLLALFVTVGSLMGTIEKAFNSIWG 158

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V   R+ +      F   L+  + +       V++      + +    +G +        
Sbjct: 159 VARGRTLWRKFTDFFSVTLVCPIVMAAAFSFSVSLRH--ETLVQKLLNVGIVSYAYVAFL 216

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                L + + L F+++F+P  + +  S L G +   + W +    +  Y +  + Y+ +
Sbjct: 217 KMVPFLMIALMLFFIYVFIPNTRVRFGSALLGGLVAGLLWTLAEGAYVGYQIGAARYNAI 276

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
           Y G A +   L+++Y+  V  +LGAE++ ++    
Sbjct: 277 YGGFAQLPLFLIWVYVTWVIVLLGAEVSFAVQNVR 311


>gi|83949735|ref|ZP_00958468.1| Ribonuclease BN [Roseovarius nubinhibens ISM]
 gi|83837634|gb|EAP76930.1| Ribonuclease BN [Roseovarius nubinhibens ISM]
          Length = 315

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 45/264 (17%), Positives = 112/264 (42%), Gaps = 8/264 (3%)

Query: 14  DAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPEV 73
                    +   +++ ++  ALLS+FP +     + GF G    + +  DV     PE 
Sbjct: 3   RVFGGIDRLNIGLISAGVAFYALLSLFPAVTAMVAIWGFAGDPSKLLSQFDVARQFMPEE 62

Query: 74  IAKPITDEILQVLAVPAKGLFTISAL---AAAYFSSNGVEALRISLNRAYRVVEMRSWYI 130
               + ++I  ++      L   + +    + + + N   AL   LN  YR    ++   
Sbjct: 63  AYLLVQEQITALIVADNTTLQWTTVISLTLSIWSAKNATAALIRGLNSIYREDHRKNPLK 122

Query: 131 TRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALF 190
              ++    ++     ++   + +A+P+ALA++         + + +   +    M  + 
Sbjct: 123 RYGVAVALTIVMIAAALVAFALVIALPVALAFLN----LGIKVEMFVSAAKWAILMGVVL 178

Query: 191 IGLIFVHLFLPAAK-SKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           +    ++ + P  + + +  + PG +F   +W  G++ F+ Y+  F +++ +Y  L +++
Sbjct: 179 LCFGLLYRYGPNRRGATVSWLSPGALFALATWAAGSIAFSTYLRNFGSFNEVYGSLGALV 238

Query: 250 TCLVFLYMLGVFFILGAELNASMI 273
             L + Y+     ++GA +NA + 
Sbjct: 239 ALLFWFYISAYVVLIGALINAELE 262


>gi|260913449|ref|ZP_05919927.1| tRNA-processing ribonuclease BN [Pasteurella dagmatis ATCC 43325]
 gi|260632389|gb|EEX50562.1| tRNA-processing ribonuclease BN [Pasteurella dagmatis ATCC 43325]
          Length = 316

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/281 (14%), Positives = 101/281 (35%), Gaps = 10/281 (3%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV- 59
           M   F             F +      A +++ S +L++ P ++   ++         V 
Sbjct: 1   MNNIFKNTLLFSKLFWLRFQQNKLSQAAGYLTYSTMLALVPLVMVVFSVFSAFPVFNEVT 60

Query: 60  PTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRA 119
             +   +F  +    +  +   I + ++  +K +  +  ++    +   + ++  +LN  
Sbjct: 61  GELKGFIFDNFAPQASDMVGQYIDEFVSN-SKQMSAVGVISLVVVALMLINSIDRTLNSI 119

Query: 120 YRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWN 179
           +    +R    +  I +  + L  + +     V   I   L         L         
Sbjct: 120 WHDTTIRPLVFSFAIYWLILTLGPLLIGASIGVSSYIATMLNENISLPFGLK-------- 171

Query: 180 GRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYS 239
              +      ++    ++  +P  K KI     G +   + + +G   F  Y+  F +Y 
Sbjct: 172 LLSFVPFFLTWLIFTLIYSVVPNKKVKITHSAIGALVAAVFFTLGKQAFLWYVTNFPSYQ 231

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
            +Y  +A++   L+++ +  V  ++GA+L + +  Y   KK
Sbjct: 232 LIYGAMATLPIMLLWIQLSWVVILIGAQLASVLADYSLCKK 272


>gi|258624619|ref|ZP_05719555.1| tRNA processing ribonuclease BN [Vibrio mimicus VM603]
 gi|262166747|ref|ZP_06034484.1| ribonuclease BN [Vibrio mimicus VM223]
 gi|258583083|gb|EEW07896.1| tRNA processing ribonuclease BN [Vibrio mimicus VM603]
 gi|262026463|gb|EEY45131.1| ribonuclease BN [Vibrio mimicus VM223]
          Length = 309

