Query         gi|254780368|ref|YP_003064781.1| electron transfer flavoprotein beta subunit [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 249
No_of_seqs    134 out of 1509
Neff          6.2 
Searched_HMMs 39220
Date          Sun May 29 15:31:26 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780368.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK03359 putative electron tra 100.0       0       0  524.0  27.8  243    1-244     1-254 (256)
  2 PRK12342 putative electron tra 100.0       0       0  511.6  29.6  243    1-247     1-254 (254)
  3 COG2086 FixA Electron transfer 100.0       0       0  502.4  28.1  249    1-249     1-260 (260)
  4 cd01714 ETF_beta The electron  100.0       0       0  461.1  23.9  200    2-203     1-202 (202)
  5 KOG3180 consensus              100.0       0       0  420.6  22.5  247    1-247     4-253 (254)
  6 cd01985 ETF The electron trans 100.0 3.6E-43       0  297.8  19.2  176    2-203     1-181 (181)
  7 pfam01012 ETF Electron transfe  99.9 5.1E-24 1.3E-28  174.7  17.4  147   32-183    10-161 (161)
  8 PRK11916 electron transfer fla  99.2 3.4E-09 8.8E-14   79.3  17.1  145   33-186     8-156 (312)
  9 cd01715 ETF_alpha The electron  99.1   1E-08 2.7E-13   76.2  15.8  137   35-183    13-154 (168)
 10 PRK03363 fixB putative electro  99.0 8.6E-08 2.2E-12   70.3  16.4  146   33-187     8-158 (313)
 11 COG2025 FixB Electron transfer  98.9 9.6E-08 2.4E-12   70.0  14.6  140   34-187    13-158 (313)
 12 KOG3954 consensus               97.6  0.0065 1.7E-07   38.9  13.8  142   31-183    30-177 (336)
 13 cd01988 Na_H_Antiporter_C The   96.0   0.027   7E-07   34.9   6.4  104   32-139     5-128 (132)
 14 cd00293 USP_Like Usp: Universa  95.8   0.082 2.1E-06   31.9   8.2   97   36-136     9-121 (130)
 15 PRK11175 universal stress prot  95.2    0.13 3.2E-06   30.7   7.5   98   34-135    11-133 (304)
 16 LOAD_USPA consensus             95.0    0.18 4.5E-06   29.8   7.7  100   34-140     8-132 (135)
 17 cd01987 USP_OKCHK USP domain i  94.9    0.16 4.1E-06   30.0   7.2   78   35-120     8-96  (124)
 18 PRK10116 universal stress prot  93.7    0.38 9.7E-06   27.6   7.0   83   34-120    11-113 (142)
 19 TIGR01278 DPOR_BchB light-inde  91.3     1.2 3.2E-05   24.3   7.4   19   35-53    219-237 (562)
 20 pfam00582 Usp Universal stress  91.0    0.44 1.1E-05   27.2   4.6   97   35-138    11-135 (140)
 21 TIGR02076 pyrH_arch uridylate   90.9     1.4 3.5E-05   24.0   7.7  107   39-147    17-146 (232)
 22 cd01977 Nitrogenase_VFe_alpha   89.5     1.5 3.7E-05   23.8   6.2   20  112-131   165-184 (415)
 23 PRK03675 consensus              89.3     1.8 4.7E-05   23.2  10.8  130    5-140    24-178 (279)
 24 cd01984 AANH_like Adenine nucl  89.1     1.1 2.8E-05   24.6   5.3   63   33-128     5-67  (86)
 25 TIGR02824 quinone_pig3 putativ  87.7     1.3 3.3E-05   24.2   4.9   39   45-88    160-199 (334)
 26 KOG0081 consensus               86.8     1.5 3.9E-05   23.7   4.9   68   70-140    81-159 (219)
 27 PRK07199 phosphoribosylpyropho  86.7     2.6 6.7E-05   22.2  11.1  139    5-153    29-199 (301)
 28 PRK04117 consensus              85.9     2.9 7.4E-05   21.9   8.9  131    5-141    30-189 (309)
 29 COG0503 Apt Adenine/guanine ph  82.3     4.1 0.00011   20.9   7.5   75  100-178    44-124 (179)
 30 TIGR01420 pilT_fam twitching m  80.6     2.8   7E-05   22.1   4.1  106   87-197   178-316 (350)
 31 PRK02304 adenine phosphoribosy  78.1     5.7 0.00014   20.0   7.6   84   82-169    18-106 (174)
 32 PRK02269 ribose-phosphate pyro  77.9     5.7 0.00015   20.0   9.4  132    5-140    32-192 (321)
 33 PRK04554 consensus              77.5     5.9 0.00015   20.0  10.1  132    5-140    33-192 (327)
 34 COG0137 ArgG Argininosuccinate  76.3     6.3 0.00016   19.7   6.2   91   47-140    22-141 (403)
 35 cd01989 STK_N The N-terminal d  74.9     6.9 0.00018   19.5   7.8   81   36-120     9-114 (146)
 36 PRK07206 hypothetical protein;  73.5     7.4 0.00019   19.3   7.4   20   33-53     73-92  (415)
 37 TIGR01036 pyrD_sub2 dihydrooro  73.3     6.9 0.00018   19.5   4.5  106    3-110   223-358 (370)
 38 PRK05370 argininosuccinate syn  72.9     7.7  0.0002   19.2   8.7   94   46-143    28-154 (447)
 39 PRK10643 DNA-binding transcrip  72.4     7.9  0.0002   19.1   5.9   67   35-107    52-118 (222)
 40 TIGR01284 alt_nitrog_alph nitr  72.1     2.3   6E-05   22.5   1.8   32  101-141   398-429 (468)
 41 pfam02698 DUF218 DUF218 domain  71.5     8.3 0.00021   19.0   9.3  107   36-147    12-125 (148)
 42 TIGR01517 ATPase-IIB_Ca calciu  71.4     4.3 0.00011   20.8   3.0   14   93-106   571-584 (885)
 43 TIGR01090 apt adenine phosphor  70.5     8.7 0.00022   18.8   5.4   89   82-174    14-111 (175)
 44 TIGR02845 spore_V_AD stage V s  70.4     3.5   9E-05   21.4   2.4   74   60-142    16-103 (331)
 45 TIGR03568 NeuC_NnaA UDP-N-acet  70.1       7 0.00018   19.4   3.9   84   54-140    27-121 (365)
 46 pfam07355 GRDB Glycine/sarcosi  69.6     9.1 0.00023   18.7   5.9   48   97-144    68-119 (349)
 47 PRK03092 ribose-phosphate pyro  69.3     9.2 0.00023   18.7  10.6  132    5-140    16-176 (304)
 48 PRK01999 consensus              69.2     9.2 0.00024   18.7   9.1  129    5-140    32-189 (311)
 49 PRK09982 universal stress prot  68.6     9.5 0.00024   18.6   8.3   86   35-125    12-118 (142)
 50 TIGR02472 sucr_P_syn_N sucrose  66.5     2.8 7.2E-05   22.0   1.3   90   40-140    30-141 (445)
 51 COG0496 SurE Predicted acid ph  65.5      11 0.00028   18.2   6.7  100   39-147    15-128 (252)
 52 TIGR00032 argG argininosuccina  65.4      11 0.00028   18.2   4.1  192   47-244    17-265 (420)
 53 PRK02270 consensus              64.6      11 0.00029   18.1  10.8  131    5-139    32-188 (327)
 54 pfam02350 Epimerase_2 UDP-N-ac  64.4     9.5 0.00024   18.6   3.6   80   56-140     9-95  (346)
 55 PRK00934 ribose-phosphate pyro  64.2      12 0.00029   18.1   9.8  166    5-182    26-216 (286)
 56 PRK02458 ribose-phosphate pyro  63.5      12  0.0003   18.0   9.4  132    5-140    36-196 (323)
 57 PRK07940 DNA polymerase III su  62.7      10 0.00027   18.3   3.6   46   62-107     7-65  (395)
 58 pfam05636 DUF795 Protein of un  61.8      13 0.00033   17.8   6.6   84   34-123     9-108 (389)
 59 PRK01259 ribose-phosphate pyro  61.7      13 0.00033   17.8   9.2  131    5-141    27-186 (309)
 60 pfam07287 DUF1446 Protein of u  61.5      13 0.00033   17.7   8.6   37   98-138   149-185 (362)
 61 PRK13670 hypothetical protein;  61.3      13 0.00033   17.7   6.5   84   34-123     9-108 (390)
 62 pfam02595 Gly_kinase Glycerate  59.1      14 0.00036   17.5   4.2   44   92-135   109-154 (378)
 63 PRK10336 DNA-binding transcrip  58.1      13 0.00033   17.8   3.4   67   35-107    52-118 (219)
 64 TIGR01919 hisA-trpF bifunction  57.1      12  0.0003   18.0   3.1   55   57-112    77-131 (246)
 65 pfam00764 Arginosuc_synth Argi  56.2      16  0.0004   17.2   9.6   93   46-142    14-135 (389)
 66 cd02809 alpha_hydroxyacid_oxid  55.8      13 0.00032   17.8   3.0   63  183-247   212-283 (299)
 67 PRK10610 chemotaxis regulatory  55.6      16 0.00041   17.1   7.1   14   90-103    61-74  (129)
 68 PRK04262 hypothetical protein;  55.3      16 0.00042   17.1   5.9   91   26-118    34-142 (346)
 69 pfam02585 PIG-L GlcNAc-PI de-N  54.8      17 0.00043   17.0   6.9   68   47-116    19-103 (111)
 70 pfam09370 TIM-br_sig_trns TIM-  54.7      17 0.00043   17.0   4.2   28  111-139    82-109 (268)
 71 TIGR01814 kynureninase kynuren  54.5     9.9 0.00025   18.5   2.3   37   36-74    144-180 (444)
 72 PRK09230 cytosine deaminase; P  54.5      17 0.00043   17.0   4.4   57   23-81    115-178 (426)
 73 TIGR02407 ectoine_ectB diamino  53.6      13 0.00033   17.7   2.8  106   35-142   104-225 (413)
 74 PRK09390 fixJ response regulat  53.5      18 0.00045   16.9   3.8   41   39-81     59-99  (202)
 75 PRK01506 consensus              53.0      18 0.00046   16.8   9.2  168    5-183    36-230 (317)
 76 pfam06032 DUF917 Protein of un  52.9      18 0.00046   16.8   5.5   28  110-139    92-119 (352)
 77 cd01999 Argininosuccinate_Synt  52.5      18 0.00046   16.8  10.1   95   46-143    15-138 (385)
 78 COG0041 PurE Phosphoribosylcar  51.8      19 0.00048   16.7   5.3   81   58-145     4-89  (162)
 79 COG0742 N6-adenine-specific me  51.3      12 0.00032   17.8   2.4   75   54-135    43-137 (187)
 80 COG0604 Qor NADPH:quinone redu  51.2      19 0.00049   16.7   6.4   31  111-144   145-175 (326)
 81 KOG0538 consensus               49.8      20 0.00051   16.5   3.7   61  184-246   264-333 (363)
 82 cd03799 GT1_amsK_like This is   49.7      20 0.00051   16.5   7.8   95   39-144    14-111 (355)
 83 cd02922 FCB2_FMN Flavocytochro  49.6      17 0.00044   16.9   2.9   81   30-115    64-151 (344)
 84 pfam04007 DUF354 Protein of un  49.2      20 0.00052   16.5   3.9  171   48-246    22-212 (335)
 85 PRK01372 ddl D-alanine--D-alan  49.1      21 0.00052   16.4   7.2   13  128-140   125-137 (304)
 86 PRK11197 lldD L-lactate dehydr  48.8      19 0.00049   16.6   3.0   14  233-246   342-355 (381)
 87 cd06259 YdcF-like YdcF-like. Y  48.4      21 0.00054   16.4   7.6   97   37-138    17-120 (150)
 88 pfam00205 TPP_enzyme_M Thiamin  48.0      21 0.00054   16.3   3.6   82  101-183     4-91  (138)
 89 cd00858 GlyRS_anticodon GlyRS   47.8      21 0.00055   16.3   7.9   71   93-168    39-109 (121)
 90 TIGR02915 PEP_resp_reg putativ  47.4      22 0.00056   16.3   5.5  108   41-162    63-175 (451)
 91 PRK02910 light-independent pro  46.5      22 0.00057   16.2   6.0  110   31-141   210-348 (524)
 92 pfam01983 CofC Guanylyl transf  46.5      22 0.00057   16.2   3.6  152    1-198     1-158 (217)
 93 PRK06816 3-oxoacyl-(acyl carri  46.4      23 0.00057   16.2   5.0   78   41-120    66-155 (378)
 94 PRK02039 consensus              46.2      23 0.00058   16.2   7.8  128    5-140    32-191 (316)
 95 pfam00107 ADH_zinc_N Zinc-bind  46.2      23 0.00058   16.2   5.4   61   45-115     5-65  (131)
 96 PRK02812 ribose-phosphate pyro  46.1      23 0.00058   16.2   8.9  132    5-140    48-207 (331)
 97 pfam02153 PDH Prephenate dehyd  45.9      23 0.00059   16.1   6.9  150   46-206     2-160 (258)
 98 TIGR02397 dnaX_nterm DNA polym  45.8      23 0.00059   16.1   4.2   60   63-123    17-78  (363)
 99 PRK05963 3-oxoacyl-(acyl carri  45.7      23 0.00059   16.1   6.2   78   41-120    56-144 (327)
100 cd04737 LOX_like_FMN L-Lactate  45.1      19 0.00049   16.7   2.6   14  233-246   318-331 (351)
101 PRK10848 phosphohistidine phos  45.0      24  0.0006   16.1   3.0   86   42-136    31-121 (159)
102 TIGR01650 PD_CobS cobaltochela  44.7      22 0.00057   16.2   2.9   84   91-178    48-142 (327)
103 cd03332 LMO_FMN L-Lactate 2-mo  44.4      24 0.00062   16.0   3.0   14  233-246   350-363 (383)
104 PRK12815 carB carbamoyl phosph  43.8      25 0.00063   15.9   5.2   41   26-68    558-601 (1068)
105 pfam02540 NAD_synthase NAD syn  43.7      25 0.00063   15.9   5.2   31   57-87     21-51  (243)
106 KOG3347 consensus               43.2      25 0.00064   15.9   3.3   33  107-141     5-37  (176)
107 PRK10046 dpiA two-component re  43.2      25 0.00064   15.9   6.9   66   34-105    57-122 (225)
108 TIGR02470 sucr_synth sucrose s  41.1      16 0.00042   17.1   1.7  145   31-184   285-504 (790)
109 cd03786 GT1_UDP-GlcNAc_2-Epime  41.1      27 0.00069   15.7   4.9   88   48-140    21-116 (363)
110 PRK09258 3-oxoacyl-(acyl carri  41.0      27 0.00069   15.7   6.8   81   42-122    60-151 (339)
111 COG2805 PilT Tfp pilus assembl  40.9      27  0.0007   15.6   3.4   37   91-129   181-217 (353)
112 cd05844 GT1_like_7 Glycosyltra  40.8      27  0.0007   15.6   4.3   42   99-144    72-113 (367)
113 PRK10430 DNA-binding transcrip  40.7      28  0.0007   15.6   7.2   50   35-87     57-106 (239)
114 PRK09352 3-oxoacyl-(acyl carri  40.5      28 0.00071   15.6   5.4   77   41-119    55-143 (319)
115 PRK05294 carB carbamoyl phosph  40.4      28 0.00071   15.6   5.0   28   37-66    571-598 (1063)
116 PRK10867 signal recognition pa  40.4      28 0.00071   15.6   7.2   77   42-122   117-199 (453)
117 TIGR01166 cbiO cobalt ABC tran  39.6      29 0.00073   15.5   4.7   92   12-115    85-183 (190)
118 cd00553 NAD_synthase NAD+ synt  39.2      29 0.00074   15.5   5.2   52   54-105    23-77  (248)
119 PRK12879 3-oxoacyl-(acyl carri  38.7      30 0.00075   15.4   6.5   79   41-119    56-144 (326)
120 PRK08304 stage V sporulation p  38.6      24 0.00062   16.0   2.3   74   59-142    21-107 (336)
121 TIGR00628 ung uracil-DNA glyco  38.3      18 0.00046   16.8   1.5   31  173-205    76-107 (225)
122 PRK12404 stage V sporulation p  38.2      30 0.00077   15.4   3.1   74   59-142    19-105 (334)
123 TIGR03449 mycothiol_MshA UDP-N  38.1      30 0.00077   15.4   4.8   96   39-145    23-133 (405)
124 COG2062 SixA Phosphohistidine   37.9      30 0.00078   15.3   2.7   83   35-120    26-112 (163)
125 pfam06925 MGDG_synth Monogalac  37.6      31 0.00078   15.3   4.4   99   40-147     5-127 (169)
126 PRK13856 two-component respons  37.5      31 0.00079   15.3   3.4   49   35-86     53-101 (241)
127 PRK03482 phosphoglycerate muta  37.4      31 0.00079   15.3   3.3   37  124-161   151-187 (215)
128 PRK04527 argininosuccinate syn  37.4      31 0.00079   15.3   7.6   85   47-135    21-134 (397)
129 pfam07451 SpoVAD Stage V sporu  37.1      31  0.0008   15.3   3.1   74   59-142    16-102 (329)
130 cd03784 GT1_Gtf_like This fami  36.9      32  0.0008   15.2   5.5   38  101-144    96-133 (401)
131 PRK07832 short chain dehydroge  36.7      32 0.00081   15.2   8.3   71   42-115    13-84  (272)
132 PRK06048 acetolactate synthase  36.5      32 0.00082   15.2   4.8   52   93-145   193-244 (562)
133 smart00828 PKS_MT Methyltransf  36.5      32 0.00082   15.2   4.1   41   46-86     14-54  (224)
134 PRK11545 gntK gluconate kinase  36.2      29 0.00074   15.5   2.3   28  111-140    10-37  (177)
135 TIGR01426 MGT glycosyltransfer  36.1      32 0.00083   15.2   5.0  101  102-209    92-209 (429)
136 PRK08527 acetolactate synthase  36.0      33 0.00083   15.2   4.3   52   93-145   190-241 (560)
137 TIGR01369 CPSaseII_lrg carbamo  36.0      33 0.00083   15.2   3.5  114   24-144   575-709 (1089)
138 cd01968 Nitrogenase_NifE_I Nit  35.4      33 0.00085   15.1   6.3   28  110-138   159-186 (410)
139 PRK09825 idnK D-gluconate kina  35.4      33 0.00085   15.1   2.6   27  112-140     6-32  (176)
140 PRK13980 NAD synthetase; Provi  35.3      33 0.00085   15.1   5.6   11  129-139   169-179 (264)
141 PRK10840 transcriptional regul  34.8      34 0.00087   15.0   7.7   60   41-106    66-125 (216)
142 TIGR00064 ftsY signal recognit  34.4      35 0.00088   15.0   7.8   31   85-115   140-171 (284)
143 TIGR01169 rplA_bact ribosomal   34.3      34 0.00087   15.0   2.4  129   35-177    13-172 (227)
144 PRK09836 DNA-binding transcrip  34.2      35 0.00089   15.0   2.9   67   35-107    52-118 (226)
145 PRK12880 3-oxoacyl-(acyl carri  34.2      35 0.00089   15.0   6.4   87   32-120    51-152 (353)
146 PRK12778 putative bifunctional  34.0      35 0.00089   15.0   9.3  106   42-153   113-220 (760)
147 PRK10651 transcriptional regul  33.7      18 0.00045   16.9   0.9   43   38-82     63-105 (216)
148 cd06337 PBP1_ABC_ligand_bindin  33.5      36 0.00091   14.9   5.4   35  100-138   195-229 (357)
149 PRK05564 DNA polymerase III su  33.5      36 0.00091   14.9   4.5   53   63-115     7-65  (313)
150 PRK01132 consensus              33.0      36 0.00093   14.9  12.5  140    5-155    27-194 (286)
151 cd00861 ProRS_anticodon_short   32.7      37 0.00094   14.8   7.1   68   94-167    16-85  (94)
152 TIGR01162 purE phosphoribosyla  32.6      32 0.00082   15.2   2.1   82   60-147     2-88  (159)
153 TIGR01351 adk adenylate kinase  32.6      37 0.00094   14.8   2.4  114   45-173    15-154 (232)
154 PRK07204 3-oxoacyl-(acyl carri  32.5      37 0.00094   14.8   5.9   79   41-119    55-145 (329)
155 TIGR01701 Fdhalpha-like oxidor  32.5     9.6 0.00025   18.6  -0.6  106   94-202   133-249 (824)
156 cd03801 GT1_YqgM_like This fam  32.4      37 0.00095   14.8   8.5  100   35-146    13-118 (374)
157 TIGR02660 nifV_homocitr homoci  32.4      37 0.00095   14.8   4.3  151   40-204   113-273 (369)
158 PRK13946 shikimate kinase; Pro  32.2      38 0.00096   14.8   3.8   87  101-193    14-111 (195)
159 TIGR00375 TIGR00375 conserved   32.0      18 0.00047   16.7   0.8   36  109-148   158-196 (384)
160 TIGR01173 glmU UDP-N-acetylglu  31.8      38 0.00097   14.7   4.1  118   39-167    31-160 (461)
161 pfam04748 Polysacc_deac_2 Dive  31.8      38 0.00097   14.7   8.3  150   30-193    22-193 (213)
162 PRK09191 two-component respons  31.8      38 0.00097   14.7   3.8   86   60-146   113-219 (261)
163 PRK07282 acetolactate synthase  31.2      39 0.00099   14.7   7.7   99   41-145   146-247 (566)
164 PRK00553 ribose-phosphate pyro  30.9      39   0.001   14.6   9.5  133    5-141    44-204 (340)
165 PRK13463 phosphatase PhoE; Pro  30.9      39   0.001   14.6   3.8   36  124-159   152-197 (203)
166 PRK03731 aroL shikimate kinase  30.7      40   0.001   14.6   2.4   77  112-193     5-92  (172)
167 PRK07515 3-oxoacyl-(acyl carri  30.6      40   0.001   14.6   5.1   77   40-119    97-185 (372)
168 TIGR00095 TIGR00095 putative m  30.6      26 0.00066   15.8   1.3   77   54-136    55-158 (210)
169 cd00738 HGTP_anticodon HGTP an  30.4      40   0.001   14.6   3.6   70   93-168    15-86  (94)
170 cd04121 Rab40 Rab40 subfamily.  30.3      40   0.001   14.6   5.3   71   70-140    69-145 (189)
171 PRK08155 acetolactate synthase  30.1      41   0.001   14.5   3.7   97   41-145   149-248 (564)
172 cd03819 GT1_WavL_like This fam  30.0      41   0.001   14.5   8.5   96   38-144    12-109 (355)
173 PRK00509 argininosuccinate syn  29.6      41  0.0011   14.5   9.8   92   46-140    19-138 (398)
174 COG4565 CitB Response regulato  29.6      41  0.0011   14.5   4.0   48   37-87     56-103 (224)
175 COG2120 Uncharacterized protei  29.2      42  0.0011   14.4   7.3   66   48-115    33-115 (237)
176 PRK05057 aroK shikimate kinase  29.0      42  0.0011   14.4   2.4   79  111-193     6-95  (172)
177 cd00830 KAS_III Ketoacyl-acyl   28.9      43  0.0011   14.4   6.5   79   40-120    52-142 (320)
178 cd00464 SK Shikimate kinase (S  28.4      43  0.0011   14.4   2.4   68  112-181     2-80  (154)
179 cd04962 GT1_like_5 This family  28.4      43  0.0011   14.4   5.1   97   38-144    14-119 (371)
180 PRK13582 thrH phosphoserine ph  28.3      36 0.00093   14.8   1.8   91   58-155    29-124 (205)
181 pfam10678 DUF2492 Protein of u  28.2      33 0.00085   15.1   1.6   14  235-248    49-62  (78)
182 PRK07764 DNA polymerase III su  28.2      44  0.0011   14.3   4.0   59   62-120    17-77  (775)
183 COG2237 Predicted membrane pro  28.0      44  0.0011   14.3   5.3   55   35-89     42-108 (364)
184 PRK09468 ompR osmolarity respo  27.9      44  0.0011   14.3   6.8   49   35-86     57-105 (239)
185 TIGR03451 mycoS_dep_FDH mycoth  27.7      45  0.0011   14.3   5.6   30   55-85    177-206 (358)
186 PRK00131 aroK shikimate kinase  27.6      45  0.0011   14.3   2.4   31  109-141     4-34  (175)
187 pfam04123 DUF373 Domain of unk  27.3      45  0.0012   14.2   5.3   54   36-89     43-108 (344)
188 TIGR01788 Glu-decarb-GAD gluta  27.2      46  0.0012   14.2   2.5  114    7-125   265-395 (493)
189 COG1606 ATP-utilizing enzymes   27.1      46  0.0012   14.2   2.5  142   50-195    38-197 (269)
190 TIGR02885 spore_sigF RNA polym  27.0      19 0.00047   16.7   0.1   49   94-147   170-220 (231)
191 cd03800 GT1_Sucrose_synthase T  26.9      46  0.0012   14.2   5.3  100   38-145    23-133 (398)
192 PRK11475 DNA-binding transcrip  26.8      46  0.0012   14.2   5.1   54   33-88     46-99  (205)
193 PRK08199 acetolactate synthase  26.8      46  0.0012   14.2   3.6   52   93-145   184-235 (553)
194 pfam00289 CPSase_L_chain Carba  26.6      47  0.0012   14.1   4.7   93   39-140    10-102 (109)
195 TIGR00496 frr ribosome recycli  26.4      33 0.00085   15.1   1.3   24  202-225    74-97  (177)
196 PRK11083 DNA-binding response   26.4      47  0.0012   14.1   6.7   66   35-106    55-120 (229)
197 TIGR01135 glmS glucosamine--fr  26.1      28 0.00072   15.5   0.9   13  164-176   525-537 (628)
198 TIGR02352 thiamin_ThiO glycine  26.0      48  0.0012   14.1   3.1  167   32-202    93-293 (357)
199 PRK13949 shikimate kinase; Pro  26.0      48  0.0012   14.1   2.4   67  112-180     4-81  (169)
200 TIGR01862 N2-ase-Ialpha nitrog  25.9      48  0.0012   14.1   2.1   30   45-74    264-293 (510)
201 cd03814 GT1_like_2 This family  25.8      48  0.0012   14.1   6.7   96   35-143    13-114 (364)
202 cd03802 GT1_AviGT4_like This f  25.6      49  0.0012   14.0   8.1   97   35-144    18-115 (335)
203 PRK00377 cbiT cobalt-precorrin  25.5      49  0.0012   14.0   7.8   79   39-136    52-133 (198)
204 PRK06456 acetolactate synthase  25.5      49  0.0012   14.0   4.6   53   92-145   192-244 (572)
205 cd03817 GT1_UGDG_like This fam  25.4      49  0.0012   14.0   6.7   96   35-142    13-114 (374)
206 cd02649 nuc_hydro_CeIAG nuc_hy  25.4      49  0.0013   14.0   3.6   80   34-120    96-194 (306)
207 KOG2994 consensus               25.4      37 0.00095   14.8   1.4   33  172-206   149-181 (297)
208 PRK13948 shikimate kinase; Pro  25.2      50  0.0013   14.0   2.3   69  110-180    11-90  (182)
209 pfam00342 PGI Phosphoglucose i  24.7      30 0.00077   15.4   0.8   47   57-103    98-145 (483)
210 cd03794 GT1_wbuB_like This fam  24.7      51  0.0013   13.9   7.9  107   35-145    13-133 (394)
211 cd06404 PB1_aPKC PB1 domain is  24.6      51  0.0013   13.9   3.5   34   24-59     44-77  (83)
212 cd06192 DHOD_e_trans_like FAD/  24.6      51  0.0013   13.9   3.8   39   81-122    98-137 (243)
213 TIGR01292 TRX_reduct thioredox  24.5      51  0.0013   13.9   2.9   32   57-90    153-184 (321)
214 TIGR01949 AroFGH_arch predicte  24.3      51  0.0013   13.9   2.5  125   62-196    82-219 (259)
215 PRK12581 oxaloacetate decarbox  24.2      52  0.0013   13.9   7.2  104   34-142   127-266 (468)
216 PRK10161 transcriptional regul  23.8      53  0.0013   13.8   6.5   67   35-107    54-122 (229)
217 PRK00973 glucose-6-phosphate i  23.8      35  0.0009   14.9   1.0   72   32-103    48-129 (454)
218 PRK10834 hypothetical protein;  23.7      53  0.0013   13.8   7.9  104   34-144    61-169 (239)
219 PRK09483 response regulator; P  23.7      53  0.0013   13.8   6.5   49   35-86     55-103 (216)
220 COG1212 KdsB CMP-2-keto-3-deox  23.5      53  0.0014   13.8   6.5   31  130-160   112-150 (247)
221 PRK10403 transcriptional regul  23.5      53  0.0014   13.8   5.8   41   39-81     64-104 (215)
222 COG0552 FtsY Signal recognitio  23.5      53  0.0014   13.8   3.9   25   91-115   203-227 (340)
223 PRK09935 transcriptional regul  23.5      53  0.0014   13.8   6.3   46   38-86     60-105 (210)
224 PRK07133 DNA polymerase III su  23.4      54  0.0014   13.8   4.6   46   62-107    20-66  (718)
225 TIGR03254 oxalate_oxc oxalyl-C  23.3      54  0.0014   13.8   3.5   52   93-145   192-243 (554)
226 PRK12338 hypothetical protein;  23.3      54  0.0014   13.8   2.5   12  234-245   259-270 (320)
227 cd06315 PBP1_ABC_sugar_binding  23.1      54  0.0014   13.7  10.0   30   34-64     61-90  (280)
228 PRK10816 DNA-binding transcrip  23.1      54  0.0014   13.7   5.3   67   35-107    52-118 (223)
229 COG4034 Uncharacterized protei  23.0      54  0.0014   13.7   4.3   75   36-115    59-137 (328)
230 PRK08617 acetolactate synthase  22.8      55  0.0014   13.7   3.3   51   93-144   187-237 (552)
231 KOG0092 consensus               22.6      55  0.0014   13.7   2.6   87   32-119    24-120 (200)
232 PRK00179 pgi glucose-6-phospha  22.6      46  0.0012   14.2   1.4   46   58-103   133-179 (525)
233 PRK10768 ribonucleoside hydrol  22.5      56  0.0014   13.7   2.7   81   35-121    96-192 (304)
234 PRK12775 putative trifunctiona  22.4      56  0.0014   13.6   8.9  101   46-152   118-220 (993)
235 COG0703 AroK Shikimate kinase   22.3      56  0.0014   13.6   2.4   28  111-140     4-31  (172)
236 PRK04182 cytidylate kinase; Pr  22.3      56  0.0014   13.6   2.5   17  124-140    13-29  (178)
237 COG2197 CitB Response regulato  22.3      56  0.0014   13.6   7.2   66   35-106    54-119 (211)
238 TIGR03457 sulphoacet_xsc sulfo  21.8      58  0.0015   13.6   4.8   52   92-144   181-232 (579)
239 TIGR03551 F420_cofH 7,8-dideme  21.5      58  0.0015   13.5   6.0   16  129-144   185-200 (343)
240 KOG1712 consensus               21.4      59  0.0015   13.5   5.0   86   82-171    24-117 (183)
241 COG4567 Response regulator con  21.4      59  0.0015   13.5   6.5   65   75-152     3-67  (182)
242 cd04106 Rab23_lke Rab23-like s  21.2      59  0.0015   13.5   4.3   75   66-140    61-141 (162)
243 TIGR03394 indol_phenyl_DC indo  21.2      59  0.0015   13.5   4.3   47   99-145   192-238 (535)
244 PRK06217 hypothetical protein;  21.2      59  0.0015   13.5   2.5   28  112-141     4-31  (185)
245 TIGR02528 EutP ethanolamine ut  21.1      23 0.00059   16.1  -0.4   61  108-169    62-128 (144)
246 PRK08327 acetolactate synthase  21.1      59  0.0015   13.5   3.8   53   92-145   205-257 (568)
247 COG1929 Glycerate kinase [Carb  21.0      60  0.0015   13.5   2.8   46   91-136   108-155 (378)
248 cd04730 NPD_like 2-Nitropropan  20.9      60  0.0015   13.5   4.5   72   55-138    80-158 (236)
249 pfam01820 Dala_Dala_lig_N D-al  20.9      60  0.0015   13.4   3.2   35  106-141    75-109 (110)
250 cd00156 REC Signal receiver do  20.8      60  0.0015   13.4   4.3   14   90-103    52-65  (113)
251 pfam00072 Response_reg Respons  20.8      60  0.0015   13.4   4.7   11   91-101    54-64  (111)
252 PRK10754 quinone oxidoreductas  20.8      60  0.0015   13.4   6.5   22  120-141   149-170 (327)
253 COG1064 AdhP Zn-dependent alco  20.7      61  0.0015   13.4   5.0   21  112-136   170-190 (339)
254 PRK13671 hypothetical protein;  20.6      61  0.0015   13.4   7.6   84   34-123     8-107 (298)
255 PRK06720 hypothetical protein;  20.4      61  0.0016   13.4   8.0   73   39-115    26-99  (169)
256 PRK07092 benzoylformate decarb  20.3      62  0.0016   13.4   5.0   50   92-142   182-232 (521)
257 PRK09958 DNA-binding transcrip  20.2      62  0.0016   13.4   6.1   40   39-80     57-96  (204)
258 PRK08507 prephenate dehydrogen  20.2      62  0.0016   13.4   6.9   68   45-117    15-90  (275)
259 PRK08451 DNA polymerase III su  20.2      62  0.0016   13.4   4.7   44   63-106    17-61  (523)
260 KOG0023 consensus               20.0      63  0.0016   13.3   3.3   22   58-80    185-206 (360)

