RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780367|ref|YP_003064780.1| ribonuclease protein
[Candidatus Liberibacter asiaticus str. psy62]
         (281 letters)



>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 34.1 bits (78), Expect = 0.032
 Identities = 55/298 (18%), Positives = 90/298 (30%), Gaps = 102/298 (34%)

Query: 16  IEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGA---HQFV---PTVIDVVFGA 69
           +   VE         + L+  L+ F           +L     H          D     
Sbjct: 68  VSSLVEPSKVGQFDQV-LNLCLTEFE--------NCYLEGNDIHALAAKLLQENDTTLVK 118

Query: 70  WPEVI----------AKPITDEILQVL--AVPAKGLFTISALAAAYFSSNG-----VEAL 112
             E+I           +P   +    L  AV  +G   + A+    F   G      E L
Sbjct: 119 TKELIKNYITARIMAKRPFDKKSNSALFRAV-GEGNAQLVAI----FGGQGNTDDYFEEL 173

Query: 113 RISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGN 172
           R  L + Y V+      +  LI F    L+           +   L      K F   G 
Sbjct: 174 R-DLYQTYHVL------VGDLIKFSAETLSE---------LIRTTLD---AEKVFT-QG- 212

Query: 173 LLLIIW-------NGRIYATMLA-------LFIGLI-FVHLFLPAAKSKIMSILPGVIFT 217
           L ++ W         + Y   L        L IG+I   H ++  AK  ++   PG + +
Sbjct: 213 LNILEWLENPSNTPDKDY---LLSIPISCPL-IGVIQLAH-YVVTAK--LLGFTPGELRS 265

Query: 218 WISWVVGAVLFTHY--IVT------FSTYSTMYAGLASIMTCLVFLYMLGVFFILGAE 267
           ++    G     H   +VT        ++ + +  +   +T L        FFI G  
Sbjct: 266 YLKGATG-----HSQGLVTAVAIAETDSWESFFVSVRKAITVL--------FFI-GVR 309



 Score = 31.8 bits (72), Expect = 0.19
 Identities = 39/223 (17%), Positives = 67/223 (30%), Gaps = 68/223 (30%)

Query: 49  LAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVL--AVPAKGLFT--ISALAAAYF 104
           +  FLG   +V     +V     E       D++L +         L    I ALAA   
Sbjct: 61  VGKFLG---YV---SSLV-----EPSKVGQFDQVLNLCLTEFENCYLEGNDIHALAAKLL 109

Query: 105 SSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAI------PL 158
             N       +L +   ++  +++   R      +          S +F A+       +
Sbjct: 110 QEN-----DTTLVKTKELI--KNYITAR-----IMAKRPFDKKSNSALFRAVGEGNAQLV 157

Query: 159 ALAYVRKFFPALGNL------LLIIWNGRIYATMLALFIGLIFVHLF----LPAAKSK-- 206
           A+      F   GN       L  ++    Y  ++   I      L           K  
Sbjct: 158 AI------FGGQGNTDDYFEELRDLYQ--TYHVLVGDLIKFSAETLSELIRTTLDAEKVF 209

Query: 207 -----IMSIL------PGVIFTW---ISW-VVGAVLFTHYIVT 234
                I+  L      P   +     IS  ++G +   HY+VT
Sbjct: 210 TQGLNILEWLENPSNTPDKDYLLSIPISCPLIGVIQLAHYVVT 252



 Score = 30.7 bits (69), Expect = 0.41
 Identities = 55/357 (15%), Positives = 90/357 (25%), Gaps = 169/357 (47%)

Query: 1   MREYFC--------IVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGF 52
           +R Y          +V  +   AI    E D W         A+  +F           F
Sbjct: 263 LRSYLKGATGHSQGLVTAV---AI---AETDSWESFFVSVRKAITVLF-----------F 305

Query: 53  LGA--HQFVP-TVIDVVFGAWPEVIAKPITDEILQVLAVPA-----KGLFTISALAA--- 101
           +G   ++  P T +       P ++     D +     VP+       L T   +     
Sbjct: 306 IGVRCYEAYPNTSL------PPSILE----DSLENNEGVPSPMLSISNL-TQEQVQDYVN 354

Query: 102 ---AYFSSNGVEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVA-IP 157
              ++  +   + + ISL    +                            + V V+  P
Sbjct: 355 KTNSHLPAG--KQVEISLVNGAK----------------------------NLV-VSGPP 383