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/263 (14%), Positives = 85/263 (32%), Gaps = 6/263 (2%)

Query: 13  YDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVIDVVFGAWPE 72
              +     +     A +++   LLS+ P +    ++            VI         
Sbjct: 20  RYLLTRMKHDRVNVNAGYLAYITLLSMVPMLTVLLSILSSFSIFASAGDVIQDFVITHFV 79

Query: 73  VIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWYITR 132
             A  +    L         +  +        +   +  +  +LN  +RV   R    + 
Sbjct: 80  PAAGEVVKTALVEFVANTGKMTAVGGAFLFVAAIMLISNIDKNLNYIWRVQRKRRAVFSF 139

Query: 133 LISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFIG 192
            + +  + L  + +         I                L         +   +  F  
Sbjct: 140 SMYWMILTLGPILVGASIAATSYITSL------KILDNEALSGAYNLFLRWLPFVLSFCA 193

Query: 193 LIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCL 252
            + ++L +P  K ++   + G +   + + +    F  YI  F +Y  +Y  LA+I    
Sbjct: 194 FVGLYLLVPNKKVRLPHAMAGALIAAVLFELSKKGFAAYITQFPSYQLIYGALAAIPILF 253

Query: 253 VFLYMLGVFFILGAELNASMIIY 275
           V++Y+  +  ++GAE+ A++   
Sbjct: 254 VWVYLCWLIVLVGAEVTAALGER 276


>gi|163851653|ref|YP_001639696.1| ribonuclease BN [Methylobacterium extorquens PA1]
 gi|218530460|ref|YP_002421276.1| ribonuclease BN [Methylobacterium chloromethanicum CM4]
 gi|163663258|gb|ABY30625.1| ribonuclease BN [Methylobacterium extorquens PA1]
 gi|218522763|gb|ACK83348.1| ribonuclease BN [Methylobacterium chloromethanicum CM4]
          Length = 315

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 105/277 (37%), Positives = 161/277 (58%), Gaps = 1/277 (0%)

Query: 4   YFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI 63
            F  + D+   A + FV  DGWA+ASHI+LS L S+FPF++  A LAG +G+        
Sbjct: 18  RFKKILDVTGIAAQRFVAHDGWAIASHIALSMLTSLFPFLILLAALAGLIGSKSLADEAG 77

Query: 64  DVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVV 123
            ++F A P  +AKPI  E+ ++L     G+ T+ AL A YFSS+GVE+LR+ LNRAY + 
Sbjct: 78  TLIFDAVPREVAKPIVGEVHRLLTEQRGGVLTLGALLALYFSSSGVESLRVGLNRAYGIR 137

Query: 124 EMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIY 183
           E R W++TRL S GYV+  ++ ++  + + V  PL    +    P L  L L +  GRI 
Sbjct: 138 EARPWWLTRLESIGYVVCGALAMLAFALLVVLGPLIWRQLVFVAPGLEPLALTVAIGRIG 197

Query: 184 ATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFST-YSTMY 242
            T   + + L+  H F+ A +  ++S+LPG++ T   W +  + F +Y+  FS  Y++ Y
Sbjct: 198 VTAFLIALVLVIAHKFVAAGRRPVLSVLPGIVVTLCLWFLAGLGFGYYLDRFSNAYASTY 257

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
            GLA+ M  LVFLY L   F+ G E+N ++I    ++
Sbjct: 258 GGLATAMIFLVFLYWLAAMFLFGGEINGTVIAARRQR 294


>gi|254992437|ref|ZP_05274627.1| transport protein [Listeria monocytogenes FSL J2-064]
          Length = 239

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 60/236 (25%), Positives = 117/236 (49%), Gaps = 2/236 (0%)

Query: 45  FGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYF 104
             A L  +L   +   +V +++    P+ I   + + +  +L     GL +I  +A  + 
Sbjct: 1   IAATLLAYLHIDK--DSVFNMIKEFAPDQIMDFLEENLNNLLTQKNGGLLSIGIIATLWS 58

Query: 105 SSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVR 164
           +SNG+ A+  SLN+AY V   R++ + RL+S  + L    T+     + V       ++ 
Sbjct: 59  ASNGMNAVMKSLNKAYGVTNKRNYVVQRLLSMFFTLAMLATVGATLLLLVFGQQIGMFLI 118

Query: 165 KFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVG 224
                  + L    N R   T++ +F+   F++   P  +S ++S+LPG +F+ I W V 
Sbjct: 119 NHLNFSEDFLSFWNNLRWTVTLIVIFVVFTFLYWVAPNRRSTLISVLPGALFSTIGWTVA 178