No 1  
>PRK03359 putative electron transfer flavoprotein FixA; Reviewed
Probab=100.00  E-value=0  Score=523.98  Aligned_cols=243  Identities=23%  Similarity=0.350  Sum_probs=226.4

Q ss_pred             CEEEEEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHH--HHHHHHHHH
Q ss_conf             969998603038876059807888163248773326013689999999985599852899997141015--888887850
Q gi|254780368|r    1 MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVE--EVLKNSLAM   78 (249)
Q Consensus         1 M~I~V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~--~~Lr~alAm   78 (249)
                      |||+||+|||||++ +++++++++.+++++++++|||||+||||+||||||+++|.+||++||||+.++  ..||+||||
T Consensus         1 MkI~VcvKqVPD~~-~~~i~~~~g~l~~~~~~~~iNp~De~AlE~AlrlkE~~gg~~VtvvsvG~~~~~~~~~lr~aLAm   79 (256)
T PRK03359          1 MKIITCYKCVPDEQ-DIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTNAKGRKDVLSR   79 (256)
T ss_pred             CEEEEEEEECCCCC-CEEEECCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHHHC
T ss_conf             97999988787864-14870799939846986346865689999999988851995799999377544559999999975


Q ss_pred             CCCCCEEEECC--CCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEE-EECCCEEEE
Q ss_conf             77762376336--547889999999998612686499996113588861289999998579613324433-432865999
Q gi|254780368|r   79 GADRGILIESN--ETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNI-KIIDNHAIV  155 (249)
Q Consensus        79 GaD~ai~i~d~--~~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i-~~~~~~~~v  155 (249)
                      |||+++|++|+  +++|+++||++|++++++.+|||||||+||+|+++||||+++|++|||||+|+|.++ +++++.+++
T Consensus        80 GaD~ai~i~d~~~~~~D~~~tA~~La~~i~~~~~DLVl~G~~s~D~~~gqvg~~lAe~Lg~P~vt~v~~i~~~~~~~~~v  159 (256)
T PRK03359         80 GPDELIVVIDDQFEQALPQQTASALAAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPAINGVSKIISLTADTLTV  159 (256)
T ss_pred             CCCEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHCCCHHEEEEEEEEECCCEEEE
T ss_conf             89728997576544437799999999999872999999925102599985228999982985220077899953998999


Q ss_pred             EEECCCCEEEEEECCCEEEEEECCCCCCCCCCHHHHHHHHHCCCCEECHHHHCCCCCCCEEEEEEECCCCCCCCE-EECC
Q ss_conf             983589679999639889998435565454698889988521661204989076666845799951788524745-5379
Q gi|254780368|r  156 TREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGL-RLYS  234 (249)
Q Consensus       156 ~r~~e~g~e~v~~~lPavisv~~~~n~PR~psl~~im~A~kk~i~~~~~~dlg~d~~~~~~v~~~~~p~~~~~g~-~~e~  234 (249)
                      +|++|+|+|+++++||||+||++++|+||||||++||+|+||||++|+++|||++.+|...+.+.+.||.++++. ++|+
T Consensus       160 ~R~~e~g~e~v~~~lPavvtv~~~~n~PR~psl~~im~AkkKpi~~~s~~dlgl~~~~~~~~~~~~~p~~~~~~~~~~eG  239 (256)
T PRK03359        160 ERELEDEVETLSIPLPAVIAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGLNAVPAWSEQQVAAPKQRERQRIVIEG  239 (256)
T ss_pred             EEECCCCEEEEEECCCEEEEEECCCCCCCCCCHHHHHHHCCCCCCEECHHHCCCCCCCCEEEEEEECCCCCCCCEEEECC
T ss_conf             99857908999976998999988988668899799998679986373899949778882689886089866686389559


Q ss_pred             -----HHHHHHHHHH
Q ss_conf             -----9999999998
Q gi|254780368|r  235 -----TTKLIEILKS  244 (249)
Q Consensus       235 -----~~eLv~~L~~  244 (249)
                           +++|+++||+
T Consensus       240 ~~~e~v~~lv~~Lk~  254 (256)
T PRK03359        240 DGEEQIAAFAENLRK  254 (256)
T ss_pred             CHHHHHHHHHHHHHH
T ss_conf             989999999999985


No 2  
>PRK12342 putative electron transfer flavoprotein YdiQ; Provisional
Probab=100.00  E-value=0  Score=511.58  Aligned_cols=243  Identities=26%  Similarity=0.365  Sum_probs=222.6

Q ss_pred             CEEEEEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHH--HHHHHHHHHH
Q ss_conf             96999860303887605980788816324877332601368999999998559985289999714101--5888887850
Q gi|254780368|r    1 MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKV--EEVLKNSLAM   78 (249)
Q Consensus         1 M~I~V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~--~~~Lr~alAm   78 (249)
                      |||+||+|||||++ ++++++++ .+++++++++|||||+||||+|||||+.  |++|+++|||++.+  ...+|.||||
T Consensus         1 M~I~VciKqVPD~~-~~~~~~d~-~l~~~~~~~~iNp~D~~AlE~Al~lk~~--gg~v~vvs~G~~~~~~~~~~r~alAm   76 (254)
T PRK12342          1 MKIITCFKLVPEEQ-DIVVTPEY-TLNFDNAEAKISQFDLNAIEAASQLATD--GDEIAALTVGGSLLQNSKVRKDVLSR   76 (254)
T ss_pred             CEEEEEEEECCCCC-EEEECCCC-CEEECCCCCCCCCCCHHHHHHHHHHHHC--CCCEEEEEECCCCHHHHHHHHHHHHH
T ss_conf             97999999888855-05884899-7885378655686569999999998861--99699999568802559999999973


Q ss_pred             CCCCCEEEECC--CCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEE
Q ss_conf             77762376336--5478899999999986126864999961135888612899999985796133244334328659999
Q gi|254780368|r   79 GADRGILIESN--ETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVT  156 (249)
Q Consensus        79 GaD~ai~i~d~--~~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~  156 (249)
                      |||+++|++|+  +++|+++||++||+++++.+|||||||+||+|+++||||+++|++|||||+|+|.++++++++++++
T Consensus        77 GaD~a~li~d~~~~g~D~~~tA~~La~~i~~~~~DLVl~G~~s~D~~tgqvg~~lAe~Lg~P~vt~v~~i~~~~~~~~v~  156 (254)
T PRK12342         77 GPHSLYLVQDAQLEHALPLDTAKALAAAIEKIGFDLLLFGEGSGDLYAQQVGLLLGELLQLPVINAVSKIQRQGNKLVVE  156 (254)
T ss_pred             CCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHHCCCCCEEEEEEEEEECCEEEEE
T ss_conf             79889998457656668899999999999983969999936212489885789999870997166799999719989999


Q ss_pred             EECCCCEEEEEECCCEEEEEECCCCCCCCCCHHHHHHHHHCCCCEECHHHHCCCC-CCCEEEEEEECCCCCCCC-EEECC
Q ss_conf             8358967999963988999843556545469888998852166120498907666-684579995178852474-55379
Q gi|254780368|r  157 REVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDL-TPRLKVLRFEENRAERKG-LRLYS  234 (249)
Q Consensus       157 r~~e~g~e~v~~~lPavisv~~~~n~PR~psl~~im~A~kk~i~~~~~~dlg~d~-~~~~~v~~~~~p~~~~~g-~~~e~  234 (249)
                      |+.|+|+|+++++||||+||++++|+||||||++||+|+||||++|+++|||++. .+.+++.+++.||+++++ +++++
T Consensus       157 R~~e~g~e~ve~~lPavvtv~~~~n~PR~psl~~im~AkkK~i~~~~~~dlg~~~~~~~~~v~~~~~Pp~~~~~~~i~eg  236 (254)
T PRK12342        157 RTLEDDVEVIELSLPAVLCVTSDINVPRIPSMKAILGAGKKPVNQWQASDIGWSQSAPLAELVSILVPPQTERKHIILDN  236 (254)
T ss_pred             EECCCCEEEEEECCCEEEEEECCCCCCCCCCHHHHHHHCCCCCEEECHHHCCCCCCCCCEEEEEEECCCCCCCCCEEECC
T ss_conf             99179679999779989999899885577997899986699850858999497767786389997479976677668249


Q ss_pred             -----HHHHHHHHHHHHC
Q ss_conf             -----9999999998617
Q gi|254780368|r  235 -----TTKLIEILKSKHD  247 (249)
Q Consensus       235 -----~~eLv~~L~~e~~  247 (249)
                           +++|+++||+|++
T Consensus       237 d~~e~v~~Lv~~Lkee~~  254 (254)
T PRK12342        237 DSPEAIAELAEHLKKALN  254 (254)
T ss_pred             CHHHHHHHHHHHHHHHHC
T ss_conf             989999999999988659


No 3  
>COG2086 FixA Electron transfer flavoprotein, beta subunit [Energy production and conversion]
Probab=100.00  E-value=0  Score=502.39  Aligned_cols=249  Identities=43%  Similarity=0.667  Sum_probs=237.9

Q ss_pred             CEEEEEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCC
Q ss_conf             96999860303887605980788816324877332601368999999998559985289999714101588888785077
Q gi|254780368|r    1 MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGA   80 (249)
Q Consensus         1 M~I~V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGa   80 (249)
                      |||+||+|+++|.+.+++++++++.+++++++++|||||+||||+|+||||+..|++|+++||||++++++||+|||||+
T Consensus         1 m~ilV~~k~~v~~~~~i~v~~~~~~~~~~gv~~~in~~D~~AvEeAlrLke~~~~~eV~vlt~Gp~~a~~~lr~aLAmGa   80 (260)
T COG2086           1 MKILVLIKKVVDDESKIRVDPDTGTLDRSGVPLSINPFDLNAVEEALRLKEKGYGGEVTVLTMGPPQAEEALREALAMGA   80 (260)
T ss_pred             CCEEEEEEEECCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEECCHHHHHHHHHHHHCCC
T ss_conf             90899999878962327981688840147886225812079999999861468886699999464533999999985488


Q ss_pred             CCCEEEECC--CCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEE-CCCEEEEEE
Q ss_conf             762376336--54788999999999861268649999611358886128999999857961332443343-286599998
Q gi|254780368|r   81 DRGILIESN--ETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKI-IDNHAIVTR  157 (249)
Q Consensus        81 D~ai~i~d~--~~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~-~~~~~~v~r  157 (249)
                      ||||||+|+  +++|+++||++|+++++++++||||||+||+|+++||||+++|++|||||+|+|+++++ ++++++++|
T Consensus        81 Draili~d~~~~~~d~~~ta~~Laa~~~~~~~~LVl~G~qa~D~~t~qvg~~lAe~Lg~P~~t~v~~i~~~d~~~v~v~R  160 (260)
T COG2086          81 DRAILITDRAFAGADPLATAKALAAAVKKIGPDLVLTGKQAIDGDTGQVGPLLAELLGWPQVTYVSKIEIVDGGKVTVER  160 (260)
T ss_pred             CEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHCCCEEEEEEEEEECCCCEEEEEE
T ss_conf             75999703223675589999999999987499889981344357646658999998698505337889974798799999