Query: 158 LAL----AYVRKFFPALGNLLLIIWNGRIYATMLALFIGLIFVHLFLP-----------A 202
            +L      +RK     G     +   RI  +   L     F + FLP            
Sbjct: 384 QSLYGLNLTLRKAKAPSG-----LDQSRIPFSERKL----KFSNRFLPVASPFHSHLLVP 434

Query: 203 AKSKIM---------------------------------SILPGV---IFT----WISWV 222
           A   I                                  SI   +   I      W +  
Sbjct: 435 ASDLINKDLVKNNVSFNAKDIQIPVYDTFDGSDLRVLSGSISERIVDCIIRLPVKWET-- 492

Query: 223 VGAVLF--THYIVTFSTYSTMYAGLASIM------TCLVFLYMLGVFFILGAELNAS 271
                F  TH I+ F       +GL  +       T        GV  I+   L+ +
Sbjct: 493 --TTQFKATH-ILDFGPGGA--SGLGVLTHRNKDGT--------GVRVIVAGTLDIN 536



 Score = 30.3 bits (68), Expect = 0.53
 Identities = 28/171 (16%), Positives = 52/171 (30%), Gaps = 63/171 (36%)

Query: 3   EYFCIVFD---IIYDAIEHFVEEDGWAMASHI-SLSALLSVFPFIVFGANLAGFLGAHQF 58
           +YF    +    +Y      V +     A  +  L         + F     G       
Sbjct: 168 DYF----EELRDLYQTYHVLVGDLIKFSAETLSELIRTTLDAEKV-FT---QGL------ 213

Query: 59  VPTVIDVVFGAW---PEVIAKPITDEILQV-LAVPAKGL-----FTISALA--------A 101
                +++   W   P     P  D +L + ++ P  G+     + ++A           
Sbjct: 214 -----NIL--EWLENPS--NTPDKDYLLSIPISCPLIGVIQLAHYVVTAKLLGFTPGELR 264

Query: 102 AYFS-----SNG-VEALRISLNRAYRVVEMRSWYITRLISFGYVLLASVTL 146
           +Y       S G V A+ I+        E  SW      SF   +  ++T+
Sbjct: 265 SYLKGATGHSQGLVTAVAIA--------ETDSWE-----SFFVSVRKAITV 302


>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty
            acid synthase, acyl-carrier-protein, beta-ketoacyl
            reductase, beta-ketoacyl synthase, dehydratase; 4.00A
            {Saccharomyces cerevisiae}
          Length = 1688

 Score = 31.3 bits (70), Expect = 0.25
 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 20/90 (22%)

Query: 43   IVFGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAA 102
            I+  A+LA  +G    VP     ++G     +A   TD+I + +  P KG+ T    A  
Sbjct: 1187 IIMQADLALKMG----VP-----IYGI--VAMAATATDKIGRSVPAPGKGILTT---ARE 1232

Query: 103  YFSSNGVEALRISLNRAYRVVEMRSWYITR 132
            + SS  V+    +LN  YR  ++    +TR
Sbjct: 1233 HHSS--VKYASPNLNMKYRKRQL----VTR 1256


>3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2,
           initiation factor 2 alpha subunit, initiation factor 2
           beta subunit; 2.80A {Sulfolobus solfataricus} PDB:
           2aho_B
          Length = 266

 Score = 30.2 bits (68), Expect = 0.53
 Identities = 15/83 (18%), Positives = 31/83 (37%), Gaps = 10/83 (12%)

Query: 45  FGANLAGFLGAHQFVPTVIDVVFGAWPEVIAKPITDEILQVLAVPA---KGLFTISALAA 101
           +G  +     A +    ++       PE+  KP+ +E  +          GL T+     
Sbjct: 133 YGDPITAIEKAVKEGEKILIDAG--VPEIWVKPLLEEASKHAEERKVKMSGLITVRT--- 187

Query: 102 AYFSSNGVEALRISLNRAYRVVE 124
                 GVE ++  +++A   +E
Sbjct: 188 --NEPLGVEKIKEVISKALENIE 208


>2kpm_A Uncharacterized protein; methods development, structural
          genomics, PSI-2, protein structure initiative; NMR
          {Nitrosomonas europaea}
          Length = 105