Query: 225 AVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKK 280
           ++ F +Y+  F  YS  Y  +  I+  +++ Y+ G+  ++G ELNA++ I   +K+
Sbjct: 179 SLGFAYYVNNFGNYSATYGSIGVIIILMLWFYLTGIILMIGGELNATLAIRKKKKE 234


>gi|330466829|ref|YP_004404572.1| ribonuclease bn [Verrucosispora maris AB-18-032]
 gi|328809800|gb|AEB43972.1| ribonuclease bn [Verrucosispora maris AB-18-032]
          Length = 326

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 46/283 (16%), Positives = 106/283 (37%), Gaps = 7/283 (2%)

Query: 1   MREYFCIVFD-IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFV 59
           +R+     +  ++  +  +F+ ++    A+ ++   +L++FP  V    L G +   +  
Sbjct: 22  IRQLSWPTWRGVLIRSGRNFLRDNCTDWAAALTYYGVLALFPSTVVVVALVGLVSDGERT 81

Query: 60  PTVIDVVFGAWPEVIAKPITDEILQV-----LAVPAKGLFTISALAAAYFSSNGVEALRI 114
              +  +               +  V         A+ L +     A + +SN + +   
Sbjct: 82  VDTVLDLARGVGAGDVVGNESFVGVVRALVDQNSSARVLLSFGLFGALWSASNFIASFTR 141

Query: 115 SLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL 174
           + N  Y V+E R  +  R +  G   L+ V +  ++   +        V     A G   
Sbjct: 142 ASNAIYGVIEGRPMWRLRPMQIGLAALSLVLIATVAAGLIVSGPVADAVGDLIGAGGAAR 201

Query: 175 LIIWNGRIYATMLALFIGLIFVHLFLPAAKSK-IMSILPGVIFTWISWVVGAVLFTHYIV 233
                 +  A  +   + L  +    P  +      + PG +   ++W++ +  F  Y+ 
Sbjct: 202 TAWAVAKWPALAMIAMLLLSLLFWVAPNVRQPRFRWLTPGGVVALLAWMISSFGFGLYVA 261

Query: 234 TFSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYY 276
            F +Y   Y  L +++  LV+L++     +LG ++NA +    
Sbjct: 262 NFGSYDATYGSLGAVIAFLVWLFLSNSALMLGVQINAELQRGR 304


>gi|134094435|ref|YP_001099510.1| putative ribonuclease BN transmembrane protein [Herminiimonas
           arsenicoxydans]
 gi|133738338|emb|CAL61383.1| Putative ribonuclease BN [Herminiimonas arsenicoxydans]
          Length = 434

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 48/274 (17%), Positives = 106/274 (38%), Gaps = 9/274 (3%)

Query: 8   VFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVI--DV 65
           + ++I  A     EE    +A  ++ +++L++ P +     +             +    
Sbjct: 30  LRNLIRFAARRLDEERLPQVAGSLTFTSVLALVPVLTIALAIFTTFPLFNTFRASLEAYF 89

Query: 66  VFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEM 125
           V    P+ IA  I   + Q  +  A  L  + A+A    +   +  +    N+ +RV   
Sbjct: 90  VQNLMPQGIANTILGYLTQF-STKATRLSAVGAVALIVTAVMMMLMIDRVFNQIWRVKTK 148

Query: 126 RSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYAT 185
           R      LI +  V L  + +     +   +  A     +  P  G +           +
Sbjct: 149 RPIMQRILIYWAIVTLGPLLIGASMTLTSYLFTATNGAVRDIPFFGGV------LYSSIS 202

Query: 186 MLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGL 245
           +L   +    +++ +P    +    L G +   I++ V   LF  ++V   TY+ +Y  +
Sbjct: 203 ILLTTVAFTSLYIVVPNRFVEWRDALCGGLLAAIAFEVVKRLFAIFVVKVPTYTVVYGAV 262

Query: 246 ASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           A+    LV++Y+  +  + GA + A++ I  + +
Sbjct: 263 AAFPIFLVWIYLGWLITLGGAVVTAALPIVKYER 296


>gi|91224961|ref|ZP_01260220.1| ribonuclease BN [Vibrio alginolyticus 12G01]
 gi|254228544|ref|ZP_04921969.1| tRNA-processing ribonuclease BN [Vibrio sp. Ex25]
 gi|262392674|ref|YP_003284528.1| ribonuclease BN [Vibrio sp. Ex25]
 gi|91190207|gb|EAS76477.1| ribonuclease BN [Vibrio alginolyticus 12G01]
 gi|151938926|gb|EDN57759.1| tRNA-processing ribonuclease BN [Vibrio sp. Ex25]
 gi|262336268|gb|ACY50063.1| ribonuclease BN [Vibrio sp. Ex25]
          Length = 314

