RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780367|ref|YP_003064780.1| ribonuclease protein
[Candidatus Liberibacter asiaticus str. psy62]
         (281 letters)



>1ukg_A Lectin, lectin PAL; mannose, carbohydrate, sugar binding
           protein; HET: MMA; 1.70A {Pterocarpus angolensis} (A:)
          Length = 252

 Score = 28.7 bits (63), Expect = 0.93
 Identities = 12/68 (17%), Positives = 25/68 (36%), Gaps = 2/68 (2%)

Query: 176 IIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTF 235
           + +N       L +         +  + +  + S+LP  +    S   G    TH + ++
Sbjct: 174 VTFNPST--RNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESW 231

Query: 236 STYSTMYA 243
           S  ST+  
Sbjct: 232 SFTSTLLY 239


>2kpm_A Uncharacterized protein; methods development, structural
          genomics, PSI-2, protein structure initiative; NMR
          {Nitrosomonas europaea} (A:)
          Length = 105

 Score = 27.5 bits (61), Expect = 2.0
 Identities = 5/22 (22%), Positives = 10/22 (45%)

Query: 10 DIIYDAIEHFVEEDGWAMASHI 31
            +  A+E   ++ GWA   + 
Sbjct: 24 KFVLAALEQSSDDAGWANLGNF 45


>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, cytoplasm,
           exonuclease, hydrolase, magnesium, metal-binding,
           nonsense- mediated mRNA decay; HET: 7MG GDP; 3.00A {Mus
           musculus} (A:1-435)
          Length = 435

 Score = 26.8 bits (58), Expect = 2.9
 Identities = 7/33 (21%), Positives = 12/33 (36%)

Query: 243 AGLASIMTCLVFLYMLGVFFILGAELNASMIIY 275
           AG  + +T L F+ M      L +     +   
Sbjct: 374 AGYDAYITGLCFISMANYLGSLLSPPKMCVSAR 406


>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit;
           flavoenzyme, electron transfer, folate- methylating
           enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A
           {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A*
           1vrq_A* (A:847-965)
          Length = 119

 Score = 26.3 bits (58), Expect = 4.3
 Identities = 4/28 (14%), Positives = 10/28 (35%)

Query: 157 PLALAYVRKFFPALGNLLLIIWNGRIYA 184
              LA ++     +G +L      ++  
Sbjct: 74  TFGLALIKNGRNRIGEVLKTPVGDQLVD 101


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.333    0.144    0.449 

Gapped
Lambda     K      H
   0.267   0.0361    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 2,220,495
Number of extensions: 94855
Number of successful extensions: 420
Number of sequences better than 10.0: 1
Number of HSP's gapped: 414
Number of HSP's successfully gapped: 54
Length of query: 281
Length of database: 4,956,049
Length adjustment: 87
Effective length of query: 194
Effective length of database: 2,015,014
Effective search space: 390912716
Effective search space used: 390912716
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)
S2: 54 (25.6 bits)