Q ss_pred             ECCCCEEEEEECCCEEEEEECCCCCCCCCCHHHHHHHHHCCCCEECHHHHC---CCCCCCEEEEEEECCCCCCCCEEECC
Q ss_conf             358967999963988999843556545469888998852166120498907---66668457999517885247455379
Q gi|254780368|r  158 EVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFA---IDLTPRLKVLRFEENRAERKGLRLYS  234 (249)
Q Consensus       158 ~~e~g~e~v~~~lPavisv~~~~n~PR~psl~~im~A~kk~i~~~~~~dlg---~d~~~~~~v~~~~~p~~~~~g~~~e~  234 (249)
                      ++|+|.|+++++||||+|++.++|+||||||++||+|+|||++.|+++|+|   ....|++++.+.++|++|+.++++.+
T Consensus       161 ~le~g~e~~e~~LPaVvtv~~~~n~PR~psl~~im~A~kk~v~~~~~~d~g~~~~~~~s~~~v~~~~~~~~r~~~~~v~~  240 (260)
T COG2086         161 ELEGGLETVEAPLPAVVTVDLRINEPRYPSLPGIMAAKKKPVKKWSLADLGLNVGLAGSPLKVVKVTPPPERKAGVKVKD  240 (260)
T ss_pred             ECCCCEEEEECCCCEEEEECCCCCCCCCCCHHHHHHHCCCCCEECCHHHHCCCCCCCCCCCEEEECCCCCCCCCCEEECC
T ss_conf             73795399971598899953555787778979998754578403457670642134688504664268764567648557


Q ss_pred             -----HHHHHHHHHHHHCCC
Q ss_conf             -----999999999861769
Q gi|254780368|r  235 -----TTKLIEILKSKHDLL  249 (249)
Q Consensus       235 -----~~eLv~~L~~e~~vi  249 (249)
                           +++|+++|+++..++
T Consensus       241 ~~~e~a~~lv~~L~~~~~i~  260 (260)
T COG2086         241 GPEEIAAELVEKLKEEGVIL  260 (260)
T ss_pred             CHHHHHHHHHHHHHHHHCCC
T ss_conf             58999999999998732669


No 4  
>cd01714 ETF_beta The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases. ETF transfers electrons to the main respiratory chain via ETF-ubiquinone oxidoreductase. ETF is an heterodimer that consists of an alpha and a beta subunit which binds one molecule of FAD per dimer . A similar system also exists in some bacteria.  The homologous pair of proteins (FixA/FixB) are essential for nitrogen fixation. The beta subunit protein is distantly related to and forms a heterodimer with the alpha subunit.
Probab=100.00  E-value=0  Score=461.06  Aligned_cols=200  Identities=46%  Similarity=0.690  Sum_probs=193.3

Q ss_pred             EEEEEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCC
Q ss_conf             69998603038876059807888163248773326013689999999985599852899997141015888887850777
Q gi|254780368|r    2 KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGAD   81 (249)
Q Consensus         2 ~I~V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD   81 (249)
                      ||+||+|||||++. .+++++++.++++++++++||||+||||+||||||+ .|++|+++||||++++++||+|||||||
T Consensus         1 nI~V~vK~VPD~~~-~~~~~~~g~v~~~~~~~vin~~D~~AlE~Alrlke~-~g~~VtvlsvGp~~a~~~Lr~alAmGaD   78 (202)
T cd01714           1 NILVCVKQVPDTEE-KRVDPDTGTIDREGVPLIINPYDEYAVEEALRLKEK-YGGEVTVVSMGPPQAEEALREALAMGAD   78 (202)
T ss_pred             CEEEEEEECCCCCC-EEEECCCCEEEECCCCCCCCCCCHHHHHHHHHHHHC-CCCEEEEEEECCHHHHHHHHHHHHHCCC
T ss_conf             98999887878775-278389992984698435695438999999998660-3988999993747889999999970898


Q ss_pred             CCEEEECC--CCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEEC
Q ss_conf             62376336--5478899999999986126864999961135888612899999985796133244334328659999835
Q gi|254780368|r   82 RGILIESN--ETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREV  159 (249)
Q Consensus        82 ~ai~i~d~--~~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~  159 (249)
                      +++||+|+  +++|+++||++||+++++.+|||||||+||+|+++||||+++|++|||||+++|.++++++++++++|+.
T Consensus        79 ~ai~i~d~~~~~~D~~~tA~~La~~i~~~~~DLIl~G~~s~D~~~g~v~~~lA~~Lg~P~vt~v~~i~~~~~~~~v~r~~  158 (202)
T cd01714          79 RAILVSDRAFAGADTLATAKALAAAIKKIGVDLILTGKQSIDGDTGQVGPLLAELLGWPQITYVSKIEIEGGKVTVEREL  158 (202)
T ss_pred             EEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCHHHHHHHHHCCCCCCEEEEEEEECCEEEEEEEC
T ss_conf             35998065556669899999999999875998899954545799777999999994897224888999939999999984


Q ss_pred             CCCEEEEEECCCEEEEEECCCCCCCCCCHHHHHHHHHCCCCEEC
Q ss_conf             89679999639889998435565454698889988521661204
Q gi|254780368|r  160 GHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKK  203 (249)
Q Consensus       160 e~g~e~v~~~lPavisv~~~~n~PR~psl~~im~A~kk~i~~~~  203 (249)
                      ++|.|++++++|||+||++++|+||||||++||+|+||||++||
T Consensus       159 ~~g~e~~~~~lPavisv~~~~n~pR~psl~~im~A~kkpi~~~s  202 (202)
T cd01714         159 EGGVETVEVKLPAVITVDLGINEPRYPSLPGIMKAKKKPIEVVS  202 (202)
T ss_pred             CCEEEEEEECCCEEEEEECCCCCCCCCCHHHHHHHCCCCCEEEC
T ss_conf             89699999639999999899886577997999976799976669


No 5  
>KOG3180 consensus
Probab=100.00  E-value=0  Score=420.57  Aligned_cols=247  Identities=48%  Similarity=0.766  Sum_probs=239.3

Q ss_pred             CEEEEEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCC
Q ss_conf             96999860303887605980788816324877332601368999999998559985289999714101588888785077
Q gi|254780368|r    1 MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGA   80 (249)
Q Consensus         1 M~I~V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGa   80 (249)
                      |+|+|-+|+|.|+..++|++++.++++++|++++|||||+.|+|||+||||+....+|.++|+||+++++.||+|||||+
T Consensus         4 ~riLV~VKRvvDyavK~RVkpdkTgV~t~gvk~SmNPF~eIAvEEAvrlKEk~l~eeviavs~G~aqs~~ilRt~LA~Ga   83 (254)
T KOG3180           4 LRILVGVKRVVDYAVKIRVKPDKTGVVTSGVKHSMNPFCEIAVEEAVRLKEKKLAEEVIAVSIGPAQSQEILRTALAKGA   83 (254)
T ss_pred             EEEEEEEEEEEEEEEEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHEEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             58887541223446644535765314503614045816788899988675540013179995276202899999986267


Q ss_pred             CCCEEEECC--CCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCE-EEEEE
Q ss_conf             762376336--547889999999998612686499996113588861289999998579613324433432865-99998
Q gi|254780368|r   81 DRGILIESN--ETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNH-AIVTR  157 (249)
Q Consensus        81 D~ai~i~d~--~~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~-~~v~r  157 (249)
                      |+++||...  +...|+.+|++|++.++++++||||.|+|++|.+..|+|+|+|.+|||||.|+.++++.+++. ++++|
T Consensus        84 dr~~hv~~~~~~~lepl~vAKiLk~~vekek~~lVllGKQAIDDD~nqTgqmlA~lL~WPQ~t~askV~~~~~~~~~VtR  163 (254)
T KOG3180          84 DRGVHVEVVGAEELEPLHVAKILKKLVEKEKSDLVLLGKQAIDDDCNQTGQMLAALLGWPQATFASKVELEGDKRVKVTR  163 (254)
T ss_pred             CCEEEEECCCHHHCCCHHHHHHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCEEEEECCCCCEEEEE
T ss_conf             73368732754533512799999999875358879972200256202467899998578410330037984897179998


Q ss_pred             ECCCCEEEEEECCCEEEEEECCCCCCCCCCHHHHHHHHHCCCCEECHHHHCCCCCCCEEEEEEECCCCCCCCEEECCHHH
Q ss_conf             35896799996398899984355654546988899885216612049890766668457999517885247455379999
Q gi|254780368|r  158 EVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK  237 (249)
Q Consensus       158 ~~e~g~e~v~~~lPavisv~~~~n~PR~psl~~im~A~kk~i~~~~~~dlg~d~~~~~~v~~~~~p~~~~~g~~~e~~~e  237 (249)
                      +++||.|++++.+|+|+|.+..+|+|||++|++||+|||||++.+++.|+|+|..|+++++++.+||.|++|.++.++++
T Consensus       164 EIDgGletl~~~lPaVittDLRLN~PRya~LpniMKAkkkpl~k~~~~dl~Vdi~~~l~~vsv~ePp~r~~gv~v~svde  243 (254)
T KOG3180         164 EIDGGLETLKVKLPAVITTDLRLNTPRYATLPNIMKAKKKPLKKMTIKDLGVDITPQLETVSVEEPPQRQAGVMVKSVDE  243 (254)
T ss_pred             EECCCHHHEEECCCEEEEEECCCCCCCCCCCHHHHHHCCCCCCCCCHHHCCCCCCCCEEEEEECCCCCCCCCCEEEEHHH
T ss_conf             70587532120475289740201785213527787751087455788884754455347898127974558856300999


Q ss_pred             HHHHHHHHHC
Q ss_conf             9999998617
Q gi|254780368|r  238 LIEILKSKHD  247 (249)
Q Consensus       238 Lv~~L~~e~~  247 (249)
                      |+++|++...
T Consensus       244 lv~kLKe~g~  253 (254)
T KOG3180         244 LVAKLKELGA  253 (254)
T ss_pred             HHHHHHHCCC
T ss_conf             9999875057


No 6  
>cd01985 ETF The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases. ETF transfers electrons to the main respiratory chain via ETF-ubiquinone oxidoreductase. ETF is an heterodimer that consists of an alpha and a beta subunit which binds one molecule of FAD per dimer . A similar system also exists in some bacteria.  The homologous pair of proteins (FixA/FixB) are essential for nitrogen fixation. The alpha subunit of ETF is structurally related to the bacterial nitrogen fixation protein fixB which could play a role in a redox process and feed electrons to ferredoxin. The beta subunit protein is distantly related to and forms a heterodimer with the alpha subunit.
Probab=100.00  E-value=3.6e-43  Score=297.80  Aligned_cols=176  Identities=39%  Similarity=0.551  Sum_probs=163.7

Q ss_pred             EEEEEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCC
Q ss_conf             69998603038876059807888163248773326013689999999985599852899997141015888887850777
Q gi|254780368|r    2 KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGAD   81 (249)
Q Consensus         2 ~I~V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD   81 (249)
                      ||+||+||+||...                 +++||||++|||+|+||||.  |++|+++++||..++.+||+++|||+|
T Consensus         1 ~IlV~vk~~~d~~~-----------------~v~n~~d~~Ale~A~~lke~--~~~v~~v~~G~~~~~~~l~~~~a~GaD   61 (181)
T cd01985           1 KILVLVEHVPDTAE-----------------LVLNPLDLEAVEAALRLKEY--GGEVTALVIGPPAAEVALREALAMGAD   61 (181)
T ss_pred             CEEEEEEECCCCCC-----------------CCCCCCCHHHHHHHHHHHHC--CCCEEEEEECCCHHHHHHHHHHHCCCC
T ss_conf             98999987799887-----------------44580369999999986444--996899997881689999999772897


Q ss_pred             CCEEEECC--CCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEEC
Q ss_conf             62376336--5478899999999986126864999961135888612899999985796133244334328659999835
Q gi|254780368|r   82 RGILIESN--ETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREV  159 (249)
Q Consensus        82 ~ai~i~d~--~~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~  159 (249)
                      ++++++++  ++.|+.++|++|++++++.+||+||||.+|.   ++++++++|++||||+++++++++++++.++++|..
T Consensus        62 ~v~~v~~~~~~~~~~~~~a~~la~~i~~~~~dlVl~g~~s~---g~~~~~~lA~~L~~~~v~~v~~i~~~~~~~~~~R~~  138 (181)
T cd01985          62 KVLLVEDPALAGYDPEATAKALAALIKKEKPDLILAGATSI---GKQLAPRVAALLGVPQISDVTKLEIDGGDLTVTRPI  138 (181)
T ss_pred             EEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCHH---HCCHHHHHHHHHCCCCCCCEEEEEECCCEEEEEEEE
T ss_conf             89998167445768899999999999860998999604102---225899999985997312379999809969999994


Q ss_pred             CCC--EEEEEEC-CCEEEEEECCCCCCCCCCHHHHHHHHHCCCCEEC
Q ss_conf             896--7999963-9889998435565454698889988521661204
Q gi|254780368|r  160 GHG--TMTMETP-LPAVITVDLNLNEPRYISLPNIIKARKKRIEKKK  203 (249)
Q Consensus       160 e~g--~e~v~~~-lPavisv~~~~n~PR~psl~~im~A~kk~i~~~~  203 (249)
                      .+|  .++++++ +|||+||+.++|+||||++++    ++|+|+.++
T Consensus       139 ~~g~~~~~v~~~~~P~vitv~~~~~~pr~~~~~~----~~~~I~~~~  181 (181)
T cd01985         139 YAGNGLETVESPDLPAVITVRPGAFEPRYPSGPG----KKKPVEKVS  181 (181)
T ss_pred             ECCCEEEEEEECCCCEEEEEECCCCCCCCCCCCC----CCCCCEEEC
T ss_conf             0697699999799988999858987657788787----886054309


No 7  
>pfam01012 ETF Electron transfer flavoprotein domain. This family includes the homologous domain shared between the alpha and beta subunits of the electron transfer flavoprotein.
Probab=99.93  E-value=5.1e-24  Score=174.68  Aligned_cols=147  Identities=32%  Similarity=0.391  Sum_probs=131.8

Q ss_pred             CEECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECC--CCCCHHHHHHHHHHHHHCCC
Q ss_conf             7332601368999999998559985289999714101588888785077762376336--54788999999999861268
Q gi|254780368|r   32 KISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESN--ETLEPLSIAKILREIVKKEN  109 (249)
Q Consensus        32 ~~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~--~~~D~~~~A~~La~~i~~~~  109 (249)
                      ...+||+|.++|++|.+|+++. |++|+++++|+.. +..-..+.++|+|+.++++++  ...++..++++|++++++.+
T Consensus        10 ~g~l~~~~~eal~~A~~l~~~~-g~~v~~v~~G~~~-~~~~~~~~~~Gad~v~~~~~~~~~~~~~~~~a~~l~~~i~~~~   87 (161)
T pfam01012        10 NGKLNPVDLEALEAARQLAEAL-GGEVTAVVVGPVP-AAAEALLAAMGADKVLVVEDPALAGYDAEAYAAALAALIKKEG   87 (161)
T ss_pred             CCEECHHHHHHHHHHHHHHHHC-CCEEEEEEECCCH-HHHHHHHHHCCCCEEEEECCHHHCCCCHHHHHHHHHHHHHCCC
T ss_conf             9984888999999999999863-9859999953947-9999998755999999978712124686889999999754139


Q ss_pred             CCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEECCCCEEEEEECCC---EEEEEECCCCCC
Q ss_conf             64999961135888612899999985796133244334328659999835896799996398---899984355654
Q gi|254780368|r  110 PIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLP---AVITVDLNLNEP  183 (249)
Q Consensus       110 ~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g~e~v~~~lP---avisv~~~~n~P  183 (249)
                      ||+||||.++.|++   ++|++|++||+|++++|++++.+++.++++|..++|.+..++++|   +|+|+..+.++|
T Consensus        88 ~~~Vl~~~s~~g~~---~~~rlA~~L~~~~vsdv~~l~~~~~~~~~~R~~~~G~~~~~~~~~~~~~vitv~~~~f~p  161 (161)
T pfam01012        88 PDLVLAGATSIGKD---LAPRLAALLGAPLITDVTALEVEGGKLTVTRPIYGGNAIATVKLPDPPAVLTVRPGAFEP  161 (161)
T ss_pred             CCEEEECCHHHHHH---HHHHHHHHHCCCCCCCEEEEEECCCEEEEEEECCCCEEEEEEECCCCCEEEEECCCCCCC
T ss_conf             97999704078761---469999995998614279999739839999984588699999989998899983797394


No 8  
>PRK11916 electron transfer flavoprotein subunit YdiR; Provisional
Probab=99.21  E-value=3.4e-09  Score=79.31  Aligned_cols=145  Identities=13%  Similarity=0.168  Sum_probs=106.2

Q ss_pred             EECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCC-CCHHHHHHHHHHHHHCCCCC
Q ss_conf             33260136899999999855998528999971410158888878507776237633654-78899999999986126864
Q gi|254780368|r   33 ISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNET-LEPLSIAKILREIVKKENPI  111 (249)
Q Consensus        33 ~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~-~D~~~~A~~La~~i~~~~~D  111 (249)
                      |++.+-.+...| -|-...+ .|.+|+++.+|...+++    +.+.|||+.+.+.++.. ..+-..+.+|++.+++.+|+
T Consensus         8 wVf~e~~~~~~E-Llg~Ar~-Lg~~v~avv~G~~~a~~----l~~~Gad~V~~~~~~~~~~~~~~y~~~l~~li~~~~P~   81 (312)
T PRK11916          8 WVFSDNPERYAE-LFGGAQQ-WGQQVYAIVQNTDQAQA----VMPYGPKCIYVLEQNDALQRTENYAESIAALLKDKHPA   81 (312)
T ss_pred             EEEEECCCCHHH-HHHHHHH-HCCEEEEEEECCCHHHH----HHHCCCCEEEEEECCHHHCCCHHHHHHHHHHHHHCCCC
T ss_conf             999967888899-9999987-38827999966806999----98619988999516412103068999999999864999


Q ss_pred             EEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEECCCCEE--EEEECC-CEEEEEECCCCCCCCC
Q ss_conf             99996113588861289999998579613324433432865999983589679--999639-8899984355654546
Q gi|254780368|r  112 IVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTM--TMETPL-PAVITVDLNLNEPRYI  186 (249)
Q Consensus       112 LIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g~e--~v~~~l-Pavisv~~~~n~PR~p  186 (249)
                      +||+|.-..   ...+.|++|.+|+.++++.++.++++++.+..+|...+|..  +.++.. |+++|+..+.++|.-+
T Consensus        82 ~vL~~aT~~---GRdlA~rlAarL~~gl~aD~~~l~~~~~~l~~~r~~~gG~~~~~~~~~~~~~~~tvrpg~~~~~~~  156 (312)
T PRK11916         82 MLLLAATKR---GKALAARLSVQLNAALVNDATAVDIVDGHICAEHRMYGGLAFAQEKINSPLAIITLAPGVQEPCTS  156 (312)
T ss_pred             EEEECCCCC---HHHHHHHHHHHHCCCCCCCEEEEEECCCCEEEEEECCCCEEEEEEEECCCCEEEEECCCCCCCCCC
T ss_conf             999867811---667899999984998254249987169957998411477158998708995799989866666767


No 9  
>cd01715 ETF_alpha The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases. ETF transfers electrons to the main respiratory chain via ETF-ubiquinone oxidoreductase. ETF is an heterodimer that consists of an alpha and a beta subunit which binds one molecule of FAD per dimer . A similar system also exists in some bacteria.  The homologous pair of proteins (FixA/FixB) are essential for nitrogen fixation. The alpha subunit of ETF is structurally related to the bacterial nitrogen fixation protein fixB which could play a role in a redox process and feed electrons to ferredoxin.
Probab=99.12  E-value=1e-08  Score=76.21  Aligned_cols=137  Identities=24%  Similarity=0.242  Sum_probs=107.0

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECC--CCCCHHHHHHHHHHHHHCCCCCE
Q ss_conf             2601368999999998559985289999714101588888785077762376336--54788999999999861268649
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESN--ETLEPLSIAKILREIVKKENPII  112 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~--~~~D~~~~A~~La~~i~~~~~DL  112 (249)
                      +++.-.-++-.|-+|     |++++++.+|+. .++...+..+.|+|+.+++.++  ...++...+.+|++++++.+|++
T Consensus        13 l~~~s~Ell~~A~~L-----~~~v~avv~G~~-~~~~~~~l~~~Ga~~V~~~~~~~l~~~~~~~~~~~l~~~~~~~~p~~   86 (168)
T cd01715          13 LRELTLEAVTAARKL-----GGEVTALVIGSG-AEAVAAALKAYGADKVLVAEDPALAHYLAEPYAPALVALAKKEKPSH   86 (168)
T ss_pred             ECHHHHHHHHHHHHH-----CCCEEEEEECCC-CHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCE
T ss_conf             988999999999985-----997699995785-44679998656988999956810204577899999999875239978


Q ss_pred             EEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEECCCCE--EEEEE-CCCEEEEEECCCCCC
Q ss_conf             999611358886128999999857961332443343286599998358967--99996-398899984355654
Q gi|254780368|r  113 VIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGT--MTMET-PLPAVITVDLNLNEP  183 (249)
Q Consensus       113 Il~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g~--e~v~~-~lPavisv~~~~n~P  183 (249)
                      ||++.   +....-+.|+||.+||.+++++|+.++.   .++++|...+|.  .++++ .-|+++|+..+.++|
T Consensus        87 Vl~~~---t~~grdlaprlAa~l~a~~vsdv~~l~~---~~~~~r~v~~Gk~~~~~~~~~~~~i~tvr~~sF~~  154 (168)
T cd01715          87 ILAGA---TSFGKDLAPRVAAKLDVGLISDVTALED---DLTFTRPIYAGNALATVKSPDRPKVATVRPGAFPA  154 (168)
T ss_pred             EEECC---CHHHHHHHHHHHHHHCCCEECCEEEECC---CCEEEEECCCCEEEEEEEECCCCEEEEECCCCCCC
T ss_conf             99648---8758789999999869872442599548---99999753688079999948998899999987557


No 10 
>PRK03363 fixB putative electron transfer flavoprotein FixB; Provisional
Probab=98.99  E-value=8.6e-08  Score=70.32  Aligned_cols=146  Identities=12%  Similarity=0.115  Sum_probs=104.7

Q ss_pred             EECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCC-CCCHHHHHHHHHHHHHCCCC-
Q ss_conf             3326013689999999985599852899997141015888887850777623763365-47889999999998612686-
Q gi|254780368|r   33 ISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNE-TLEPLSIAKILREIVKKENP-  110 (249)
Q Consensus        33 ~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~-~~D~~~~A~~La~~i~~~~~-  110 (249)
                      |++.+.++.+.| -+-...+ .|.++.++.+|....+    .+.+.|||+.+.+.+.. ..-....+.++++.+++..+ 
T Consensus         8 wVf~e~~~~~~E-Ll~~Ar~-L~~~v~a~v~~~~~~~----~~~~~GAd~V~~v~~~~~~~~~~~ya~~~~~~i~~~~~~   81 (313)
T PRK03363          8 WVFSDTPSRLPE-LMNGAQA-LANQINAFVLNDADGA----QAIQLGANHVWKLSGKPDDRMIEDYAGVMADTIRQHGAD   81 (313)
T ss_pred             EEEEECCCCHHH-HHHHHHH-HCCEEEEEEECCCCHH----HHHHHCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             999856686899-9999998-6682579996560288----999708989999457622333468999999999975999