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/266 (13%), Positives = 91/266 (34%), Gaps = 8/266 (3%)

Query: 11  IIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID-VVFGA 69
                ++    +     A +++   LLS+ P +    ++         V  V+   +   
Sbjct: 22  FFKYLLKRLTHDRVNVNAGYLAYITLLSIVPMLTVLLSILSKFPVFANVGEVLQGYIIEN 81

Query: 70  WPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYRVVEMRSWY 129
           +     + +   + + +A     +  +        +   +  +  +LN  +RV + R   
Sbjct: 82  FVPASGEAVHTALQEFVAN-TGKMSAVGGGFLFIAAVMLISNIDKNLNYIWRVKDKRRLV 140

Query: 130 ITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLAL 189
            +  + +  + L  + +         +                L         +  +L  
Sbjct: 141 FSFSMYWMVLTLGPIMVGASIAATSYVTSL------QILENETLSGAFNLFLRWLPLLLS 194

Query: 190 FIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIM 249
           F   + +++ +P  K  +     G     I + +    F  YI  F +Y  +Y  LA+I 
Sbjct: 195 FFAFLGLYILVPNKKVHLAHGAMGAAVAAILFELSKKGFALYITQFPSYQLIYGALAAIP 254

Query: 250 TCLVFLYMLGVFFILGAELNASMIIY 275
              V++Y+  +  +LGAE+ A++   
Sbjct: 255 ILFVWVYLCWMIVLLGAEVTAALGER 280


>gi|261856109|ref|YP_003263392.1| ribonuclease BN [Halothiobacillus neapolitanus c2]
 gi|261836578|gb|ACX96345.1| ribonuclease BN [Halothiobacillus neapolitanus c2]
          Length = 472

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 34/278 (12%), Positives = 91/278 (32%), Gaps = 2/278 (0%)

Query: 2   REYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPT 61
           +     +  I         + +    A  +S   LLS+ P +    ++    G+ Q +  
Sbjct: 27  QRIGQRLGRIGLYMSREAFKGNLQLNAMSLSYITLLSLVPLLAVSFSVLKAFGSDQVIEP 86

Query: 62  VIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAYR 121
            +  +               +  V  +    L  +      +     ++ +    N  + 
Sbjct: 87  FLTTLLAPLGSSADGLTAQILTFVGNIKVGVLGAVGIAMLFFTVVTLMQKIESVFNGIWH 146

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
           V ++R       +    +++  V ++  + +     L   +              + +  
Sbjct: 147 VQQLRQITTRFPMYLSVLMVGPVLVLAATGLTA--SLLSNHFVTDITQHSVFRDALASVA 204

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
                +       F++  +P    +  S L G +   I W    + F   I + + Y+ +
Sbjct: 205 WLVPFMVWVAVFTFIYALVPNTSVRFSSALAGGVVAAILWNGIGLAFGSMIASSTQYTAI 264

Query: 242 YAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRK 279
           Y+  AS++  +V+L +  +  +LGA ++ +       +
Sbjct: 265 YSAFASLILFMVWLQLAWLIVLLGATVSYAWQNIDQLR 302


>gi|190894365|ref|YP_001984658.1| putative ribonuclease [Rhizobium etli CIAT 652]
 gi|190700026|gb|ACE94108.1| putative ribonuclease protein [Rhizobium etli CIAT 652]
          Length = 358

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 59/277 (21%), Positives = 120/277 (43%), Gaps = 6/277 (2%)

Query: 5   FCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVPTVID 64
              + D+ +      +++    +A+ ++   LL++FP +    +L G +     +   + 
Sbjct: 59  LSGLRDVFWRVYHEVLDDRITLIAAGVTFYLLLALFPALAALVSLYGLVADPVTISEHLR 118

Query: 65  VVFGAWPEVIAKPITDEILQVLAVPAKGLFTI---SALAAAYFSSNGVEALRISLNRAYR 121
            + G  P      I D+I  ++      L          A + + +G  A+  ++N AY 
Sbjct: 119 ELAGLLPPGAFDLIADQIKALVEKRESTLGITFFVGLAIALWSTHSGTLAIFDAMNVAYE 178

Query: 122 VVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGR 181
             E R +    L    + L A V  V+M  +   +P+ L+Y+          LL+ W   
Sbjct: 179 ENEKRGFLRLNLTGLCFTLCAMVFAVVMVVLVGVMPVMLSYLWLDQFKEHLALLLRWPLL 238

Query: 182 IYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTM 241
           ++   +A+ +   F     PA   +I  +  G   T ++W V ++ F+ Y+  F+ Y+  
Sbjct: 239 LFIVAVAVTLVYRFGPSREPA---RIRWMTWGAALTTLAWAVMSIGFSFYLDHFANYNAT 29