RPSBLAST alignment for GI: 254780367 and conserved domain: PRK04214

>gnl|CDD|179791 PRK04214, rbn, ribonuclease BN/unknown domain fusion protein; Reviewed. Length = 412
 Score = 48.2 bits (115), Expect = 2e-06
 Identities = 45/167 (26%), Positives = 73/167 (43%), Gaps = 9/167 (5%)

Query: 115 SLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLL 174
           + NR +RV   R W +TR + +  VL     L+  S  F A   AL  +    P     L
Sbjct: 123 TFNRIWRVNSARPW-LTRFLVYWTVLTLGPLLLGASIAFSAGVFALPLLATTAPQWLAEL 181

Query: 175 LIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVT 234
                    A +    + L  ++  +P     +   LPG + T +   +    F  Y+  
Sbjct: 182 ------ARLAPLAFETVCLTLLYRVVPNHFVPLRHALPGALLTAVLLELVKWGFGFYLGN 235

Query: 235 FSTYSTMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
           F TY  +Y   A++   L+++Y+L V  +LGA L +S+   YWR +P
Sbjct: 236 FQTYQRIYGAFAAVPILLLWIYLLWVLVLLGASLTSSL--SYWRGQP 280