Q ss_pred             CEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEECCCCE--EEEEECCC-EEEEEECCCCCCCCCC
Q ss_conf             49999611358886128999999857961332443343286599998358967--99996398-8999843556545469
Q gi|254780368|r  111 IIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGT--MTMETPLP-AVITVDLNLNEPRYIS  187 (249)
Q Consensus       111 DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g~--e~v~~~lP-avisv~~~~n~PR~ps  187 (249)
                      ++||.|.-   .....+.|++|.+|+.++++.++.++++++.+.++|...+|.  ....+..| .++|+..+..+|.-|.
T Consensus        82 ~ivL~~aT---~~GrdlAprlAarl~~gl~aD~t~l~~~~~~~~~~~~~~gG~~~~~~~~~~~~~~~Tvrpg~f~~~~~~  158 (313)
T PRK03363         82 GLVLLPNT---RRGKLLAAKLGYRLKAAVSNDASTVSVQDGKATVKHMVYGGLAIGEERIATPYAVLTISSGTFDAAQPD  158 (313)
T ss_pred             CEEEECCC---HHHHHHHHHHHHHHCCCCCCCEEEEEECCCCEEEEECCCCHHHEEEEEECCCCEEEEECCCCCCCCCCC
T ss_conf             59998488---217889999999739871546479986599626993335513179999889984999899987877688


No 11 
>COG2025 FixB Electron transfer flavoprotein, alpha subunit [Energy production and conversion]
Probab=98.93  E-value=9.6e-08  Score=70.01  Aligned_cols=140  Identities=25%  Similarity=0.281  Sum_probs=112.4

Q ss_pred             ECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCC--CCCHHHHHHHHHHHHHCCCCC
Q ss_conf             326013689999999985599852899997141015888887850777623763365--478899999999986126864
Q gi|254780368|r   34 SMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNE--TLEPLSIAKILREIVKKENPI  111 (249)
Q Consensus        34 ~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~--~~D~~~~A~~La~~i~~~~~D  111 (249)
                      .+++.....+..|-+|.      +|.++.+|.    ..-..+.+.|+|+.+.++...  ...+...+.+|...+++..+|
T Consensus        13 ~l~~~s~el~~~A~~l~------~v~~vv~g~----~~~~~~~~~Gad~v~~~e~~~~~~~~~e~~~~~l~~l~~~~~p~   82 (313)
T COG2025          13 RLSPVSLELLTAARKLG------DVAAVVIGE----GAAAAAKAYGADKVLVAEGPELANYLPEPYADALVDLAKKYKPD   82 (313)
T ss_pred             CCCCCCHHHHHHHHHCC------CEEEEEECH----HHHHHHHHCCCCEEEEECCCCHHCCCHHHHHHHHHHHHHHCCCC
T ss_conf             52520199999987309------648999652----88888875498789996166320053258999999999846998


Q ss_pred             EEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEECCCCE--EEEEE--CCCEEEEEECCCCCCCCCC
Q ss_conf             9999611358886128999999857961332443343286599998358967--99996--3988999843556545469
Q gi|254780368|r  112 IVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGT--MTMET--PLPAVITVDLNLNEPRYIS  187 (249)
Q Consensus       112 LIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g~--e~v~~--~lPavisv~~~~n~PR~ps  187 (249)
                      .||.|.-+...   .+.+++|.+|+.+.++.++++++.++ ++.+|...+|.  .++++  +.|.++|+-.+..+|.-+.
T Consensus        83 ~il~~aT~~Gk---~la~rvAa~l~~~~~~D~~~l~~~~~-l~~~Rp~ygG~~i~~~~~~~~~~~v~Tvr~g~~~~~~~~  158 (313)
T COG2025          83 VVLLPATTNGK---ELAPRVAARLDVGLIADVTSLDVGDG-LTFTRPIYGGNAIATVISPSGRPAVITVRPGVFAAAAAA  158 (313)
T ss_pred             EEEECCCCCHH---HHHHHHHHHHCCCCEEEEEEEECCCC-CEEEEEECCCEEEEEEECCCCCCEEEEECCCCCCCCCCC
T ss_conf             79975776367---78999999808871578999974896-179852034300489864799836999766566777777


No 12 
>KOG3954 consensus
Probab=97.58  E-value=0.0065  Score=38.94  Aligned_cols=142  Identities=20%  Similarity=0.188  Sum_probs=99.5

Q ss_pred             CCEECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHC-CCCCEEEECC--CCCCHHHHHHHHHHHHHC
Q ss_conf             7733260136899999999855998528999971410158888878507-7762376336--547889999999998612
Q gi|254780368|r   31 TKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMG-ADRGILIESN--ETLEPLSIAKILREIVKK  107 (249)
Q Consensus        31 ~~~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmG-aD~ai~i~d~--~~~D~~~~A~~La~~i~~  107 (249)
                      -.-.++|.-.+++++|-+|     |++|+++-.|....+-+=.-+-..| ..+.+...++  ++.-|-..+..|-+..++
T Consensus        30 ~~g~l~p~tls~i~AA~kl-----g~~vs~lv~Gs~~~k~ae~~ak~~~~v~kvlvae~~k~~~~lpe~lapl~~~~~kq  104 (336)
T KOG3954          30 QNGSLSPITLSTITAAKKL-----GGDVSVLVAGSKASKAAEALAKVVGDVKKVLVAEDDKLEGNLPEQLAPLLLANQKQ  104 (336)
T ss_pred             CCCCCCCHHHHHHHHHHHC-----CCCEEEEEECCCCHHHHHHHHHHCCCHHEEEEEECCHHCCCCHHHHHHHHHHHHHC
T ss_conf             6984361016889999871-----89659999557406999999864354124899625111156667768899998744


Q ss_pred             CCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEECCCC--EEEEEEC-CCEEEEEECCCCCC
Q ss_conf             6864999961135888612899999985796133244334328659999835896--7999963-98899984355654
Q gi|254780368|r  108 ENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHG--TMTMETP-LPAVITVDLNLNEP  183 (249)
Q Consensus       108 ~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g--~e~v~~~-lPavisv~~~~n~P  183 (249)
                      .+|.-|+.|.-+--.+   |-|++|.+|+...++.|+.+.-.+   +..|-+..|  +-++++. -++++|+-...+.|
T Consensus       105 ~~yshi~a~~SafGK~---vlPRvaA~lDV~pIsdvi~i~s~d---tFvRpiYAGNa~~tv~~~~~~k~ltvR~tsF~~  177 (336)
T KOG3954         105 FDYSHILAGSSAFGKN---VLPRVAAKLDVSPISDVIGIKSAD---TFVRPIYAGNAICTVKCKAPIKLLTVRATSFPP  177 (336)
T ss_pred             CCEEEEEECCCCCCCC---CHHHHHHHHCCCCHHHEEEECCCC---CEEEEEECCCEEEEEECCCCCEEEEEECCCCCC
T ss_conf             8726898315412554---025577660664310126751675---345444036447899717871699996454787


No 13 
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea . Na+/H+ exchange proteins eject protons from cells, effectively eliminating excess acid from actively metabolising cells. Na+ /H+ exchange activity is also crucial for the regulation of cell volume, and for the reabsorption of NaCl across renal, intestinal, and other epithelia. These antiports exchange Na+ for H+ in an electroneutral manner, and this activity is carried out by a family of Na+ /H+ exchangers, or NHEs, which are known to be present in both prokaryotic and eukaryotic cells.  These exchangers are highly-regulated (glyco)phosphoproteins, which, based on their primary structure, appear to contain 10-12 membrane-spanning regions (M) at the N-terminus and a large cytoplasmic region at the C-terminus. The transmembrane regions M3-M12 share identity wit h other members of the family. The M6 and M7 regions are highly conserved. Thus, this is thought to be the regio
Probab=95.99  E-value=0.027  Score=34.94  Aligned_cols=104  Identities=12%  Similarity=0.083  Sum_probs=62.6

Q ss_pred             CEECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCC--------------HHHHHHHHHHHHCCCCCEEEECCC--CCCHH
Q ss_conf             73326013689999999985599852899997141--------------015888887850777623763365--47889
Q gi|254780368|r   32 KISMNPFDEIALEESLQLREKGIATEVIVVSIGSC--------------KVEEVLKNSLAMGADRGILIESNE--TLEPL   95 (249)
Q Consensus        32 ~~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~--------------~~~~~Lr~alAmGaD~ai~i~d~~--~~D~~   95 (249)
                      +.--+++.+.|++.|..|.++ .++++.++++=+.              ..++.++++........+.+....  ..++ 
T Consensus         5 pvd~s~~s~~al~~A~~la~~-~~a~l~~lhVv~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~-   82 (132)
T cd01988           5 PVANPNTARDLLELAAALARA-QNGEIIPLNVIEVPNHSSPSQLEVNVQRARKLLRQAERIAASLGVPVHTIIRIDHDI-   82 (132)
T ss_pred             ECCCCHHHHHHHHHHHHHHHH-CCCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCH-
T ss_conf             728988999999999999987-699899999984587678556678999999999999999987699569999977997-


Q ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCC----CCCEEHHHHHHHHHCCCC
Q ss_conf             99999999861268649999611358----886128999999857961
Q gi|254780368|r   96 SIAKILREIVKKENPIIVIAGKQTTD----NESNQTGQMLAALMRWPQ  139 (249)
Q Consensus        96 ~~A~~La~~i~~~~~DLIl~G~~S~D----~~~g~v~~~lA~~Lg~p~  139 (249)
                        +..|..++++.+.|||++|.+.-.    .--|.+...+-..-..|-
T Consensus        83 --~~~I~~~a~e~~~DlIVmG~~g~~~~~~~~lGSv~~~V~~~a~cpV  128 (132)
T cd01988          83 --ASGILRTAKERQADLIIMGWHGSTSLRDRLFGGVIDQVLESAPCDV  128 (132)
T ss_pred             --HHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCE
T ss_conf             --9999999998499999983799987542444757999984599988


No 14 
>cd00293 USP_Like Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity.
Probab=95.79  E-value=0.082  Score=31.86  Aligned_cols=97  Identities=15%  Similarity=0.242  Sum_probs=59.9

Q ss_pred             CCHHHHHHHHHHHHHHCCCCCCEEEEEECCCH--------------HHHHHHHHHHHCCCCCEEEECCC-CCCHHHHHHH
Q ss_conf             60136899999999855998528999971410--------------15888887850777623763365-4788999999
Q gi|254780368|r   36 NPFDEIALEESLQLREKGIATEVIVVSIGSCK--------------VEEVLKNSLAMGADRGILIESNE-TLEPLSIAKI  100 (249)
Q Consensus        36 n~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~--------------~~~~Lr~alAmGaD~ai~i~d~~-~~D~~~~A~~  100 (249)
                      ++....|++.|+++..+ .+++++++++-+..              ..+.|.+....-....+.+...- ..++   +..
T Consensus         9 s~~s~~al~~a~~la~~-~~~~l~~v~v~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~---~~~   84 (130)
T cd00293           9 SEESERALRWAARLARR-LGAELVLLHVVDPPPSSAAELAELLEEEARALLEALREALAEAGVKVETVVLEGDP---AEA   84 (130)
T ss_pred             CHHHHHHHHHHHHHHHH-CCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCH---HHH
T ss_conf             98999999999999987-29979999997288655301446789999999999999854279838999994661---899


Q ss_pred             HHHHHHCCCCCEEEEEECCCCCCCE-EHHHHHHHHHC
Q ss_conf             9998612686499996113588861-28999999857
Q gi|254780368|r  101 LREIVKKENPIIVIAGKQTTDNESN-QTGQMLAALMR  136 (249)
Q Consensus       101 La~~i~~~~~DLIl~G~~S~D~~~g-~v~~~lA~~Lg  136 (249)
                      |.+.+++.++|+|++|......-.+ ..|......+.
T Consensus        85 i~~~a~~~~~dliV~G~~~~~~~~~~~~gs~~~~v~~  121 (130)
T cd00293          85 ILEAAEELGADLIVMGSRGRSGLRRLLLGSVAERVLR  121 (130)
T ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCCCCCCHHHHHHH
T ss_conf             9887776118899994799975445602719999983


No 15 
>PRK11175 universal stress protein UspE; Provisional
Probab=95.24  E-value=0.13  Score=30.66  Aligned_cols=98  Identities=14%  Similarity=0.081  Sum_probs=55.6

Q ss_pred             ECCCHHHHHHHHHHHHHHCCCCCCEEEEEECC-----------CHHHHHH------------HHHHHHCCCCCEEEECCC
Q ss_conf             32601368999999998559985289999714-----------1015888------------887850777623763365
Q gi|254780368|r   34 SMNPFDEIALEESLQLREKGIATEVIVVSIGS-----------CKVEEVL------------KNSLAMGADRGILIESNE   90 (249)
Q Consensus        34 ~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~-----------~~~~~~L------------r~alAmGaD~ai~i~d~~   90 (249)
                      --++.++.||+.|++|..+ .|.+++++.+=+           ....+.+            ++.+..-.+.++.+...-
T Consensus        11 D~s~~s~~Al~rA~~LA~~-~~A~l~ll~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~g~~v~~~v   89 (304)
T PRK11175         11 DPNQDDQPALARAVYLAQR-SGAKITAFLSIYDFSYEMTTLLSPDEREAMRQGVISQRTAWIQEQAKPYLDAGVPIDIKV   89 (304)
T ss_pred             CCCHHHHHHHHHHHHHHHH-HCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             9974329999999999998-599899999960677310134782569999999999999999999999974698710799


Q ss_pred             --CCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHH
Q ss_conf             --478899999999986126864999961135888612899999985
Q gi|254780368|r   91 --TLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALM  135 (249)
Q Consensus        91 --~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~L  135 (249)
                        ..+++   ..|.+.+.+.++|||+.|.+..++-.+.+-+-+++.|
T Consensus        90 ~~~~~p~---~~Ii~~a~~~~~DLVV~g~~~~~~l~~~l~gs~~~~l  133 (304)
T PRK11175         90 VWHNRPF---EAIIQEVIKGKHDLVVKMTHQHDKLESVIFTPTDWHL  133 (304)
T ss_pred             EECCCHH---HHHHHHHHHCCCCEEEECCCCCCHHHHHHHCHHHHHH
T ss_conf             9889879---9999999975998999877776234433005158999


No 16 
>LOAD_USPA consensus
Probab=94.99  E-value=0.18  Score=29.75  Aligned_cols=100  Identities=18%  Similarity=0.292  Sum_probs=61.6

Q ss_pred             ECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHH-----------------HHHHHHHHHHCCCCC----EEEECCCCC
Q ss_conf             32601368999999998559985289999714101-----------------588888785077762----376336547
Q gi|254780368|r   34 SMNPFDEIALEESLQLREKGIATEVIVVSIGSCKV-----------------EEVLKNSLAMGADRG----ILIESNETL   92 (249)
Q Consensus        34 ~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~-----------------~~~Lr~alAmGaD~a----i~i~d~~~~   92 (249)
                      -.++....|++.|+++..+ .+.+++++++-+...                 ...+.+....-.+..    .++  ..+ 
T Consensus         8 d~s~~s~~a~~~A~~la~~-~~a~l~~lhV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i--~~g-   83 (135)
T LOAD_USPA         8 DGSPESEKALRWAVDLAKR-RGAELILLHVIPPSVSTAASPALDLALLLEEALKLLEEALELLEEAGVKIDVEV--EEG-   83 (135)
T ss_pred             CCCHHHHHHHHHHHHHHHH-CCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE--EEE-
T ss_conf             6998999999999999987-499899999962776444444201468999999999999999986399739999--996-


Q ss_pred             CHHHHHHHHHHHHHCCCCCEEEEEECCCCCC----CEEHHHHHHHHHCCCCE
Q ss_conf             8899999999986126864999961135888----61289999998579613
Q gi|254780368|r   93 EPLSIAKILREIVKKENPIIVIAGKQTTDNE----SNQTGQMLAALMRWPQA  140 (249)
Q Consensus        93 D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~----~g~v~~~lA~~Lg~p~v  140 (249)
                      ++   +..|..+++..++|||++|.+.-.+-    .|.+.-.+......|.+
T Consensus        84 ~~---~~~I~~~~~~~~~dliVmG~~~~~~~~~~~~Gs~~~~vi~~~~~pvl  132 (135)
T LOAD_USPA        84 SP---AEAILELAEESNADLIVVGSRGRGGLRRLLLGSVSEKVLRKAPCPVL  132 (135)
T ss_pred             CC---HHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHCCCCCEE
T ss_conf             42---89999998605776799946899752246037299999962899999


No 17 
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family. The family of KdpD sensor kinase proteins regulates the kdpFABC operon responsible for potassium transport. The USP domain is homologous to the universal stress protein Usp Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity.
Probab=94.88  E-value=0.16  Score=29.97  Aligned_cols=78  Identities=17%  Similarity=0.252  Sum_probs=54.7

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCH-------HHHHHH----HHHHHCCCCCEEEECCCCCCHHHHHHHHHH
Q ss_conf             260136899999999855998528999971410-------158888----878507776237633654788999999999
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIATEVIVVSIGSCK-------VEEVLK----NSLAMGADRGILIESNETLEPLSIAKILRE  103 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~-------~~~~Lr----~alAmGaD~ai~i~d~~~~D~~~~A~~La~  103 (249)
                      -+|+.+.++..|.+|.++ .+++.+++++-++.       ....|.    -|=.+|++- +.+.   +-|+   +..|..
T Consensus         8 ~s~~s~~lir~a~rlA~~-~~a~l~vl~V~~~~~~~~~~~~~~~l~~~~~la~~lga~~-~~~~---~~d~---~~~I~~   79 (124)
T cd01987           8 GGPNAERLIRRAARLADR-LKAPWYVVYVETPRLNRLSEAERRRLAEALRLAEELGAEV-VTLP---GDDV---AEAIVE   79 (124)
T ss_pred             CCHHHHHHHHHHHHHHHH-CCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEE-EEEE---CCCH---HHHHHH
T ss_conf             985079999999999996-4998999999559756589799999999999999859989-9994---7998---999999


Q ss_pred             HHHCCCCCEEEEEECCC
Q ss_conf             86126864999961135
Q gi|254780368|r  104 IVKKENPIIVIAGKQTT  120 (249)
Q Consensus       104 ~i~~~~~DLIl~G~~S~  120 (249)
                      +++..+.|+|+.|...-
T Consensus        80 ~A~~~~~t~IVlG~~~~   96 (124)
T cd01987          80 FAREHNVTQIVVGKSRR   96 (124)
T ss_pred             HHHHCCCCEEEECCCCC
T ss_conf             99984998999768988


No 18 
>PRK10116 universal stress protein UspC; Provisional
Probab=93.67  E-value=0.38  Score=27.58  Aligned_cols=83  Identities=16%  Similarity=0.264  Sum_probs=50.4

Q ss_pred             ECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCH-H------------HHHH----HHHHH-HCCCCCEEEECC--CCCC
Q ss_conf             3260136899999999855998528999971410-1------------5888----88785-077762376336--5478
Q gi|254780368|r   34 SMNPFDEIALEESLQLREKGIATEVIVVSIGSCK-V------------EEVL----KNSLA-MGADRGILIESN--ETLE   93 (249)
Q Consensus        34 ~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~-~------------~~~L----r~alA-mGaD~ai~i~d~--~~~D   93 (249)
                      -+++..+.+++.|.+|.++ .+++++.+++.... .            ...+    ++.|. .+..-.+-+...  ...+
T Consensus        11 DlS~~S~~~i~kA~~lA~~-~~AklslihV~~~~~~y~~~~~~~~~d~~~~~~e~a~~~L~~l~~~~~~pi~~~~v~~G~   89 (142)
T PRK10116         11 AVTPESQQLLAKAVSIARP-VNGKISLITLASDPEMYNQFAAPMLEDLRSVMQEETQSFLDELIQKADYPIEKTFIAYGE   89 (142)
T ss_pred             CCCHHHHHHHHHHHHHHHH-CCCEEEEEEEECCHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECC
T ss_conf             1885069999999999998-199899999935766652102213788999999999999999998749981589999658


Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEEECCC
Q ss_conf             899999999986126864999961135
Q gi|254780368|r   94 PLSIAKILREIVKKENPIIVIAGKQTT  120 (249)
Q Consensus        94 ~~~~A~~La~~i~~~~~DLIl~G~~S~  120 (249)
                      +   +..|.+.+++.+.|||+||.+.-
T Consensus        90 ~---~~~I~~~a~e~~~DLIV~G~Hg~  113 (142)
T PRK10116         90 L---SEHILEVCRKHHFDLVICGNHNH  113 (142)
T ss_pred             H---HHHHHHHHHHHCCCEEEEECCCC
T ss_conf             8---99999999996999999905985


No 19 
>TIGR01278 DPOR_BchB light-independent protochlorophyllide reductase, B subunit; InterPro: IPR005969    Synonym: dark protochlorophyllide reductase    Protochlorophyllide reductase catalyzes the reductive formation of chlorophyllide from protochlorophyllide during biosynthesis of chlorophylls and bacteriochlorophylls. The light-independent (dark) form of protochlorophyllide reductase plays a key role in the ability of gymnosperms, algae, and photosynthetic bacteria to form chlorophyll in the dark. Genetic and sequence analyses have indicated that dark protochlorophyllide reductase consists of three protein subunits that exhibit significant sequence similarity to the three subunits of nitrogenase, which catalyzes the reductive formation of ammonia from dinitrogen. Dark protochlorophyllide reductase activity was shown to be dependent on the presence of all three subunits, ATP, and the reductant dithionite .; GO: 0016730 oxidoreductase activity acting on iron-sulfur proteins as donors, 0015995 chlorophyll biosynthetic process, 0019685 photosynthesis dark reaction.
Probab=91.31  E-value=1.2  Score=24.28  Aligned_cols=19  Identities=37%  Similarity=0.520  Sum_probs=9.4

Q ss_pred             CCCHHHHHHHHHHHHHHCC
Q ss_conf             2601368999999998559
Q gi|254780368|r   35 MNPFDEIALEESLQLREKG   53 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~   53 (249)
                      |=||-|+++..|-=|+|+.
T Consensus       219 I~pYrE~G~~aA~YL~E~F  237 (562)
T TIGR01278       219 IAPYREIGLMAAEYLKEKF  237 (562)
T ss_pred             CCCCHHHHHHHHHHHHHHC
T ss_conf             3552558999999998745


