HHsearch alignment for GI: 254780368 and conserved domain: cd01985

>cd01985 ETF The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases. ETF transfers electrons to the main respiratory chain via ETF-ubiquinone oxidoreductase. ETF is an heterodimer that consists of an alpha and a beta subunit which binds one molecule of FAD per dimer . A similar system also exists in some bacteria. The homologous pair of proteins (FixA/FixB) are essential for nitrogen fixation. The alpha subunit of ETF is structurally related to the bacterial nitrogen fixation protein fixB which could play a role in a redox process and feed electrons to ferredoxin. The beta subunit protein is distantly related to and forms a heterodimer with the alpha subunit.
Probab=100.00  E-value=3.6e-43  Score=297.80  Aligned_cols=176  Identities=39%  Similarity=0.551  Sum_probs=163.7

Q ss_pred             EEEEEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCC
Q ss_conf             69998603038876059807888163248773326013689999999985599852899997141015888887850777
Q gi|254780368|r    2 KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGAD   81 (249)
Q Consensus         2 ~I~V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD   81 (249)
T Consensus         1 ~IlV~vk~~~d~~~-----------------~v~n~~d~~Ale~A~~lke~--~~~v~~v~~G~~~~~~~l~~~~a~GaD   61 (181)
T cd01985           1 KILVLVEHVPDTAE-----------------LVLNPLDLEAVEAALRLKEY--GGEVTALVIGPPAAEVALREALAMGAD   61 (181)
T ss_pred             CEEEEEEECCCCCC-----------------CCCCCCCHHHHHHHHHHHHC--CCCEEEEEECCCHHHHHHHHHHHCCCC
T ss_conf             98999987799887-----------------44580369999999986444--996899997881689999999772897


Q ss_pred             CCEEEECC--CCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEEC
Q ss_conf             62376336--5478899999999986126864999961135888612899999985796133244334328659999835
Q gi|254780368|r   82 RGILIESN--ETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREV  159 (249)
Q Consensus        82 ~ai~i~d~--~~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~  159 (249)
T Consensus        62 ~v~~v~~~~~~~~~~~~~a~~la~~i~~~~~dlVl~g~~s~---g~~~~~~lA~~L~~~~v~~v~~i~~~~~~~~~~R~~  138 (181)
T cd01985          62 KVLLVEDPALAGYDPEATAKALAALIKKEKPDLILAGATSI---GKQLAPRVAALLGVPQISDVTKLEIDGGDLTVTRPI  138 (181)
T ss_pred             EEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCHH---HCCHHHHHHHHHCCCCCCCEEEEEECCCEEEEEEEE
T ss_conf             89998167445768899999999999860998999604102---225899999985997312379999809969999994


Q ss_pred             CCC--EEEEEEC-CCEEEEEECCCCCCCCCCHHHHHHHHHCCCCEEC
Q ss_conf             896--7999963-9889998435565454698889988521661204
Q gi|254780368|r  160 GHG--TMTMETP-LPAVITVDLNLNEPRYISLPNIIKARKKRIEKKK  203 (249)
Q Consensus       160 e~g--~e~v~~~-lPavisv~~~~n~PR~psl~~im~A~kk~i~~~~  203 (249)
T Consensus       139 ~~g~~~~~v~~~~~P~vitv~~~~~~pr~~~~~~----~~~~I~~~~  181 (181)
T cd01985         139 YAGNGLETVESPDLPAVITVRPGAFEPRYPSGPG----KKKPVEKVS  181 (181)
T ss_pred             ECCCEEEEEEECCCCEEEEEECCCCCCCCCCCCC----CCCCCEEEC
T ss_conf             0697699999799988999858987657788787----886054309