HHsearch alignment for GI: 254780368 and conserved domain: PRK11916

>PRK11916 electron transfer flavoprotein subunit YdiR; Provisional.
Probab=99.21  E-value=3.4e-09  Score=79.31  Aligned_cols=145  Identities=13%  Similarity=0.168  Sum_probs=106.2

Q ss_pred             EECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCC-CCHHHHHHHHHHHHHCCCCC
Q ss_conf             33260136899999999855998528999971410158888878507776237633654-78899999999986126864
Q gi|254780368|r   33 ISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNET-LEPLSIAKILREIVKKENPI  111 (249)
Q Consensus        33 ~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~-~D~~~~A~~La~~i~~~~~D  111 (249)
T Consensus         8 wVf~e~~~~~~E-Llg~Ar~-Lg~~v~avv~G~~~a~~----l~~~Gad~V~~~~~~~~~~~~~~y~~~l~~li~~~~P~   81 (312)
T PRK11916          8 WVFSDNPERYAE-LFGGAQQ-WGQQVYAIVQNTDQAQA----VMPYGPKCIYVLEQNDALQRTENYAESIAALLKDKHPA   81 (312)
T ss_pred             EEEEECCCCHHH-HHHHHHH-HCCEEEEEEECCCHHHH----HHHCCCCEEEEEECCHHHCCCHHHHHHHHHHHHHCCCC
T ss_conf             999967888899-9999987-38827999966806999----98619988999516412103068999999999864999


Q ss_pred             EEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEECCCCEE--EEEECC-CEEEEEECCCCCCCCC
Q ss_conf             99996113588861289999998579613324433432865999983589679--999639-8899984355654546
Q gi|254780368|r  112 IVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTM--TMETPL-PAVITVDLNLNEPRYI  186 (249)
Q Consensus       112 LIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g~e--~v~~~l-Pavisv~~~~n~PR~p  186 (249)
T Consensus        82 ~vL~~aT~~---GRdlA~rlAarL~~gl~aD~~~l~~~~~~l~~~r~~~gG~~~~~~~~~~~~~~~tvrpg~~~~~~~  156 (312)
T PRK11916         82 MLLLAATKR---GKALAARLSVQLNAALVNDATAVDIVDGHICAEHRMYGGLAFAQEKINSPLAIITLAPGVQEPCTS  156 (312)
T ss_pred             EEEECCCCC---HHHHHHHHHHHHCCCCCCCEEEEEECCCCEEEEEECCCCEEEEEEEECCCCEEEEECCCCCCCCCC
T ss_conf             999867811---667899999984998254249987169957998411477158998708995799989866666767