No 20 
>pfam00582 Usp Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.
Probab=90.98  E-value=0.44  Score=27.15  Aligned_cols=97  Identities=16%  Similarity=0.210  Sum_probs=55.6

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHH------------HH----HHHH--------HHCCCCCEEEECCC
Q ss_conf             260136899999999855998528999971410158------------88----8878--------50777623763365
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEE------------VL----KNSL--------AMGADRGILIESNE   90 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~------------~L----r~al--------AmGaD~ai~i~d~~   90 (249)
                      -++...+|++.|+++... .+++++++++-+.....            ..    ...+        ..+.+.-+++.  .
T Consensus        11 ~s~~s~~al~~A~~~a~~-~~~~l~llhv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~   87 (140)
T pfam00582        11 GSEESERALEWALELAKR-RGAELILLHVIDPEPSGAASEALEEEEEEELEEEEAEAEALAEAAAEAGGVVVEVVVR--G   87 (140)
T ss_pred             CCHHHHHHHHHHHHHHHH-CCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEE--E
T ss_conf             999999999999999986-4997999999628875544433303579999999999999999986357986799999--6


Q ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCC----EEHHHHHHHHHCCC
Q ss_conf             4788999999999861268649999611358886----12899999985796
Q gi|254780368|r   91 TLEPLSIAKILREIVKKENPIIVIAGKQTTDNES----NQTGQMLAALMRWP  138 (249)
Q Consensus        91 ~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~----g~v~~~lA~~Lg~p  138 (249)
                      + +   ....|..++++.++|||++|.+.-.+-.    |.+...+...-..|
T Consensus        88 g-~---~~~~I~~~~~~~~~dliV~G~~~~~~~~~~~~Gs~s~~v~~~~~~p  135 (140)
T pfam00582        88 G-D---PAEAILEVAEEEDADLIVMGSRGRSGLRRLLLGSVAEKVLRHAPCP  135 (140)
T ss_pred             E-C---HHHHHCEEECCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHCCCCC
T ss_conf             0-7---0364210000567888999289998644650173999999548998


No 21 
>TIGR02076 pyrH_arch uridylate kinase, putative; InterPro: IPR011818   Uridylate kinases (also known as UMP kinases) are key enzymes in the synthesis of nucleoside triphosphates. They catalyse the reversible transfer of the gamma-phosphoryl group from an ATP donor to UMP, yielding UDP, which is the starting point for the synthesis of all other pyrimidine nucleotides. The eukaryotic enzyme has a dual specificity, phosphorylating both UMP and CMP, while the bacterial enzyme is specific to UMP. The bacterial enzyme shows no sequence similarity to the eukaryotic enzyme or other nucleoside monophosphate kinases, but rather appears to be part of the amino acid kinase family. It is dependent on magnesium for activity and is activated by GTP and repressed by UTP , . In many bacterial genomes, the gene tends to be located immediately downstream of elongation factor T and upstream of ribosome recycling factor. A related protein family, believed to be equivalent in function is found in the archaea and in spirochetes.   Structurally, the bacterial and archaeal proteins are homohexamers centred around a hollow nucleus and organised as a trimer of dimers , . Each monomer within the protein forms the amino acid kinase fold and can be divided into an N-terminal region which binds UMP and mediates intersubunit interactions within the dimer, and a C-terminal region which binds ATP and contains a mobile loop covering the active site. Inhibition of enzyme activity by UTP appears to be due to competition for the binding site for UMP, not allosteric inhibition as was previously suspected.   This entry represents the archaeal and spirochete proteins.; GO: 0009041 uridylate kinase activity, 0006221 pyrimidine nucleotide biosynthetic process.
Probab=90.86  E-value=1.4  Score=24.00  Aligned_cols=107  Identities=19%  Similarity=0.162  Sum_probs=78.2

Q ss_pred             HHHHHHHHHHHHHCCCC---CCEEEEEECCCHHHHHHHHHHHH--CCCCCEEEECCCCC-CHHHHHHHHHHHHHCC----
Q ss_conf             36899999999855998---52899997141015888887850--77762376336547-8899999999986126----
Q gi|254780368|r   39 DEIALEESLQLREKGIA---TEVIVVSIGSCKVEEVLKNSLAM--GADRGILIESNETL-EPLSIAKILREIVKKE----  108 (249)
Q Consensus        39 D~~AlE~Al~lke~~~g---~~V~~lsvG~~~~~~~Lr~alAm--GaD~ai~i~d~~~~-D~~~~A~~La~~i~~~----  108 (249)
                      -++=.+.|-.|++-...   -+|-+++=|+.-|-+-+.-|=.+  |+++..+  |+=|- -|.-.|..|..+++..    
T Consensus        17 ~e~~~~~A~~l~~~~~~Gek~~v~vVvGGG~~AR~YI~~aR~lnPG~~E~~l--D~iGI~~TRLNA~LLi~aL~~~a~p~   94 (232)
T TIGR02076        17 AEKIKEYANILRKLSDEGEKHKVGVVVGGGKTAREYIGVARELNPGASETFL--DEIGIDATRLNAMLLIAALGDDAYPK   94 (232)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHCCCCCCHHH--HHHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             7899999999999984499468998878876588999999860888880245--67779999999999998716335898


Q ss_pred             -------------CCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEE
Q ss_conf             -------------864999961135888612899999985796133244334
Q gi|254780368|r  109 -------------NPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIK  147 (249)
Q Consensus       109 -------------~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~  147 (249)
                                   .+.+++||=-..-..|-.|+++|||+++--.+-++++++
T Consensus        95 vP~~~~EA~~~~~~~~ivVmGGt~PGhtTDAVAA~lAE~~~ad~L~~~TnVD  146 (232)
T TIGR02076        95 VPENFEEALEAMSLGKIVVMGGTEPGHTTDAVAALLAEFLEADLLINATNVD  146 (232)
T ss_pred             CCCCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             9889899999982698798668789852899999997662687269982268


No 22 
>cd01977 Nitrogenase_VFe_alpha Nitrogenase_VFe_alpha -like: Nitrogenase VFe protein, alpha subunit like. This group contains proteins similar to the alpha subunits of,  the VFe protein of the vanadium-dependent (V-) nitrogenase and the FeFe protein of the iron only (Fe-) nitrogenase Nitrogenase catalyzes the ATP-dependent reduction of dinitrogen (N2) to ammonia. In addition to V- and Fe- nitrogenases there is a molybdenum (Mo)-dependent nitrogenase which is the most widespread and best characterized of these systems.  These systems consist of component 1 (VFe protein, FeFe protein or, MoFe protein  respectively) and, component 2 (Fe protein). MoFe is an alpha2beta2 tetramer, V-and Fe- nitrogenases are alpha2beta2delta2 hexamers. The alpha and beta subunits of VFe and FeFe are similar to the alpha and beta subunits of MoFe. For MoFe each alphabeta pair contains one P-cluster (at the alphabeta interface) and, one molecule of iron molybdenum cofactor (FeMoco) contained within the alpha sub
Probab=89.49  E-value=1.5  Score=23.82  Aligned_cols=20  Identities=10%  Similarity=0.194  Sum_probs=6.3

Q ss_pred             EEEEEECCCCCCCEEHHHHH
Q ss_conf             99996113588861289999
Q gi|254780368|r  112 IVIAGKQTTDNESNQTGQML  131 (249)
Q Consensus       112 LIl~G~~S~D~~~g~v~~~l  131 (249)
                      +-+.|.....++...+-.++
T Consensus       165 vNiig~~~~~gd~~eikrll  184 (415)
T cd01977         165 INYIGDYNIQGDTEVLQKYF  184 (415)
T ss_pred             EEEECCCCCCCCHHHHHHHH
T ss_conf             68837988855289999999


No 23 
>PRK03675 consensus
Probab=89.31  E-value=1.8  Score=23.20  Aligned_cols=130  Identities=16%  Similarity=0.138  Sum_probs=82.9

Q ss_pred             EEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHH---HHHHCCCCCCEEEEE--ECC-----------CHH
Q ss_conf             9860303887605980788816324877332601368999999---998559985289999--714-----------101
Q gi|254780368|r    5 VPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESL---QLREKGIATEVIVVS--IGS-----------CKV   68 (249)
Q Consensus         5 V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al---~lke~~~g~~V~~ls--vG~-----------~~~   68 (249)
                      +-+|+-||-+..+++...+..+--  +...-.|-|.+=+|.-+   .+|+. +..+||++.  +|.           +-+
T Consensus        24 ~e~~~FpDGE~~vri~e~g~dv~i--iqs~~~p~nd~lmELll~~dAlr~a-~A~~It~ViPY~~YaRQDr~~~~gepis  100 (279)
T PRK03675         24 VEIKKFPDGEKYVRVLENGDEAIV--VQSTYYPQDEKLIEALLLGDALREA-GFEKLKLVVPYLAYSRQDRVTKEGEPIS  100 (279)
T ss_pred             EEEEECCCCCEEEEECCCCCCEEE--ECCCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEEECCCCCCCCCCCCCCCCCHH
T ss_conf             378988999889986578982899--8789999736799999999999982-7872799934675232242247998614


Q ss_pred             HHHHHHHHHHCCCCCEEEECCC---------CCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCC
Q ss_conf             5888887850777623763365---------4788999999999861268649999611358886128999999857961
Q gi|254780368|r   69 EEVLKNSLAMGADRGILIESNE---------TLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQ  139 (249)
Q Consensus        69 ~~~Lr~alAmGaD~ai~i~d~~---------~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~  139 (249)
                      ...+-+.|++|+|+.+.++-..         ..+.+..+..|++++++...|.++.   |.|.++.+-.-.+|..||+++
T Consensus       101 ak~va~ll~~~~d~vitvDlH~~~i~~fF~~pv~~l~~~~~~~~~~~~~~~~~vVV---sPD~G~~~ra~~~A~~lg~~~  177 (279)
T PRK03675        101 VRAVMKMLGLYYDELYVFDIHNPKTLEFFPGKAVNIYPAKVIAEYFRDKLGEGLVL---APDKGALERAKAVAEVLGLEY  177 (279)
T ss_pred             HHHHHHHHHHHCCEEEEEECCCHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCCEEE---ECCCCHHHHHHHHHHHHCCCE
T ss_conf             99999997521276999826857776457996022016488899998508986899---789888999999998617865


Q ss_pred             E
Q ss_conf             3
Q gi|254780368|r  140 A  140 (249)
Q Consensus       140 v  140 (249)
                      .
T Consensus       178 ~  178 (279)
T PRK03675        178 S  178 (279)
T ss_pred             E
T ss_conf             7


No 24 
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily  including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF). The domain forms a apha/beta/apha fold which  binds to Adenosine nucleotide.
Probab=89.10  E-value=1.1  Score=24.65  Aligned_cols=63  Identities=19%  Similarity=0.327  Sum_probs=49.2

Q ss_pred             EECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCE
Q ss_conf             33260136899999999855998528999971410158888878507776237633654788999999999861268649
Q gi|254780368|r   33 ISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPII  112 (249)
Q Consensus        33 ~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~~~~DL  112 (249)
                      ..-+..+..++..|.+++  ..+.++.++.++                               ...+.+.+....++.|.
T Consensus         5 ~Sgg~dS~~~~~la~~~~--~~~~~~~~~~~~-------------------------------~~~~~~~~~~~~~~~~~   51 (86)
T cd01984           5 LSGGLDSSVLLHLAKRLK--SGGPEVVALVVV-------------------------------AFVRILKRLAAEEGADV   51 (86)
T ss_pred             ECCCCCHHHHHHHHHHHH--CCCCEEEEEEHH-------------------------------HHHHHHHHHHHHCCCCE
T ss_conf             617853899999999852--599808976389-------------------------------99999999877608988


Q ss_pred             EEEEECCCCCCCEEHH
Q ss_conf             9996113588861289
Q gi|254780368|r  113 VIAGKQTTDNESNQTG  128 (249)
Q Consensus       113 Il~G~~S~D~~~g~v~  128 (249)
                      |+.|.++.|......+
T Consensus        52 i~~G~~~~~~~~~~~~   67 (86)
T cd01984          52 IILGHNADDVAGRRLG   67 (86)
T ss_pred             EEECCCCHHHHHHCCC
T ss_conf             9986773245331016


No 25 
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family; InterPro: IPR014189   Members of this family are putative quinone oxidoreductases that belong to the broader superfamily of zinc-dependent alcohol (of medium chain length) dehydrogenases and quinone oxidoreductases. An alignment shows no motif of conserved Cys residues as are found in zinc-binding members of the superfamily, consequently members of this entry are likely to be quinone oxidoreductases. A member of this family in Homo sapiens (Human), PIG3, is induced by p53 but is otherwise uncharacterised..
Probab=87.69  E-value=1.3  Score=24.18  Aligned_cols=39  Identities=28%  Similarity=0.383  Sum_probs=29.5

Q ss_pred             HHHHHHHCCCCCCEEEEEECCCHHHHHHH-HHHHHCCCCCEEEEC
Q ss_conf             99999855998528999971410158888-878507776237633
Q gi|254780368|r   45 ESLQLREKGIATEVIVVSIGSCKVEEVLK-NSLAMGADRGILIES   88 (249)
Q Consensus        45 ~Al~lke~~~g~~V~~lsvG~~~~~~~Lr-~alAmGaD~ai~i~d   88 (249)
                      .|+||.-+ .|.+|. .|+|.   ++-++ -|.++|||.+|-..+
T Consensus       160 tAIqLAKA-~Ga~V~-~TaGS---~eK~~~a~~~LGAd~aINY~e  199 (334)
T TIGR02824       160 TAIQLAKA-FGARVF-TTAGS---DEKCATACEALGADIAINYRE  199 (334)
T ss_pred             HHHHHHHH-CCCEEE-EEECC---HHHHHHHHHHCCCEEEEECCC
T ss_conf             99999985-697599-98289---899999998609807860777


No 26 
>KOG0081 consensus
Probab=86.82  E-value=1.5  Score=23.72  Aligned_cols=68  Identities=25%  Similarity=0.328  Sum_probs=42.3

Q ss_pred             HHHHHHH---HHCCCCCEEEECCCCC-CHHHHHHHHHHHHHC---CCCCEEEEEECCCCCCCEEH----HHHHHHHHCCC
Q ss_conf             8888878---5077762376336547-889999999998612---68649999611358886128----99999985796
Q gi|254780368|r   70 EVLKNSL---AMGADRGILIESNETL-EPLSIAKILREIVKK---ENPIIVIAGKQTTDNESNQT----GQMLAALMRWP  138 (249)
Q Consensus        70 ~~Lr~al---AmGaD~ai~i~d~~~~-D~~~~A~~La~~i~~---~~~DLIl~G~~S~D~~~g~v----~~~lA~~Lg~p  138 (249)
                      .+|.+|.   |||.   +++-|-... .-+.+..-|++.-.+   ++||+|+||..+-=.+..+|    ...+|..+|+|
T Consensus        81 RSLTTAFfRDAMGF---lLiFDlT~eqSFLnvrnWlSQL~~hAYcE~PDivlcGNK~DL~~~R~Vs~~qa~~La~kyglP  157 (219)
T KOG0081          81 RSLTTAFFRDAMGF---LLIFDLTSEQSFLNVRNWLSQLQTHAYCENPDIVLCGNKADLEDQRVVSEDQAAALADKYGLP  157 (219)
T ss_pred             HHHHHHHHHHHCCC---EEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             88899999850111---588862533778879989999877401379998998671231666552399999999973998


Q ss_pred             CE
Q ss_conf             13
Q gi|254780368|r  139 QA  140 (249)
Q Consensus       139 ~v  140 (249)
                      ++
T Consensus       158 Yf  159 (219)
T KOG0081         158 YF  159 (219)
T ss_pred             EE
T ss_conf             26


No 27 
>PRK07199 phosphoribosylpyrophosphate synthetase; Provisional
Probab=86.75  E-value=2.6  Score=22.19  Aligned_cols=139  Identities=20%  Similarity=0.235  Sum_probs=83.5

Q ss_pred             EEEEEECCCCCCEEECCCCCEEEECCCCEEC----CCHHHHHHHHHHH---HHHCCCCCCEEEEE--E-----------C
Q ss_conf             9860303887605980788816324877332----6013689999999---98559985289999--7-----------1
Q gi|254780368|r    5 VPIKGVINYNTKVRIKNDYSGIETENTKISM----NPFDEIALEESLQ---LREKGIATEVIVVS--I-----------G   64 (249)
Q Consensus         5 V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~i----n~~D~~AlE~Al~---lke~~~g~~V~~ls--v-----------G   64 (249)
                      +-+++-||-+..+++..+-.    ..--+++    +| |++=+|.-+-   +|+. +..+||++.  +           |
T Consensus        29 ~~~~~F~DGE~~v~i~e~vr----g~dV~iiqs~~~p-nd~lmELll~idA~r~a-~A~~It~ViPY~~YaRQDr~~~~g  102 (301)
T PRK07199         29 ITLHRFPDGESYVRLDSGVA----GRTVVLVCSLDQP-DEKLLPLLFAAEAAREL-GARRVVLVAPYLAYMRQDIRFHPG  102 (301)
T ss_pred             EEEEECCCCCEEEEECCCCC----CCEEEEECCCCCC-CHHHHHHHHHHHHHHHC-CCCEEEEEECCCCHHCCCCCCCCC
T ss_conf             28998799988996179877----9838998899997-38899999999999874-887489981566210132234799


Q ss_pred             CCHHHHHHHHHHHHCCCCCEEEECC-------CC-----CCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHH
Q ss_conf             4101588888785077762376336-------54-----78899999999986126864999961135888612899999
Q gi|254780368|r   65 SCKVEEVLKNSLAMGADRGILIESN-------ET-----LEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLA  132 (249)
Q Consensus        65 ~~~~~~~Lr~alAmGaD~ai~i~d~-------~~-----~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA  132 (249)
                      .+-+...+-+.|++|+|+.+-+.-.       .+     .|-+.....|+.++++.-.|.++.   |.|.++..-...+|
T Consensus       103 e~isak~vA~ll~~~~d~vitvDlH~h~~~~i~~ff~ip~~nl~~~~~l~~~i~~~~~~~vvV---sPD~G~~~ra~~~a  179 (301)
T PRK07199        103 EAISSRHFARLLSGSFDRLITVDPHLHRYHSLSEVYPIPARVLHAAPAIAAWIRAHVPKPLLI---GPDSESEQWVSAVA  179 (301)
T ss_pred             CCCCHHHHHHHHHHHCCEEEEECCCCCCHHHHCCCCCCCCEEEEECHHHHHHHHHHCCCCEEE---CCCCCHHHHHHHHH
T ss_conf             851089999999852776899704532267752677898177670587899998518775367---88877799999999


Q ss_pred             HHHCCCCEEEEEEEEECCCEE
Q ss_conf             985796133244334328659
Q gi|254780368|r  133 ALMRWPQATFVSNIKIIDNHA  153 (249)
Q Consensus       133 ~~Lg~p~vt~v~~i~~~~~~~  153 (249)
                      ..||.|+. ...+-...+..+
T Consensus       180 ~~lg~~~~-~~~K~R~~~~~v  199 (301)
T PRK07199        180 GRAGAPHA-VLRKTRHGDRDV  199 (301)
T ss_pred             HHCCCCEE-EEEEEECCCCCC
T ss_conf             86599879-999886589863


No 28 
>PRK04117 consensus
Probab=85.94  E-value=2.9  Score=21.92  Aligned_cols=131  Identities=18%  Similarity=0.267  Sum_probs=81.2

Q ss_pred             EEEEEECCCCCCEEECCCCC--EEEECCCCEECCCHHHHHHHHHHH---HHHCCCCCCEEEEE--ECCCHHH--------
Q ss_conf             98603038876059807888--163248773326013689999999---98559985289999--7141015--------
Q gi|254780368|r    5 VPIKGVINYNTKVRIKNDYS--GIETENTKISMNPFDEIALEESLQ---LREKGIATEVIVVS--IGSCKVE--------   69 (249)
Q Consensus         5 V~vK~VpD~~~~i~i~~~~~--~i~~~~~~~~in~~D~~AlE~Al~---lke~~~g~~V~~ls--vG~~~~~--------   69 (249)
                      +.+++-||-+..+++..+-.  .+--  +...-.|-|++=+|.-+-   +|+. +..+||++.  +|..+.+        
T Consensus        30 ~~~~~FpDGE~~v~i~~~vrg~dV~i--vqs~~~p~nd~lmELll~~~a~r~a-gA~~It~ViPY~~YsRQDr~~~~ge~  106 (309)
T PRK04117         30 ATIKRFSDGEINVQISESVRGKDVFI--IQPTCAPANDNLMELLIMTDALRRS-SANSITAVVPYFGYARQDRKAAPRVP  106 (309)
T ss_pred             EEEEECCCCCEEEEECCCCCCCCEEE--ECCCCCCCHHHHHHHHHHHHHHHHC-CCCEEEEEECCCCCCCCCCCCCCCCC
T ss_conf             18898899988886688778998899--9179998248899999999999874-89738896035500214445699987


Q ss_pred             ---HHHHHHH-HHCCCCCEEEECCC---------CCCHHHHHHHHHHHHHCCC-CCEEEEEECCCCCCCEEHHHHHHHHH
Q ss_conf             ---8888878-50777623763365---------4788999999999861268-64999961135888612899999985
Q gi|254780368|r   70 ---EVLKNSL-AMGADRGILIESNE---------TLEPLSIAKILREIVKKEN-PIIVIAGKQTTDNESNQTGQMLAALM  135 (249)
Q Consensus        70 ---~~Lr~al-AmGaD~ai~i~d~~---------~~D~~~~A~~La~~i~~~~-~DLIl~G~~S~D~~~g~v~~~lA~~L  135 (249)
                         ..+=+.| ++|+|+.+.++-..         ..|-+..+..++.+++..+ .+.|+.   |.|.++-.-.-.+|+.|
T Consensus       107 isak~vA~lL~~~G~d~vitvDlH~~~i~~fF~ip~~~l~~~~~~~~~i~~~~~~~~vvV---sPD~Ga~~ra~~~A~~L  183 (309)
T PRK04117        107 ITAKLVANLMQAAGIDRVVTMDLHAGQIQGFFDIPVDNLYGSIVFRDYIKSKNLKNPIIA---SPDIGGVARARYFAKKL  183 (309)
T ss_pred             CCHHHHHHHHHHCCCCEEEEECCCHHHHHHCCCCCCCEEECCHHHHHHHHHHCCCCCEEE---CCCCHHHHHHHHHHHHC
T ss_conf             018999988864277658996178688740368973303453877899996188874697---15931999999998742


