RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780367|ref|YP_003064780.1| ribonuclease protein [Candidatus Liberibacter asiaticus str. psy62] (281 letters) >d2r6gf1 e.70.1.1 (F:13-260) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]} Length = 248 Score = 26.0 bits (57), Expect = 4.0 Identities = 12/68 (17%), Positives = 28/68 (41%), Gaps = 2/68 (2%) Query: 173 LLLIIWNGRIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYI 232 ++L+ G + L + +++F + PG+ +V+ ++ T I Sbjct: 19 VVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGM-GLFVLFPLVCTIAI 77 Query: 233 VTFSTYST 240 F+ YS+ Sbjct: 78 -AFTNYSS 84 >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Score = 26.0 bits (56), Expect = 4.2 Identities = 6/26 (23%), Positives = 13/26 (50%) Query: 1 MREYFCIVFDIIYDAIEHFVEEDGWA 26 + + I + + I+ F+ E+GW Sbjct: 52 LTQEQLIPNLAMKEVIDAFISENGWV 77 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.333 0.144 0.449 Gapped Lambda K H 0.267 0.0621 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,089,624 Number of extensions: 48520 Number of successful extensions: 194 Number of sequences better than 10.0: 1 Number of HSP's gapped: 192 Number of HSP's successfully gapped: 19 Length of query: 281 Length of database: 2,407,596 Length adjustment: 84 Effective length of query: 197 Effective length of database: 1,254,276 Effective search space: 247092372 Effective search space used: 247092372 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.5 bits) S2: 52 (24.0 bits)