BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780367|ref|YP_003064780.1| ribonuclease protein
[Candidatus Liberibacter asiaticus str. psy62]
         (281 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780367|ref|YP_003064780.1| ribonuclease protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 281

 Score =  558 bits (1437), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 281/281 (100%), Positives = 281/281 (100%)

Query: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60
           MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP
Sbjct: 1   MREYFCIVFDIIYDAIEHFVEEDGWAMASHISLSALLSVFPFIVFGANLAGFLGAHQFVP 60

Query: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120
           TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY
Sbjct: 61  TVIDVVFGAWPEVIAKPITDEILQVLAVPAKGLFTISALAAAYFSSNGVEALRISLNRAY 120

Query: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180
           RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG
Sbjct: 121 RVVEMRSWYITRLISFGYVLLASVTLVIMSFVFVAIPLALAYVRKFFPALGNLLLIIWNG 180

Query: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240
           RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST
Sbjct: 181 RIYATMLALFIGLIFVHLFLPAAKSKIMSILPGVIFTWISWVVGAVLFTHYIVTFSTYST 240

Query: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281
           MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP
Sbjct: 241 MYAGLASIMTCLVFLYMLGVFFILGAELNASMIIYYWRKKP 281


>gi|254780411|ref|YP_003064824.1| prolipoprotein diacylglyceryl transferase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 288

 Score = 25.0 bits (53), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 3/43 (6%)

Query: 5   FCIVFDIIYDAIEHFVEED---GWAMASHISLSALLSVFPFIV 44
           F I + ++   +E F E D   G+ +   +++  +LS+ PF+V
Sbjct: 227 FAICYSVVRFFMEFFREPDYQLGYLLGGWMTMGMILSILPFLV 269


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.333    0.144    0.449 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 164,942
Number of Sequences: 1233
Number of extensions: 6326
Number of successful extensions: 42
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 30
Number of HSP's gapped (non-prelim): 14
length of query: 281
length of database: 328,796
effective HSP length: 73
effective length of query: 208
effective length of database: 238,787
effective search space: 49667696
effective search space used: 49667696
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)
S2: 38 (19.2 bits)