Q ss_pred             CCCCEE
Q ss_conf             796133
Q gi|254780368|r  136 RWPQAT  141 (249)
Q Consensus       136 g~p~vt  141 (249)
                      |+++..
T Consensus       184 g~~~~~  189 (309)
T PRK04117        184 GLDMVI  189 (309)
T ss_pred             CCCEEE
T ss_conf             788799


No 29 
>COG0503 Apt Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism]
Probab=82.30  E-value=4.1  Score=20.93  Aligned_cols=75  Identities=19%  Similarity=0.117  Sum_probs=54.9

Q ss_pred             HHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEECCCCEEEEEECCCE------E
Q ss_conf             9999861268649999611358886128999999857961332443343286599998358967999963988------9
Q gi|254780368|r  100 ILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPA------V  173 (249)
Q Consensus       100 ~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g~e~v~~~lPa------v  173 (249)
                      .+++..+..+.|.|+|=    ....=..+..+|..||.|++-.-..-.+-.++.......+.+.+++++..++      |
T Consensus        44 ~~~~~~~~~~id~Iv~i----ea~Gi~~a~~vA~~Lgvp~v~vRK~~kl~~~~~~~~~~~~~~~~~l~~~~~~l~~G~rV  119 (179)
T COG0503          44 ELAERYKDDGIDKIVTI----EARGIPLAAAVALELGVPFVPVRKKGKLPEESVVETYYLEYGSETLELHKDALKPGDRV  119 (179)
T ss_pred             HHHHHHCCCCCCEEEEE----CCCCCCHHHHHHHHHCCCEEEEEECCCCCCCCEEEEEEECCCEEEEEEEHHHCCCCCEE
T ss_conf             99998400599899997----37784049999998599889999568788643578998606417999872006899989


Q ss_pred             EEEEC
Q ss_conf             99843
Q gi|254780368|r  174 ITVDL  178 (249)
Q Consensus       174 isv~~  178 (249)
                      +-|+.
T Consensus       120 lIVDD  124 (179)
T COG0503         120 LIVDD  124 (179)
T ss_pred             EEEEC
T ss_conf             99965


No 30 
>TIGR01420 pilT_fam twitching motility protein; InterPro: IPR006321   These represent the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction . Members of this family may be found in some species that do not have type IV pili but have related structures for DNA uptake and natural transformation. ; GO: 0005524 ATP binding, 0006810 transport.
Probab=80.60  E-value=2.8  Score=22.06  Aligned_cols=106  Identities=22%  Similarity=0.391  Sum_probs=60.5

Q ss_pred             ECCC-CCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCC-------EEHHHHHHHHHCCCCEEEEE-E-EEEC-------
Q ss_conf             3365-4788999999999861268649999611358886-------12899999985796133244-3-3432-------
Q gi|254780368|r   87 ESNE-TLEPLSIAKILREIVKKENPIIVIAGKQTTDNES-------NQTGQMLAALMRWPQATFVS-N-IKII-------  149 (249)
Q Consensus        87 ~d~~-~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~-------g~v~~~lA~~Lg~p~vt~v~-~-i~~~-------  149 (249)
                      .-++ |+||..-+.+|.++++ ++||+||-|.-= |.+|       +++|=+|=.-|.=-.+.... + +++=       
T Consensus       178 ~QREvG~DT~sF~~ALraALR-eDPDvILiGE~R-D~ET~~~AL~AAETGHLV~gTLHTnsA~~ti~RIid~FP~~~~~q  255 (350)
T TIGR01420       178 NQREVGLDTLSFANALRAALR-EDPDVILIGEMR-DLETVELALTAAETGHLVFGTLHTNSAAKTIERIIDVFPAEEQEQ  255 (350)
T ss_pred             ECCCCCCCHHHHHHHHHHHHC-CCCCEEEEECCC-CHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHH
T ss_conf             436246754579999768410-289889982556-278999999874213156766664238887677742597756689


Q ss_pred             -----CCE-------EEEEEECCCCE---EEEEECCCEEEEEECCCCC-CCCCCHHHHHHHHHC
Q ss_conf             -----865-------99998358967---9999639889998435565-454698889988521
Q gi|254780368|r  150 -----DNH-------AIVTREVGHGT---MTMETPLPAVITVDLNLNE-PRYISLPNIIKARKK  197 (249)
Q Consensus       150 -----~~~-------~~v~r~~e~g~---e~v~~~lPavisv~~~~n~-PR~psl~~im~A~kk  197 (249)
                           .++       =.+.|..++|.   ..+=+..|+|   .+-+-+ -|+.-++..|+..+.
T Consensus       256 iR~~La~~L~Av~sQrL~p~~~G~GRv~~~Eil~~Tpav---~~lIre~gk~~qi~~~i~~G~~  316 (350)
T TIGR01420       256 IRTQLAESLVAVISQRLLPKKNGGGRVLAVEILINTPAV---RNLIREEGKTHQIKSVIQTGRA  316 (350)
T ss_pred             HHHHHHHHHHHHHCCCCEEECCCCCEEEEEEEECCCHHH---HHHHCCCCCHHHHHHHHHHCCC
T ss_conf             999998767877000542233896258888752158789---9960287887689999871430


No 31 
>PRK02304 adenine phosphoribosyltransferase; Provisional
Probab=78.06  E-value=5.7  Score=20.05  Aligned_cols=84  Identities=19%  Similarity=0.130  Sum_probs=55.4

Q ss_pred             CCEEEECCC--CCCHHHH---HHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEE
Q ss_conf             623763365--4788999---99999986126864999961135888612899999985796133244334328659999
Q gi|254780368|r   82 RGILIESNE--TLEPLSI---AKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVT  156 (249)
Q Consensus        82 ~ai~i~d~~--~~D~~~~---A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~  156 (249)
                      .+|+..|-.  -.||...   ...+++.++..++|.|.+ -   +...-..++.+|..||.|++.-=.+=.+.+..+..+
T Consensus        18 ~Gi~F~Ditpll~dp~~~~~~~~~l~~~~~~~~vD~Ivg-i---EarGfi~a~alA~~l~~p~v~iRK~gKLPg~~~s~~   93 (174)
T PRK02304         18 PGILFRDITPLLADPEALREVIDALVERYKDADIDKIVG-I---EARGFIFGAALAYKLGIGFVPVRKPGKLPGETISES   93 (174)
T ss_pred             CCCEEEECHHHHCCHHHHHHHHHHHHHHHCCCCCCEEEE-E---CCCCEECCHHHHHHHCCCEEEEECCCCCCCCEEEEE
T ss_conf             994688582476599999999999999843489989999-8---655521015889982998799972898998564512


Q ss_pred             EECCCCEEEEEEC
Q ss_conf             8358967999963
Q gi|254780368|r  157 REVGHGTMTMETP  169 (249)
Q Consensus       157 r~~e~g~e~v~~~  169 (249)
                      -..|.|..++++.
T Consensus        94 y~lEYG~~~lei~  106 (174)
T PRK02304         94 YELEYGTDTLEIH  106 (174)
T ss_pred             EECCCCCEEEEEE
T ss_conf             6736762169998


No 32 
>PRK02269 ribose-phosphate pyrophosphokinase; Provisional
Probab=77.94  E-value=5.7  Score=20.03  Aligned_cols=132  Identities=17%  Similarity=0.287  Sum_probs=80.2

Q ss_pred             EEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHH---HHHCCCCCCEEEEE--ECCCHH-----------
Q ss_conf             98603038876059807888163248773326013689999999---98559985289999--714101-----------
Q gi|254780368|r    5 VPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQ---LREKGIATEVIVVS--IGSCKV-----------   68 (249)
Q Consensus         5 V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~---lke~~~g~~V~~ls--vG~~~~-----------   68 (249)
                      +-+++-||-+..+++..+-.+=|-=-+...-+|-|++=+|.-+-   +|+. +..+||++.  +|..+.           
T Consensus        32 ~~~~~F~DGE~~v~i~e~vrg~dV~ivqs~~~pvnd~lmELll~idAlr~a-~A~~It~ViPY~~YaRQDr~~~~ge~is  110 (321)
T PRK02269         32 STVRQFSDGEIQVNIEESIRGHHVFILQSTSSPVNDNLMEILIMVDALKRA-SAESISVVMPYYGYARQDRKARSREPIT  110 (321)
T ss_pred             EEEEECCCCCEEEEECCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHC-CCCEEEEEECCCCCCCCCCCCCCCCCCH
T ss_conf             288988999889875787789808999079999537999999999999874-8973999813553130454457899726


Q ss_pred             HHHHHHHH-HHCCCCCEEEECCC---------CCCHHHHHHHHHHHHHCCC---CCEEEEEECCCCCCCEEHHHHHHHHH
Q ss_conf             58888878-50777623763365---------4788999999999861268---64999961135888612899999985
Q gi|254780368|r   69 EEVLKNSL-AMGADRGILIESNE---------TLEPLSIAKILREIVKKEN---PIIVIAGKQTTDNESNQTGQMLAALM  135 (249)
Q Consensus        69 ~~~Lr~al-AmGaD~ai~i~d~~---------~~D~~~~A~~La~~i~~~~---~DLIl~G~~S~D~~~g~v~~~lA~~L  135 (249)
                      ...+=+.| ++|+|+.+.+.-..         ..|-+..+..++.++++.+   .+.|+.   |.|.++..-.-.+|..|
T Consensus       111 ak~vA~lL~~~g~d~vitvDlH~~~i~gfF~ipv~~l~~~~~~~~~i~~~~~~~~~~vvV---sPD~G~~~ra~~~A~~l  187 (321)
T PRK02269        111 SKLVANMLEVAGVDRLLTVDLHAAQIQGFFDIPVDHLMGAPLIADYFDRHGLVGEDVVVV---SPDHGGVTRARKLAQFL  187 (321)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHCCCCCCCCEEECHHHHHHHHHHCCCCCCEEEE---CCCCHHHHHHHHHHHHC
T ss_conf             999999887448777999626747776326998411130389999999847987670897---17931999999999862


Q ss_pred             CCCCE
Q ss_conf             79613
Q gi|254780368|r  136 RWPQA  140 (249)
Q Consensus       136 g~p~v  140 (249)
                      |.|+.
T Consensus       188 ~~~~~  192 (321)
T PRK02269        188 KTPIA  192 (321)
T ss_pred             CCCEE
T ss_conf             78789


No 33 
>PRK04554 consensus
Probab=77.52  E-value=5.9  Score=19.95  Aligned_cols=132  Identities=14%  Similarity=0.186  Sum_probs=80.7

Q ss_pred             EEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHH---HHHCCCCCCEEEEE--ECCCHH-----------
Q ss_conf             98603038876059807888163248773326013689999999---98559985289999--714101-----------
Q gi|254780368|r    5 VPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQ---LREKGIATEVIVVS--IGSCKV-----------   68 (249)
Q Consensus         5 V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~---lke~~~g~~V~~ls--vG~~~~-----------   68 (249)
                      +-+++-||-+..+++..+-.+=|-=-+...-.|-+++=+|.-+-   +|+. +..++|++-  +|..+.           
T Consensus        33 ~~~~~F~DGE~~v~i~esVrg~dV~iiqs~~~~~nd~lmELll~idA~rra-~A~~It~ViPY~~YaRQDr~~~~gr~pI  111 (327)
T PRK04554         33 ASVSKFSDGEVAVELLENVRGRDVFILQPTCAPTNDNLMEILTMADALKRA-SAGRITTAIPYFGYARQDRRPRSVRVPI  111 (327)
T ss_pred             EEEEECCCCCEEEEECCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHC-CCCCEEEEECCCCCCCCCCCCCCCCCCC
T ss_conf             288988999888741787789818999179998247799999999999872-8872799944656433676657886751


Q ss_pred             -HHHHHHHH-HHCCCCCEEEECCC---------CCCHHHHHHHHHHHHHCCCC-CEEEEEECCCCCCCEEHHHHHHHHHC
Q ss_conf             -58888878-50777623763365---------47889999999998612686-49999611358886128999999857
Q gi|254780368|r   69 -EEVLKNSL-AMGADRGILIESNE---------TLEPLSIAKILREIVKKENP-IIVIAGKQTTDNESNQTGQMLAALMR  136 (249)
Q Consensus        69 -~~~Lr~al-AmGaD~ai~i~d~~---------~~D~~~~A~~La~~i~~~~~-DLIl~G~~S~D~~~g~v~~~lA~~Lg  136 (249)
                       ...+-+.| ++|+|+.+.+.-..         ..|.+.....|+.++++.++ ++|+.   |.|.++.+-...+|+.||
T Consensus       112 sak~vA~lL~~~G~d~vitvDlH~~qiqgfF~ipvd~l~a~~~l~~~i~~~~~~~~vvV---sPD~G~~~ra~~~A~~L~  188 (327)
T PRK04554        112 SAKLVANMLYSAGIDRVLTVDLHADQIQGFFDIPVDNIYATPILLNDIKQQRIENLTVV---SPDIGGVVRARAVAKSLN  188 (327)
T ss_pred             CHHHHHHHHHHCCCCCCEEECCCHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEE---CCCCCHHHHHHHHHHHCC
T ss_conf             29999855762598850476268488734368970211121999999986077872898---379538999999997568


Q ss_pred             CCCE
Q ss_conf             9613
Q gi|254780368|r  137 WPQA  140 (249)
Q Consensus       137 ~p~v  140 (249)
                      +|+.
T Consensus       189 ~~~a  192 (327)
T PRK04554        189 ADLA  192 (327)
T ss_pred             CCEE
T ss_conf             8779


No 34 
>COG0137 ArgG Argininosuccinate synthase [Amino acid transport and metabolism]
Probab=76.30  E-value=6.3  Score=19.74  Aligned_cols=91  Identities=32%  Similarity=0.369  Sum_probs=60.6

Q ss_pred             HHHHHCCCCCCEEEEEE--CC--CHHHHHHHHHHHHCCCCCEEEECCC------------------CC----C---HHHH
Q ss_conf             99985599852899997--14--1015888887850777623763365------------------47----8---8999
Q gi|254780368|r   47 LQLREKGIATEVIVVSI--GS--CKVEEVLKNSLAMGADRGILIESNE------------------TL----E---PLSI   97 (249)
Q Consensus        47 l~lke~~~g~~V~~lsv--G~--~~~~~~Lr~alAmGaD~ai~i~d~~------------------~~----D---~~~~   97 (249)
                      ..|+|+ +|.+|+++++  |.  .+.+..=++|+.+||.+.+.++.++                  +.    .   ---+
T Consensus        22 ~wL~e~-~~~eVit~tadvGQ~eed~~~i~eKA~~~Ga~~~~viD~reeFv~~yi~~~i~ana~Yeg~YpL~TalaRPLI  100 (403)
T COG0137          22 KWLKEK-GGAEVIAVTADVGQPEEDLDAIREKALELGAEEAYVIDAREEFVEDYIFPAIKANALYEGVYPLGTALARPLI  100 (403)
T ss_pred             HHHHHH-CCCEEEEEEEECCCCHHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHHHHHHHHHCEEECCCCCCCHHHHHHH
T ss_conf             999976-5946999997589975775799999998188528996438999999999999730512156414543467799


Q ss_pred             HHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCE
Q ss_conf             9999998612686499996113588861289999998579613
Q gi|254780368|r   98 AKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQA  140 (249)
Q Consensus        98 A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~v  140 (249)
                      |+.+-++.++.|.+.|--|  ++--++-||-.-++.+.--|-+
T Consensus       101 ak~lVe~A~k~Ga~avaHG--cTGKGNDQvRFE~~~~al~pdl  141 (403)
T COG0137         101 AKKLVEAAKKEGADAVAHG--CTGKGNDQVRFELAILALNPDL  141 (403)
T ss_pred             HHHHHHHHHHCCCCEEEEC--CCCCCCCEEEEEEEHHHHCCCC
T ss_conf             9999999997199699746--7888875354320045418996


No 35 
>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine  kinases. The Serine Threonine  kinases are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. The N-terminal domain is homologous to the USP family which has a ATP binding fold. The N-terminal domain  is predicted to be involved in ATP binding.
Probab=74.91  E-value=6.9  Score=19.51  Aligned_cols=81  Identities=17%  Similarity=0.217  Sum_probs=56.8

Q ss_pred             CCHHHHHHHHHHHHHHCCCCCCEEEEEECCC-----------------------HHHHHHHHHHHHCCCCCEEEECC--C
Q ss_conf             6013689999999985599852899997141-----------------------01588888785077762376336--5
Q gi|254780368|r   36 NPFDEIALEESLQLREKGIATEVIVVSIGSC-----------------------KVEEVLKNSLAMGADRGILIESN--E   90 (249)
Q Consensus        36 n~~D~~AlE~Al~lke~~~g~~V~~lsvG~~-----------------------~~~~~Lr~alAmGaD~ai~i~d~--~   90 (249)
                      ++.-.+||+=|++---. .|..++.+.+=|+                       ..++.|..+..+...+.+.+..-  +
T Consensus         9 s~~S~~AL~WAl~n~~~-~~~~lvLlHV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~C~~~~V~~e~~v~e   87 (146)
T cd01989           9 DKKSKNALKWALDNLAT-KGQTIVLVHVHPPITSIPSSSGKLEVASAYKQEEDKEAKELLLPYRCFCSRKGVQCEDVVLE   87 (146)
T ss_pred             CHHHHHHHHHHHHHHHC-CCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEE
T ss_conf             88799999999986406-69819999971688767776530667889988888999999999999998759728999983


Q ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEEEECCC
Q ss_conf             478899999999986126864999961135
Q gi|254780368|r   91 TLEPLSIAKILREIVKKENPIIVIAGKQTT  120 (249)
Q Consensus        91 ~~D~~~~A~~La~~i~~~~~DLIl~G~~S~  120 (249)
                      +.|   .++.|-+++++.+.|++++|..+-
T Consensus        88 ~~d---~~~~I~e~v~~~~i~~LVmGs~~~  114 (146)
T cd01989          88 DDD---VAKAIVEYVADHGITKLVMGASSD  114 (146)
T ss_pred             CCC---HHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             488---889999999975998999862799


No 36 
>PRK07206 hypothetical protein; Provisional
Probab=73.50  E-value=7.4  Score=19.29  Aligned_cols=20  Identities=20%  Similarity=0.074  Sum_probs=12.8

Q ss_pred             EECCCHHHHHHHHHHHHHHCC
Q ss_conf             332601368999999998559
Q gi|254780368|r   33 ISMNPFDEIALEESLQLREKG   53 (249)
Q Consensus        33 ~~in~~D~~AlE~Al~lke~~   53 (249)
                      .+| |-.|+++|.|=+|.+..
T Consensus        73 aVi-~g~E~gV~lAd~La~~L   92 (415)
T PRK07206         73 AVI-AGAESGVELADRLAERL   92 (415)
T ss_pred             EEE-ECCHHHHHHHHHHHHHH
T ss_conf             999-78556599999999986


No 37 
>TIGR01036 pyrD_sub2 dihydroorotate oxidase; InterPro: IPR005719   Dihydroorotate dehydrogenase (1.3.3.1 from EC) (DHOdehase) catalyzes the fourth step in the de novo biosynthesis of pyrimidine, the conversion of dihydroorotate into orotate. DHOdehase is a ubiquitous FAD flavoprotein. In bacteria (gene pyrD), DHOdease is located on the inner side of the cytosolic membrane. In some yeasts, such as in Saccharomyces cerevisiae (gene URA1, subfamily 2), it is a cytosolic protein while in other eukaryotes it is found in the mitochondria .    This model describes dihydroorotate dehydrogenase subfamily 2 and includes members from bacteria and eukaryotes. The subfamilies 1 and 2 share extensive homology, particularly toward the C-terminus, however subfamily 2 has a longer N-terminal region.; GO: 0004158 dihydroorotate oxidase activity, 0006207 'de novo' pyrimidine base biosynthetic process, 0016020 membrane.
Probab=73.34  E-value=6.9  Score=19.48  Aligned_cols=106  Identities=13%  Similarity=0.118  Sum_probs=68.1

Q ss_pred             EEEEEEEECCCCCCE---------E-----ECCCCCEEEECC-CCEECCCH-----------HHHHHHHHHHHHHCCCCC
Q ss_conf             999860303887605---------9-----807888163248-77332601-----------368999999998559985
Q gi|254780368|r    3 ILVPIKGVINYNTKV---------R-----IKNDYSGIETEN-TKISMNPF-----------DEIALEESLQLREKGIAT   56 (249)
Q Consensus         3 I~V~vK~VpD~~~~i---------~-----i~~~~~~i~~~~-~~~~in~~-----------D~~AlE~Al~lke~~~g~   56 (249)
                      .-|+||..||.+.+-         +     +=..+++|+|+. +...-|.-           -.-+.|-=-||... ..+
T Consensus       223 ~P~~VKIAPDL~~~dl~~IAd~~v~~~~dG~IATNTT~sR~~Gv~g~k~~r~~~GGLSGkPL~~kS~eiirrL~~~-~~g  301 (370)
T TIGR01036       223 VPVLVKIAPDLSESDLLDIADSAVELGIDGIIATNTTVSRDLGVTGPKNSREETGGLSGKPLQKKSTEIIRRLYKE-LKG  301 (370)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEECCEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH-HCC
T ss_conf             8578972689882138999999987189848984451025200256321435678988751447789999999999-649


Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCCEEEECC---CCC-CHHHHHHHHHHHHHCCCC
Q ss_conf             289999714101588888785077762376336---547-889999999998612686
Q gi|254780368|r   57 EVIVVSIGSCKVEEVLKNSLAMGADRGILIESN---ETL-EPLSIAKILREIVKKENP  110 (249)
Q Consensus        57 ~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~---~~~-D~~~~A~~La~~i~~~~~  110 (249)
                      ++..+++|+=+....=++=+.|||. .+.+..-   .|- =.-.+-+-|.+.+++.||
T Consensus       302 r~piIgVGGI~~~~~A~EkI~AGAS-LlQ~YsgfIy~GP~l~k~i~~~i~~lL~~~GF  358 (370)
T TIGR01036       302 RLPIIGVGGISSAQNALEKIKAGAS-LLQIYSGFIYKGPPLVKEIVKEIEKLLKEDGF  358 (370)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHCCH-HHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             5789962785747889999984712-44564234667716799999999999751796


No 38 
>PRK05370 argininosuccinate synthase; Validated
Probab=72.93  E-value=7.7  Score=19.20  Aligned_cols=94  Identities=17%  Similarity=0.214  Sum_probs=62.9

