HHsearch alignment for GI: 254780368 and conserved domain: PRK03363

>PRK03363 fixB putative electron transfer flavoprotein FixB; Provisional.
Probab=98.99  E-value=8.6e-08  Score=70.32  Aligned_cols=146  Identities=12%  Similarity=0.115  Sum_probs=104.7

Q ss_pred             EECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCC-CCCHHHHHHHHHHHHHCCCC-
Q ss_conf             3326013689999999985599852899997141015888887850777623763365-47889999999998612686-
Q gi|254780368|r   33 ISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNE-TLEPLSIAKILREIVKKENP-  110 (249)
Q Consensus        33 ~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~-~~D~~~~A~~La~~i~~~~~-  110 (249)
T Consensus         8 wVf~e~~~~~~E-Ll~~Ar~-L~~~v~a~v~~~~~~~----~~~~~GAd~V~~v~~~~~~~~~~~ya~~~~~~i~~~~~~   81 (313)
T PRK03363          8 WVFSDTPSRLPE-LMNGAQA-LANQINAFVLNDADGA----QAIQLGANHVWKLSGKPDDRMIEDYAGVMADTIRQHGAD   81 (313)
T ss_pred             EEEEECCCCHHH-HHHHHHH-HCCEEEEEEECCCCHH----HHHHHCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             999856686899-9999998-6682579996560288----999708989999457622333468999999999975999


Q ss_pred             CEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEECCCCE--EEEEECCC-EEEEEECCCCCCCCCC
Q ss_conf             49999611358886128999999857961332443343286599998358967--99996398-8999843556545469
Q gi|254780368|r  111 IIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGT--MTMETPLP-AVITVDLNLNEPRYIS  187 (249)
Q Consensus       111 DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g~--e~v~~~lP-avisv~~~~n~PR~ps  187 (249)
T Consensus        82 ~ivL~~aT---~~GrdlAprlAarl~~gl~aD~t~l~~~~~~~~~~~~~~gG~~~~~~~~~~~~~~~Tvrpg~f~~~~~~  158 (313)
T PRK03363         82 GLVLLPNT---RRGKLLAAKLGYRLKAAVSNDASTVSVQDGKATVKHMVYGGLAIGEERIATPYAVLTISSGTFDAAQPD  158 (313)
T ss_pred             CEEEECCC---HHHHHHHHHHHHHHCCCCCCCEEEEEECCCCEEEEECCCCHHHEEEEEECCCCEEEEECCCCCCCCCCC
T ss_conf             59998488---217889999999739871546479986599626993335513179999889984999899987877688