 Score = 29.4 bits (66), Expect = 0.91
 Identities = 5/22 (22%), Positives = 10/22 (45%)

Query: 10 DIIYDAIEHFVEEDGWAMASHI 31
            +  A+E   ++ GWA   + 
Sbjct: 24 KFVLAALEQSSDDAGWANLGNF 45


>1yz7_A Probable translation initiation factor 2 alpha subunit; helical
           domain, alpha-beta domain; 2.26A {Pyrococcus abyssi}
          Length = 188

 Score = 28.6 bits (64), Expect = 1.8
 Identities = 17/65 (26%), Positives = 26/65 (40%), Gaps = 8/65 (12%)

Query: 63  IDVVFGAWPEVIAKPITDEILQVLAVPA---KGLFTISALAAAYFSSNGVEALRISLNRA 119
           IDV+ G  P+     + + I   + VP       F I+         NGVE ++ +L RA
Sbjct: 61  IDVLKGHVPDEWLPVLKEIIDNYVEVPTVTIDAEFEITV-----PKPNGVEIIKEALIRA 115

Query: 120 YRVVE 124
                
Sbjct: 116 RDRAN 120


>2w8a_A Glycine betaine transporter BETP; chemosensor and osmosensor,
           trimer, membrane, cell membrane, membrane protein; 3.35A
           {Corynebacterium glutamicum} PDB: 2wit_A
          Length = 566

 Score = 27.2 bits (60), Expect = 3.8
 Identities = 19/137 (13%), Positives = 41/137 (29%), Gaps = 2/137 (1%)

Query: 143 SVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRI--YATMLALFIGLIFVHLFL 200
           ++  + +++    +         F P +G      W G++     ++A   G        
Sbjct: 169 AIVGLAIAYSTFRVGRKQLLSSAFVPLIGEKGAEGWLGKLIDILAIIATVFGTACSLGLG 228

Query: 201 PAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYSTMYAGLASIMTCLVFLYMLGV 260
                  +S    +       +VG V        FS  S +  G+  +    + L  L  
Sbjct: 229 ALQIGAGLSAANIIEDPSDWTIVGIVSVLTLAFIFSAISGVGKGIQYLSNANMVLAALLA 288

Query: 261 FFILGAELNASMIIYYW 277
            F+       S++    
Sbjct: 289 IFVFVVGPTVSILNLLP 305


>2kzv_A Uncharacterized protein; structural genomics, PSI-2, protein
          structure initiative, no structural genomics
          consortium, NESG; NMR {Chromobacterium violaceum}
          Length = 92

 Score = 27.2 bits (60), Expect = 4.8
 Identities = 8/22 (36%), Positives = 11/22 (50%)

Query: 10 DIIYDAIEHFVEEDGWAMASHI 31
          D+   AIE    + GWA  S +
Sbjct: 11 DMFTSAIEAVARDSGWAELSAV 32


>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion,
           lipidic cubic phase, lipidic, mesophase, cholesterol,
           membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo
           sapiens} PDB: 3d4s_A*
          Length = 500

 Score = 26.8 bits (58), Expect = 6.2
 Identities = 21/159 (13%), Positives = 41/159 (25%), Gaps = 12/159 (7%)

Query: 132 RLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNGRIYATMLALFI 191
           RL +     + S+    +      +P   A++       GN     W       + A   
Sbjct: 70  RLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIE 129

Query: 192 GL------IFVHLFLPAAKSKIMSILPGVIFTWISWVVGA------VLFTHYIVTFSTYS 239
            L       +  +  P     +++     +   + W+V        +    Y  T     
Sbjct: 130 TLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAI 189

Query: 240 TMYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWR 278
             YA            Y +    +        M+  Y R
Sbjct: 190 NCYAEETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSR 228


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.333    0.144    0.449 

Gapped
Lambda     K      H
   0.267   0.0568    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 2,502,385
Number of extensions: 110637
Number of successful extensions: 518
Number of sequences better than 10.0: 1
Number of HSP's gapped: 508
Number of HSP's successfully gapped: 51
Length of query: 281
Length of database: 5,693,230
Length adjustment: 91
Effective length of query: 190
Effective length of database: 3,487,026
Effective search space: 662534940
Effective search space used: 662534940
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)
S2: 56 (25.7 bits)