Q ss_pred             HHHHHHCCCCCCEEEEEE--CCCH---HHHHHHHHHHHCCCCCEEEECCCC----------------------------C
Q ss_conf             999985599852899997--1410---158888878507776237633654----------------------------7
Q gi|254780368|r   46 SLQLREKGIATEVIVVSI--GSCK---VEEVLKNSLAMGADRGILIESNET----------------------------L   92 (249)
Q Consensus        46 Al~lke~~~g~~V~~lsv--G~~~---~~~~Lr~alAmGaD~ai~i~d~~~----------------------------~   92 (249)
                      -..|+|+  |.+|+++++  |..+   .+..-++|+..||.+.+.+..++.                            .
T Consensus        28 l~wL~e~--g~eVia~taDvGQ~de~d~~~i~~kA~~~GA~k~~v~D~reefv~~~i~ai~a~A~y~~~~g~~Y~l~t~l  105 (447)
T PRK05370         28 LLWMRQK--GAVPYAYTANLGQPDEDDYDAIPRRAMEYGAENARLIDCRAQLVAEGIAAIQCGAFHISTGGVTYFNTTPL  105 (447)
T ss_pred             HHHHHHC--CCEEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHHHHCCHHHHCCCCCCCCCCCH
T ss_conf             9999875--98799999979998613389999999982997899971799999999999973623330257644587730


Q ss_pred             CHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEE
Q ss_conf             889999999998612686499996113588861289999998579613324
Q gi|254780368|r   93 EPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFV  143 (249)
Q Consensus        93 D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v  143 (249)
                      ....+|+.|.+++++.+.|.|--|  |+--++-||=..++..+--|.+.-+
T Consensus       106 aRplia~~lv~~a~~~ga~~iaHG--aTGKGNDQVRFe~~~~~l~P~lkIi  154 (447)
T PRK05370        106 GRAVTGTMLVAAMKEDGVNIWGDG--STYKGNDIERFYRYGLLTNPELKIY  154 (447)
T ss_pred             HHHHHHHHHHHHHHHHCCCEEEEC--CCCCCCCHHHHHHHHHHHCCCCEEE
T ss_conf             788999999999998399899557--7678743889999998529987697


No 39 
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional
Probab=72.38  E-value=7.9  Score=19.12  Aligned_cols=67  Identities=19%  Similarity=0.277  Sum_probs=39.8

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHC
Q ss_conf             2601368999999998559985289999714101588888785077762376336547889999999998612
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKK  107 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~  107 (249)
                      ++..|.+.+|..-+++.......|+++|.-  ...+..-.++.+|||. ++.   .+.+......-+.+.+++
T Consensus        52 i~lp~~~G~~l~~~ir~~~~~~pII~lt~~--~~~~~~~~~l~~GAdd-yi~---KP~~~~eL~ari~~~lrr  118 (222)
T PRK10643         52 LGLPDEDGLHFLARIRQKKYTLPVLILTAR--DTLEDRIAGLDVGADD-YLV---KPFALEELHARIRALLRR  118 (222)
T ss_pred             CCCCCCCCHHHHHHHHHCCCCCCEEEEECC--CCHHHHHHHHHCCCCE-EEE---CCCCHHHHHHHHHHHHHH
T ss_conf             888998622689999834899889998210--3678899999759977-643---887689999999999703


No 40 
>TIGR01284 alt_nitrog_alph nitrogenase alpha chain; InterPro: IPR005974    The enzyme responsible for nitrogen fixation, the nitrogenase, shows a high degree of conservation of structure, function, and amino acid sequence across wide phylogenetic ranges. All known Mo-nitrogenases consist of two components, component I (also called dinitrogenase, or Fe-Mo protein), an alpha2beta2 tetramer encoded by the nifD and nifK genes, and component II (dinitrogenase reductase, or Fe protein) a homodimer encoded by the nifH gene. Two operons, nifDK and nifEN, encode a tetrameric (alpha2beta2 and N2E2) enzymatic complex. Nitrogenase contains two unusual rare metal clusters; one of them is the iron molybdenum cofactor (FeMo-co), which is considered to be the site of dinitrogen reduction and whose biosynthesis requires the products of nifNE and of some other nif genes. It has been proposed that NifNE might serve as a scaffold upon which FeMo-co is built and then inserted into component I.    This model represents the alpha chains of various forms of the nitrogen-fixing enzyme nitrogenase: vanadium-iron, iron-iron, and molybdenum-iron. Most examples of NifD, the molybdenum-iron type nitrogenase alpha chain, are excluded from this model and described instead by equivalog model IPR005972 from INTERPRO.; GO: 0016163 nitrogenase activity, 0051536 iron-sulfur cluster binding, 0009399 nitrogen fixation.
Probab=72.11  E-value=2.3  Score=22.52  Aligned_cols=32  Identities=34%  Similarity=0.484  Sum_probs=20.4

Q ss_pred             HHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEE
Q ss_conf             99986126864999961135888612899999985796133
Q gi|254780368|r  101 LREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQAT  141 (249)
Q Consensus       101 La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt  141 (249)
                      +-++|+...||+||+|.+.-         .||..|++||+.
T Consensus       398 ~~Eiie~~kPDiIltG~r~g---------elakKl~vPy~~  429 (468)
T TIGR01284       398 LLEIIELLKPDIILTGKREG---------ELAKKLRVPYIN  429 (468)
T ss_pred             HHHHHHHHCCCEEEECCCCC---------EEEEEECCCEEE
T ss_conf             88898641888897178665---------047653067674


No 41 
>pfam02698 DUF218 DUF218 domain. This large family of proteins contains several highly conserved charged amino acids, suggesting this may be an enzymatic domain (Bateman A pers. obs). The family includes SanA, which is involved in Vancomycin resistance. This protein may be involved in murein synthesis.
Probab=71.51  E-value=8.3  Score=18.99  Aligned_cols=107  Identities=14%  Similarity=0.160  Sum_probs=72.1

Q ss_pred             CCHHHHHHHHHHHHHHCCCCCCEEEEEEC------CCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             60136899999999855998528999971------410158888878507776237633654788999999999861268
Q gi|254780368|r   36 NPFDEIALEESLQLREKGIATEVIVVSIG------SCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKEN  109 (249)
Q Consensus        36 n~~D~~AlE~Al~lke~~~g~~V~~lsvG------~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~~~  109 (249)
                      +|....=++.|++|-.++... ...+|-|      ..+++-.-+.+...|.+..-.+.+....+|+..+......+++.+
T Consensus        12 ~~~~~~R~~~a~~l~~~g~~~-~ii~sGg~~~~~~~~ea~~~~~~l~~~gvp~~~I~~e~~s~nT~ena~~~~~~~~~~~   90 (148)
T pfam02698        12 SPALAARLDAAAELYRAGPAP-RIIVSGGAGGGEPVSEAEVMRRYLVELGVPAEAILLEPQSRNTYENARFSAELLRERG   90 (148)
T ss_pred             CHHHHHHHHHHHHHHHHCCCC-EEEEECCCCCCCCCCHHHHHHHHHHHCCCCHHHEECCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             877999999999999809998-8998489888888789999999999869899997745567783551999999999769


Q ss_pred             CC-EEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEE
Q ss_conf             64-999961135888612899999985796133244334
Q gi|254780368|r  110 PI-IVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIK  147 (249)
Q Consensus       110 ~D-LIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~  147 (249)
                      .+ +++.    +|..+-.=.-+++..+|+..........
T Consensus        91 ~~~v~lV----Ts~~H~~Ra~~~f~~~~~~~~~~~~~~~  125 (148)
T pfam02698        91 LRRVLLV----TSAFHMRRALLLFRRAGPEVVPVPADYP  125 (148)
T ss_pred             CCEEEEE----CCHHHHHHHHHHHHHHCCEEEEEECCCC
T ss_conf             9759998----9888999999999980990599867988


No 42 
>TIGR01517 ATPase-IIB_Ca calcium-translocating P-type ATPase, PMCA-type; InterPro: IPR006408   This family describes the P-type ATPase responsible for translocating calcium ions across the plasma membrane of eukaryotes , out of the cell. In some organisms, this type of pump may also be found in vacuolar membranes . In humans and mice, at least, there are multiple isoforms of the PMCA pump with overlapping but not redundant functions. Accordingly, there are no human diseases linked to PMCA defects, although alterations of PMCA function do elicit physiological effects . The calcium P-type ATPases have been characterised as Type IIB based on a phylogenetic analysis which distinguishes this group from the Type IIA SERCA calcium pump .; GO: 0005388 calcium-transporting ATPase activity, 0005509 calcium ion binding, 0005524 ATP binding, 0015085 calcium ion transmembrane transporter activity, 0006816 calcium ion transport, 0016020 membrane.
Probab=71.42  E-value=4.3  Score=20.83  Aligned_cols=14  Identities=21%  Similarity=0.233  Sum_probs=7.0

Q ss_pred             CHHHHHHHHHHHHH
Q ss_conf             88999999999861
Q gi|254780368|r   93 EPLSIAKILREIVK  106 (249)
Q Consensus        93 D~~~~A~~La~~i~  106 (249)
                      |=..||++||.-..
T Consensus       571 DNi~TA~AIAr~Cg  584 (885)
T TIGR01517       571 DNISTAKAIARNCG  584 (885)
T ss_pred             CHHHHHHHHHHHCC
T ss_conf             81579999986325


No 43 
>TIGR01090 apt adenine phosphoribosyltransferase; InterPro: IPR005764    Adenine phosphoribosyltransferase (APRTase, 2.4.2.7 from EC) is a widely distributed enzyme, and its deficiency in humans causes the accumulation of 2,8-dihydroxyadenine. It is the sole catalyst for adenine recycling in most eukaryotes.  AMP + diphosphate = adenine + 5-phospho-alpha-D-ribose 1-diphosphate  ; GO: 0003999 adenine phosphoribosyltransferase activity, 0006168 adenine salvage.
Probab=70.48  E-value=8.7  Score=18.85  Aligned_cols=89  Identities=17%  Similarity=0.145  Sum_probs=60.5

Q ss_pred             CCEEEECCCC--CCHHHHH---HHHHHHHHCCC--CC--EEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCE
Q ss_conf             6237633654--7889999---99999861268--64--99996113588861289999998579613324433432865
Q gi|254780368|r   82 RGILIESNET--LEPLSIA---KILREIVKKEN--PI--IVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNH  152 (249)
Q Consensus        82 ~ai~i~d~~~--~D~~~~A---~~La~~i~~~~--~D--LIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~  152 (249)
                      ++|+-.|=-.  .++-.-.   ..|++.++..+  .|  .|.|    .+...--.|+.||..||.|+|.-=..=.+-..+
T Consensus        14 ~GIlFrDITplL~~~~~f~~~id~l~~~~~~~~~~id~d~iVG----~EaRGFifG~~LA~~LgvGFVPVRK~GKLP~~t   89 (175)
T TIGR01090        14 KGILFRDITPLLNNPELFRFLIDLLVERYKDANGEIDADLIVG----LEARGFIFGAALAYKLGVGFVPVRKPGKLPGET   89 (175)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEC----CCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCE
T ss_conf             9667766170106877899999999999986079515136876----766725778899997089806754787668422


Q ss_pred             EEEEEECCCCEEEEEECCCEEE
Q ss_conf             9999835896799996398899
Q gi|254780368|r  153 AIVTREVGHGTMTMETPLPAVI  174 (249)
Q Consensus       153 ~~v~r~~e~g~e~v~~~lPavi  174 (249)
                      +..+=++|.|...+|+.-=|+-
T Consensus        90 ~~~~Y~LEYG~d~lEIh~DA~~  111 (175)
T TIGR01090        90 VSASYDLEYGKDSLEIHKDAIK  111 (175)
T ss_pred             EEEEECEECCCCEEEEEHHHHH
T ss_conf             6674030047303534111364


No 44 
>TIGR02845 spore_V_AD stage V sporulation protein AD; InterPro: IPR010894   This family contains the bacterial stage V sporulation protein AD (SpoVAD), which is approximately 340 residues long. This is one of six proteins encoded by the spoVA operon, which is transcribed exclusively in the forespore at about the time of dipicolinic acid (DPA) synthesis in the mother cell. The functions of the proteins encoded by the spoVA operon are unknown, but it has been suggested they are involved in DPA transport during sporulation ..
Probab=70.42  E-value=3.5  Score=21.38  Aligned_cols=74  Identities=18%  Similarity=0.153  Sum_probs=37.8

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHH------HHHHHHHC-----C--CCCEEEEEECCCCCCCE-
Q ss_conf             9997141015888887850777623763365478899999------99998612-----6--86499996113588861-
Q gi|254780368|r   60 VVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAK------ILREIVKK-----E--NPIIVIAGKQTTDNESN-  125 (249)
Q Consensus        60 ~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~------~La~~i~~-----~--~~DLIl~G~~S~D~~~g-  125 (249)
                      +--+||.+.+--|+..    .|. ++-+.--+-|+|.-|+      ++..+++|     .  ..|+.|.|.-    -+. 
T Consensus        16 gt~vGP~Eg~GPL~~~----FD~-~~~dl~~ge~SwEkAEr~lm~~Av~~aL~Ka~l~~~PP~vD~~LAGDL----LNQ~   86 (331)
T TIGR02845        16 GTAVGPKEGEGPLGDY----FDK-IYDDLYCGEDSWEKAERKLMEDAVNLALKKANLKKDPPDVDFFLAGDL----LNQI   86 (331)
T ss_pred             EEEEECCCCCCCCCCC----CCC-EECCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEHHHH----HHHH
T ss_conf             5785063478968621----252-201443572018999999999999998753587127872111201036----6678


Q ss_pred             EHHHHHHHHHCCCCEEE
Q ss_conf             28999999857961332
Q gi|254780368|r  126 QTGQMLAALMRWPQATF  142 (249)
Q Consensus       126 ~v~~~lA~~Lg~p~vt~  142 (249)
                      -...-+|..|++|++.-
T Consensus        87 ~~anFvAR~L~iPflGL  103 (331)
T TIGR02845        87 ITANFVARELGIPFLGL  103 (331)
T ss_pred             HHHHHHHHHCCCCCEEC
T ss_conf             99989887458882340


No 45 
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing. This family of enzymes catalyzes the combined epimerization and UDP-hydrolysis of UDP-N-acetylglucosamine to N-acetylmannosamine. This is in contrast to the related enzyme WecB (TIGR00236) which retains the UDP moiety. NeuC acts in concert with NeuA and NeuB to synthesize CMP-N5-acetyl-neuraminate.
Probab=70.09  E-value=7  Score=19.45  Aligned_cols=84  Identities=19%  Similarity=0.225  Sum_probs=48.0

Q ss_pred             CCCCEEEEEECCC---HHHHHHHHHHHHCC--CCCEEE--ECCCCC-CHHHHHHHH---HHHHHCCCCCEEEEEECCCCC
Q ss_conf             9852899997141---01588888785077--762376--336547-889999999---998612686499996113588
Q gi|254780368|r   54 IATEVIVVSIGSC---KVEEVLKNSLAMGA--DRGILI--ESNETL-EPLSIAKIL---REIVKKENPIIVIAGKQTTDN  122 (249)
Q Consensus        54 ~g~~V~~lsvG~~---~~~~~Lr~alAmGa--D~ai~i--~d~~~~-D~~~~A~~L---a~~i~~~~~DLIl~G~~S~D~  122 (249)
                      ..-++.++.-|.-   ....+++.-..-|.  +..+.+  ..+.+. -..++++++   ...+++..||+|+.   -.|.
T Consensus        27 ~~~~~~li~TGqH~~~~~g~t~~~i~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~kPD~VlV---~GDt  103 (365)
T TIGR03568        27 PDLELQLIVTGMHLSPEYGNTVNEIEKDGFDIDEKIEILLDSDSNAGMAKSMGLTIIGFSDAFERLKPDLVVV---LGDR  103 (365)
T ss_pred             CCCCEEEEEECCCCCHHHCCHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEE---ECCC
T ss_conf             9988899990777841107089999975798765576545689853399999999999999985439989999---4898


Q ss_pred             CCEEHHHHHHHHHCCCCE
Q ss_conf             861289999998579613
Q gi|254780368|r  123 ESNQTGQMLAALMRWPQA  140 (249)
Q Consensus       123 ~~g~v~~~lA~~Lg~p~v  140 (249)
                      ++..-+++.|.++++|.+
T Consensus       104 ~stla~alaA~~~~Ipv~  121 (365)
T TIGR03568       104 FEMLAAAIAAALLNIPIA  121 (365)
T ss_pred             CHHHHHHHHHHHHCCEEE
T ss_conf             607799999998198189


No 46 
>pfam07355 GRDB Glycine/sarcosine/betaine reductase selenoprotein B (GRDB). This family represents a conserved region approximately 350 residues long within the selenoprotein B component of the bacterial glycine, sarcosine and betaine reductase complexes.
Probab=69.61  E-value=9.1  Score=18.73  Aligned_cols=48  Identities=19%  Similarity=0.248  Sum_probs=33.6

Q ss_pred             HHHHHHHHHHCCCCCEEEEEECCCCCC----CEEHHHHHHHHHCCCCEEEEE
Q ss_conf             999999986126864999961135888----612899999985796133244
Q gi|254780368|r   97 IAKILREIVKKENPIIVIAGKQTTDNE----SNQTGQMLAALMRWPQATFVS  144 (249)
Q Consensus        97 ~A~~La~~i~~~~~DLIl~G~~S~D~~----~g~v~~~lA~~Lg~p~vt~v~  144 (249)
                      ...-+...+++.+|||++||-.=--+.    -|.+.-.+.+.||+|.+|.--
T Consensus        68 a~~~il~mv~~~~pDlfiAGPAFnAGRYGvACG~i~kaV~e~l~IP~vTgMy  119 (349)
T pfam07355        68 AVAEILEMLKEEKPDLFIAGPAFNAGRYGVACGTIAKAVKEELGIPAVTGMY  119 (349)
T ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEECC
T ss_conf             9999999998429998987663256425888999999999986996386415


No 47 
>PRK03092 ribose-phosphate pyrophosphokinase; Provisional
Probab=69.27  E-value=9.2  Score=18.68  Aligned_cols=132  Identities=16%  Similarity=0.228  Sum_probs=78.4

Q ss_pred             EEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHH---HHHHCCCCCCEEEEE--ECC-----------CHH
Q ss_conf             9860303887605980788816324877332601368999999---998559985289999--714-----------101
Q gi|254780368|r    5 VPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESL---QLREKGIATEVIVVS--IGS-----------CKV   68 (249)
Q Consensus         5 V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al---~lke~~~g~~V~~ls--vG~-----------~~~   68 (249)
                      +.+++-||-+..+++...-.+=+-==+...-+|-|++-+|.-+   -+|+. +..+||++.  +|-           +-+
T Consensus        16 ~~~~~F~DGE~~v~i~~~vrg~dV~Ivqs~~~p~nd~lmELll~i~alk~~-~A~~It~ViPY~~YsRQDr~~~~ge~is   94 (304)
T PRK03092         16 TTARDFANGEIYVRFEESVRGCDAFVLQSHPAPVNKWLMEQLIMIDALKRA-SAKRITVVLPFYPYARQDKKHRGREPIS   94 (304)
T ss_pred             CEEEECCCCCEEEEECCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHC-CCCEEEEECCCCCCCCCCCCCCCCCCCC
T ss_conf             178988999889874787679848999179999518899999999999975-8972799805776005877778877522


Q ss_pred             HHHHHHHH-HHCCCCCEEEECCC---------CCCHHHHHHHHHHHHHCC-C-CCEEEEEECCCCCCCEEHHHHHHHHHC
Q ss_conf             58888878-50777623763365---------478899999999986126-8-649999611358886128999999857
Q gi|254780368|r   69 EEVLKNSL-AMGADRGILIESNE---------TLEPLSIAKILREIVKKE-N-PIIVIAGKQTTDNESNQTGQMLAALMR  136 (249)
Q Consensus        69 ~~~Lr~al-AmGaD~ai~i~d~~---------~~D~~~~A~~La~~i~~~-~-~DLIl~G~~S~D~~~g~v~~~lA~~Lg  136 (249)
                      ...+=+.| ++|+|+.+.+.-..         ..|-+.....++.++++. . .++++.   |.|.+.-.-.-.+|+.||
T Consensus        95 a~~va~lL~~~G~d~vitvDlH~~~i~gfF~~pv~~l~a~~~l~~~i~~~~~~~~~vvv---sPD~Ga~~ra~~~a~~Lg  171 (304)
T PRK03092         95 ARLVADLLKTAGADRIMTVDLHTDQIQGFFDGPVDHLFAMPLLADYIRSNYDLDNMTVV---SPDAGRVRVAEKWADRLG  171 (304)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCCCCEEE---CCCCCHHHHHHHHHHHHC
T ss_conf             99999988614888179965775999741678874311179999999851887661898---069746899999999867


Q ss_pred             -CCCE
Q ss_conf             -9613
Q gi|254780368|r  137 -WPQA  140 (249)
Q Consensus       137 -~p~v  140 (249)
                       .|+.
T Consensus       172 ~~~~~  176 (304)
T PRK03092        172 GAPLA  176 (304)
T ss_pred             CCCEE
T ss_conf             99789


No 48 
>PRK01999 consensus
Probab=69.24  E-value=9.2  Score=18.68  Aligned_cols=129  Identities=16%  Similarity=0.200  Sum_probs=79.2

Q ss_pred             EEEEEECCCCCCEEECCCC--CEEEECCCCEECCCHHHHHHHHHH---HHHHCCCCCCEEEEE--ECCCHH---------
Q ss_conf             9860303887605980788--816324877332601368999999---998559985289999--714101---------
Q gi|254780368|r    5 VPIKGVINYNTKVRIKNDY--SGIETENTKISMNPFDEIALEESL---QLREKGIATEVIVVS--IGSCKV---------   68 (249)
Q Consensus         5 V~vK~VpD~~~~i~i~~~~--~~i~~~~~~~~in~~D~~AlE~Al---~lke~~~g~~V~~ls--vG~~~~---------   68 (249)
                      +.+++-||-+..+++.++-  ..+-   +-..++|..++=+|.-+   .+|+. +..++|++.  +|..+.         
T Consensus        32 ~~~~~F~DGE~~v~i~~~vrg~dV~---ivqs~~p~~d~lmELll~~dA~r~~-~A~~It~ViPY~~YaRQDr~~~~~e~  107 (311)
T PRK01999         32 MNISHFADGEFAVSYEESIRGADVF---LVQSTFPNSDNLMELLLMIDAAKRA-SARSITAVIPYFGWARQDRKDKPRVS  107 (311)
T ss_pred             EEEEECCCCCEEEEECCCCCCCEEE---EECCCCCCHHHHHHHHHHHHHHHHC-CCCEEEEECCCCCCCCCCCCCCCCCC
T ss_conf             2889889998898617876798389---9889999816899999999889865-88638996255443337665689986


Q ss_pred             --HHHHHHHH-HHCCCCCEEEECCC---------CCCHHHHHHHHHHHHHCCCC-CEEEEEECCCCCCCEEHHHHHHHHH
Q ss_conf             --58888878-50777623763365---------47889999999998612686-4999961135888612899999985
Q gi|254780368|r   69 --EEVLKNSL-AMGADRGILIESNE---------TLEPLSIAKILREIVKKENP-IIVIAGKQTTDNESNQTGQMLAALM  135 (249)
Q Consensus        69 --~~~Lr~al-AmGaD~ai~i~d~~---------~~D~~~~A~~La~~i~~~~~-DLIl~G~~S~D~~~g~v~~~lA~~L  135 (249)
                        ...+-+.| ++|+|+.+.++-..         ..|.+.....+++++++.+. +.++-   |.|.++..-.-.+|+.|
T Consensus       108 isak~va~lL~~~G~d~vitvDlH~~~i~gfF~ipv~~l~a~~~~~~~~~~~~~~~~vvV---sPD~g~~kra~~~A~~L  184 (311)
T PRK01999        108 IGAKLVADLLSVAGIDRLITMDLHADQIQGFFDKPVDHLYASTVFLPYIRSLKLDNLVIA---TPDVGGSKRASAYSKYL  184 (311)
T ss_pred             EEHHHHHHHHHCCCCCEEEEEECCCHHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCEEEE---CCCHHHHHHHHHHHHHH
T ss_conf             767774434301578658998268388874479987644375889999996398760898---15904999999999861


Q ss_pred             CCCCE
Q ss_conf             79613
Q gi|254780368|r  136 RWPQA  140 (249)
Q Consensus       136 g~p~v  140 (249)
                      |.|++
T Consensus       185 g~~~~  189 (311)
T PRK01999        185 GVPVV  189 (311)
T ss_pred             CCCEE
T ss_conf             78723


No 49 
>PRK09982 universal stress protein UspD; Provisional
Probab=68.62  E-value=9.5  Score=18.60  Aligned_cols=86  Identities=17%  Similarity=0.223  Sum_probs=50.9

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHH-----------H---HH----H---HHHHHCCCCCEEEECCCCCC
Q ss_conf             26013689999999985599852899997141015-----------8---88----8---87850777623763365478
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIATEVIVVSIGSCKVE-----------E---VL----K---NSLAMGADRGILIESNETLE   93 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~-----------~---~L----r---~alAmGaD~ai~i~d~~~~D   93 (249)
                      +++-...-++-|+.|... .+++++.+++...-.+           +   .+    +   +.|+--+|=-  |... -.-
T Consensus        12 Ls~eS~~Li~KAv~lAk~-~~AklSlIhvd~~~~elY~gl~~~~~~~~~~~~~e~~~~~L~~L~~~~~YP--I~~~-~v~   87 (142)
T PRK09982         12 GNEEDALLVNKALELARH-NDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP--KTKL-RIE   87 (142)
T ss_pred             CCHHHHHHHHHHHHHHHH-CCCEEEEEEEECCCHHHCCHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC--CEEE-EEE
T ss_conf             584169999999999876-098399999908846651102053125688999999999999999847998--2478-998


Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEEECCCCCCCE
Q ss_conf             89999999998612686499996113588861
Q gi|254780368|r   94 PLSIAKILREIVKKENPIIVIAGKQTTDNESN  125 (249)
Q Consensus        94 ~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g  125 (249)
                      +=....-|..++++.+.||++||.+. |.-+.
T Consensus        88 ~Gdl~~~L~~~v~~~~iDLlIcGHHh-~fwsk  118 (142)
T PRK09982         88 RGEMPETLLEIMQKEQCDLLVCGHHH-SFINR  118 (142)
T ss_pred             ECCHHHHHHHHHHHHCCCEEEECCCH-HHHHH
T ss_conf             44889999999998499889965628-69999


No 50 
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain; InterPro: IPR012822    This family consists of the N-terminal regions, or in some cases the entirety, of bacterial proteins closely related to plant sucrose-phosphate synthases (SPS). The C-terminal domain (IPR012821 from INTERPRO), found with most members of this family, resembles both bona fide plant sucrose-phosphate phosphatases (SPP) and the SPP-like domain of plant sucrose phosphate synthase (SPS). At least two members of this family lack the SPP-like domain, which may have binding or regulatory rather than enzymatic activity by analogy to plant SPS. This enzyme produces sucrose 6-phosphate and UDP from UDP-glucose and D-fructose 6-phosphate, and may be encoded near the gene for fructokinase..
Probab=66.52  E-value=2.8  Score=21.99  Aligned_cols=90  Identities=18%  Similarity=0.308  Sum_probs=54.1

Q ss_pred             HHHHHHHHHHHHCCCCCCEEEEE-------ECCCHHHHHHHHHHHHCCCCC--EEEEC------C-CC----CCHHHHHH
Q ss_conf             68999999998559985289999-------714101588888785077762--37633------6-54----78899999
Q gi|254780368|r   40 EIALEESLQLREKGIATEVIVVS-------IGSCKVEEVLKNSLAMGADRG--ILIES------N-ET----LEPLSIAK   99 (249)
Q Consensus        40 ~~AlE~Al~lke~~~g~~V~~ls-------vG~~~~~~~Lr~alAmGaD~a--i~i~d------~-~~----~D~~~~A~   99 (249)
                      .|-||.|-.|.....=..|.+||       ++|.-|+..  +-+   +|+|  |++..      + |.    .|.++ -+
T Consensus        30 ~YVlELar~La~~~ev~qVdlvTR~I~D~~vspDYA~~~--E~i---~p~ArIvRl~fGP~rYLRKE~LWPyLD~~~-D~  103 (445)
T TIGR02472        30 KYVLELARALARRSEVEQVDLVTRLIKDAKVSPDYAQPI--ERI---APKARIVRLPFGPRRYLRKELLWPYLDELA-DQ  103 (445)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEEEEEEECCCCCCHHHHHH--HHC---CCCCEEEEECCCCCCCCCCCCCCCCHHHHH-HH
T ss_conf             788888998615897514767750343177680233477--640---899559974578885574015660078999-99


Q ss_pred             HHHHHHHCCC--CCEEEEEECCCCCCCEEHHHHHHHHHCCCCE
Q ss_conf             9999861268--6499996113588861289999998579613
Q gi|254780368|r  100 ILREIVKKEN--PIIVIAGKQTTDNESNQTGQMLAALMRWPQA  140 (249)
Q Consensus       100 ~La~~i~~~~--~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~v  140 (249)
                      .|.- +++.+  ||+|=+    ==-|+|.||.+||.+|++|+|
T Consensus       104 ~l~y-lr~~g~lPdlIH~----HYADAGYVG~~ls~~L~vPlv  141 (445)
T TIGR02472       104 LLSY-LRQQGRLPDLIHA----HYADAGYVGARLSRLLGVPLV  141 (445)
T ss_pred             HHHH-HHHCCCCCCCCHH----HHCCHHHHHHHHHHHCCCCEE
T ss_conf             9999-9735888873101----010155899999862589848


No 51 
>COG0496 SurE Predicted acid phosphatase [General function prediction only]
Probab=65.53  E-value=11  Score=18.21  Aligned_cols=100  Identities=18%  Similarity=0.194  Sum_probs=56.4

Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECC-------CCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             368999999998559985289999714101588888785077762376336-------5478899999999986126864
Q gi|254780368|r   39 DEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESN-------ETLEPLSIAKILREIVKKENPI  111 (249)
Q Consensus        39 D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~-------~~~D~~~~A~~La~~i~~~~~D  111 (249)
                      --.||+.||+   .  +++|+++.  |..-....  ..++.-++.+++..-       .|.-+--+--.|-...++..||
T Consensus        15 Gi~aL~~al~---~--~~dV~VVA--P~~~qSg~--s~slTl~~Plr~~~~~~~~~av~GTPaDCV~lal~~l~~~~~pD   85 (252)
T COG0496          15 GIRALARALR---E--GADVTVVA--PDREQSGA--SHSLTLHEPLRVRQVDNGAYAVNGTPADCVILGLNELLKEPRPD   85 (252)
T ss_pred             HHHHHHHHHH---H--CCCEEEEC--CCCCCCCC--CCCCCCCCCCEEEEECCCEEEECCCHHHHHHHHHHHHCCCCCCC
T ss_conf             7999999986---2--79799982--69877454--34400356723247236528935881899999999864678999


Q ss_pred             EEEEEECCCC------CCCEEHHHH-HHHHHCCCCEEEEEEEE
Q ss_conf             9999611358------886128999-99985796133244334
Q gi|254780368|r  112 IVIAGKQTTD------NESNQTGQM-LAALMRWPQATFVSNIK  147 (249)
Q Consensus       112 LIl~G~~S~D------~~~g~v~~~-lA~~Lg~p~vt~v~~i~  147 (249)
                      ||+.|-....      .+||.|++. =|.++|+|.+..-....
T Consensus        86 LVvSGIN~G~Nlg~dv~ySGTVaaA~Ea~~~GipsIA~S~~~~  128 (252)
T COG0496          86 LVVSGINAGANLGDDVIYSGTVAAAMEAALLGIPAIAISLAYR  128 (252)
T ss_pred             EEEECCCCCCCCCCCEEEEEHHHHHHHHHHCCCCCEEEEEHHH
T ss_conf             8996764788655113420149999999872964236541000


No 52 
>TIGR00032 argG argininosuccinate synthase; InterPro: IPR001518   Argininosuccinate synthase (6.3.4.5 from EC) (AS) is a urea cycle enzyme that catalyzes the penultimate step in arginine biosynthesis: the ATP-dependent ligation of citrulline to aspartate to form argininosuccinate, AMP and pyrophosphate , .   In humans, a defect in the AS gene causes citrullinemia, a genetic disease characterised by severe vomiting spells and mental retardation.   AS is a homotetrameric enzyme of chains of about 400 amino-acid residues. An arginine seems to be important for the enzyme's catalytic mechanism. The sequences of AS from various prokaryotes, archaebacteria and eukaryotes show significant similarity.; GO: 0004055 argininosuccinate synthase activity, 0005524 ATP binding, 0006526 arginine biosynthetic process.
Probab=65.35  E-value=11  Score=18.22  Aligned_cols=192  Identities=22%  Similarity=0.262  Sum_probs=101.6

Q ss_pred             HHHHHCCCCC-CEEEEEE--CCC---HHHHHHHHHHHHCCCCCEEEECCC------------------C---C-------
Q ss_conf             9998559985-2899997--141---015888887850777623763365------------------4---7-------
Q gi|254780368|r   47 LQLREKGIAT-EVIVVSI--GSC---KVEEVLKNSLAMGADRGILIESNE------------------T---L-------   92 (249)
Q Consensus        47 l~lke~~~g~-~V~~lsv--G~~---~~~~~Lr~alAmGaD~ai~i~d~~------------------~---~-------   92 (249)
                      ..|+|| .|. +|+++++  |.+   +.+..=++|+..||.+.+.|+.++                  +   .       
T Consensus        17 ~wL~~k-yG~~~Via~~~dvGQPDE~d~~~~~~kA~~~GA~~~~~iDak~eFv~dy~f~aiqanA~Ye~~GG~~Y~L~Ta   95 (420)
T TIGR00032        17 KWLEEK-YGYEEVIAVTADVGQPDEEDIDAIEEKALKYGAEKHYTIDAKEEFVKDYLFAAIQANAVYEGTGGLVYPLSTA   95 (420)
T ss_pred             HHHHHH-HCCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHHHHHHHCCCEECCCCCEECCCCCC
T ss_conf             998865-2898607999756799988888899998873671025772368899999888765066031787410347661


Q ss_pred             -CHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCC---CEEEEEEEEEC----CCEEEEEEECCCCEE
Q ss_conf             -8899999999986126864999961135888612899999985796---13324433432----865999983589679
Q gi|254780368|r   93 -EPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWP---QATFVSNIKII----DNHAIVTREVGHGTM  164 (249)
Q Consensus        93 -D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p---~vt~v~~i~~~----~~~~~v~r~~e~g~e  164 (249)
                       ----||+.|-+++++.|.+.|  +..++=-++-|+=.-+.-++--|   +++.+.++++-    |+.-..+=-...|++
T Consensus        96 LaRPlIA~~lVe~Ak~~Ga~Av--aHGCTGKGNDQ~RFe~~~~~~~p~LkviaP~R~~~~~e~lgGR~e~~eYa~~~Gip  173 (420)
T TIGR00032        96 LARPLIAKKLVEVAKKEGAEAV--AHGCTGKGNDQVRFERSIRALNPDLKVIAPWRDLNLTEELGGREEEIEYAAQKGIP  173 (420)
T ss_pred             CHHHHHHHHHHHHHHHCCCEEE--ECCCCCCCCCHHHHHHHHHHHCCCCEEECCCCCHHHHHHHCCCHHHHHHHHHCCCC
T ss_conf             1457999999999846695498--70768777413576588875268985874734646776405948899999966888


Q ss_pred             -EEEECCCEEEEEECC-------CC---CC-CCCCHHHHHHHHHCCCCEE--CHHHHCCCCCCCEEEEEEE-CCCCCCCC
Q ss_conf             -999639889998435-------56---54-5469888998852166120--4989076666845799951-78852474
Q gi|254780368|r  165 -TMETPLPAVITVDLN-------LN---EP-RYISLPNIIKARKKRIEKK--KATDFAIDLTPRLKVLRFE-ENRAERKG  229 (249)
Q Consensus       165 -~v~~~lPavisv~~~-------~n---~P-R~psl~~im~A~kk~i~~~--~~~dlg~d~~~~~~v~~~~-~p~~~~~g  229 (249)
                       -....-|  -|++..       ..   .| ....-.++-+-=+.|++..  .++.+.++....+= +++. .-.+..+|
T Consensus       174 ~p~~~~K~--YSiD~Nl~grs~Ea~~LEdP~~~~Ppe~~y~~t~~p~~~~~d~PE~v~I~Fe~GvP-VaLnytdnktskg  250 (420)
T TIGR00032       174 VPMTKEKP--YSIDENLWGRSIEAGILEDPSDTEPPEDIYELTKFPIEATPDEPEVVEIDFEKGVP-VALNYTDNKTSKG  250 (420)
T ss_pred             CCCCCCCC--CCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHCCHHHCCCCCCCEEEEEECCCCC-EEECCCCCCCCCC
T ss_conf             76546777--76236677555505535788788881457886307334679997168886237853-2301554644377


Q ss_pred             EEECCHHHHHHHHHH
Q ss_conf             553799999999998
Q gi|254780368|r  230 LRLYSTTKLIEILKS  244 (249)
Q Consensus       230 ~~~e~~~eLv~~L~~  244 (249)
                      +.+++.-+|+..+-+
T Consensus       251 ~~~~~~veLi~~aNe  265 (420)
T TIGR00032       251 VSLEKPVELILKANE  265 (420)
T ss_pred             CCCCCHHHHHHHHHH
T ss_conf             330637899999998


No 53 
>PRK02270 consensus
Probab=64.55  E-value=11  Score=18.09  Aligned_cols=131  Identities=16%  Similarity=0.214  Sum_probs=79.1

Q ss_pred             EEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHH---HHHCCCCCCEEEEE--ECCCHHH----------
Q ss_conf             98603038876059807888163248773326013689999999---98559985289999--7141015----------
Q gi|254780368|r    5 VPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQ---LREKGIATEVIVVS--IGSCKVE----------   69 (249)
Q Consensus         5 V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~---lke~~~g~~V~~ls--vG~~~~~----------   69 (249)
                      +.+++-||-+..+++..+-.+=|-==+...-.|-+++=+|.-+-   +|.. +..+||++.  +|..+.+          
T Consensus        32 ~~~~~F~DGE~~v~i~esvrg~dV~ivqs~~~pvnd~lmELll~idA~rra-sA~~It~ViPY~~YaRQDrk~~~repIs  110 (327)
T PRK02270         32 IEKTVFADGEVLLKSKETVRNRDVFIVASTSRPVNENIMELLIFIDSLKRA-SAKEINVILSYYGYARQDRKSSGRQPIG  110 (327)
T ss_pred             EEEEECCCCCEEEEECCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCCCEEEEECCCCCCCCCCCCCCCCCCH
T ss_conf             288998999889842787789808998789999317899999999999873-8872589712544344777668998633


Q ss_pred             -HHHHHHH-HHCCCCCEEEECC----CC-----CCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCC
Q ss_conf             -8888878-5077762376336----54-----78899999999986126864999961135888612899999985796
Q gi|254780368|r   70 -EVLKNSL-AMGADRGILIESN----ET-----LEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWP  138 (249)
Q Consensus        70 -~~Lr~al-AmGaD~ai~i~d~----~~-----~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p  138 (249)
                       ..+=+.| ++|+|+.+.++-.    ++     .|-+.....|+.+++....++|+.   |.|.+...-.-.+|+.||-+
T Consensus       111 aklvA~lL~~~G~d~vitvDlH~~qiqgfF~iPvd~l~a~~~l~~~i~~~~~~~vvV---sPD~G~~~ra~~~a~~Lg~~  187 (327)
T PRK02270        111 AKLVADLLEKAGATKIISVDLHNPSIQGFFDIPVDDIKGQYILAKELKKKNEKFTVV---SPDHGGAVRARILAEIISDQ  187 (327)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCHHHHHCCCCCCCEEEECCHHHHHHHHHCCCCEEEE---ECCCCHHHHHHHHHHHHCCC
T ss_conf             999999885247864788435768885046997304774278799886406871899---76974899999999985389


Q ss_pred             C
Q ss_conf             1
Q gi|254780368|r  139 Q  139 (249)
Q Consensus       139 ~  139 (249)
                      +
T Consensus       188 ~  188 (327)
T PRK02270        188 I  188 (327)
T ss_pred             C
T ss_conf             7


No 54 
>pfam02350 Epimerase_2 UDP-N-acetylglucosamine 2-epimerase. This family consists of UDP-N-acetylglucosamine 2-epimerases EC:5.1.3.14 this enzyme catalyses the production of UDP-ManNAc from UDP-GlcNAc. Note that some of the enzymes is this family are bifunctional, in this instance Pfam matches only the N-terminal half of the protein suggesting that the additional C-terminal part (when compared to mono-functional members of this family) is responsible for the UPD-N-acetylmannosamine kinase activity of these enzymes. This hypothesis is further supported by the assumption that the C-terminal part of rat bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase is the kinase domain.
Probab=64.39  E-value=9.5  Score=18.61  Aligned_cols=80  Identities=20%  Similarity=0.351  Sum_probs=43.3

Q ss_pred             CCEEEEEECC---CHHHHHHHHHHHHCCCC-CEEEECCCCCCHHHHHHH---HHHHHHCCCCCEEEEEECCCCCCCEEHH
Q ss_conf             5289999714---10158888878507776-237633654788999999---9998612686499996113588861289
Q gi|254780368|r   56 TEVIVVSIGS---CKVEEVLKNSLAMGADR-GILIESNETLEPLSIAKI---LREIVKKENPIIVIAGKQTTDNESNQTG  128 (249)
Q Consensus        56 ~~V~~lsvG~---~~~~~~Lr~alAmGaD~-ai~i~d~~~~D~~~~A~~---La~~i~~~~~DLIl~G~~S~D~~~g~v~  128 (249)
                      -++..+.-|.   +.-..+.++-+  +.++ -+.+..+...-...++.+   ++..+++..||+|+.   -.|.++..-+
T Consensus         9 ~~~~li~TG~H~~~~~g~t~~e~f--~i~~~~~~l~~~~~~~~~~~~~~i~~~~~~l~~~~PD~vlv---~GDr~e~la~   83 (346)
T pfam02350         9 FELQLVVTGQHLDREMGDTFFEGF--GIPKPDYDLNVDSQSLAKSTGRILIGLEDVLEEEKPDLVLV---LGDTNETLAG   83 (346)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHC--CCCCCCEECCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEE---ECCCCHHHHH
T ss_conf             887999828889987867998656--99999744589999899999999999999999829999999---6897158899


Q ss_pred             HHHHHHHCCCCE
Q ss_conf             999998579613
Q gi|254780368|r  129 QMLAALMRWPQA  140 (249)
Q Consensus       129 ~~lA~~Lg~p~v  140 (249)
                      ++.|..+++|.+
T Consensus        84 aiaa~~~~ipi~   95 (346)
T pfam02350        84 ALAAFYLRIPVA   95 (346)
T ss_pred             HHHHHHHCCCEE
T ss_conf             999998198489


No 55 
>PRK00934 ribose-phosphate pyrophosphokinase; Provisional
Probab=64.23  E-value=12  Score=18.05  Aligned_cols=166  Identities=17%  Similarity=0.154  Sum_probs=94.7

Q ss_pred             EEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHH---HHHCCCCCCEEEEE--ECC-----------CHH
Q ss_conf             98603038876059807888163248773326013689999999---98559985289999--714-----------101
Q gi|254780368|r    5 VPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQ---LREKGIATEVIVVS--IGS-----------CKV   68 (249)
Q Consensus         5 V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~---lke~~~g~~V~~ls--vG~-----------~~~   68 (249)
                      +-+++-||-+..+++..+-.+=+- .+.....|-|.+=+|.-+-   +|+. +..+||++.  +|.           +-+
T Consensus        26 ~~~~~F~DGE~~v~i~~~vrg~dV-~i~~~~~~~nd~lmELll~i~A~r~a-~A~~It~ViPY~~YsRQDr~~~~ge~is  103 (286)
T PRK00934         26 VETKKFPDGELYVRVDEELGGEDI-VIISTQYPQDENLIELILLLDALRDE-GVKSITLVAPYLAYARQDRRFKEGEPIS  103 (286)
T ss_pred             EEEEECCCCCEEEEECCCCCCCEE-EEEECCCCCCHHHHHHHHHHHHHHHC-CCCEEEEECCCCCCCCCCCCCCCCCCCC
T ss_conf             288988999889986887799869-99918999847999999999999875-8973899834655334643468998650


Q ss_pred             HHHHHHHHHHCCCCCEEEECCC---------CCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCC
Q ss_conf             5888887850777623763365---------4788999999999861268649999611358886128999999857961
Q gi|254780368|r   69 EEVLKNSLAMGADRGILIESNE---------TLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQ  139 (249)
Q Consensus        69 ~~~Lr~alAmGaD~ai~i~d~~---------~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~  139 (249)
                      ...+-+.|..++|+.+.++-..         ..|-+.....++++++....+.++-   |.|.++..-.-.+|..||+|+
T Consensus       104 ak~va~ll~~~~d~vitvDlH~~~i~~fF~~p~~nl~~~~~~~~~~~~~~~~~vVV---sPD~G~~~ra~~~a~~Lg~~~  180 (286)
T PRK00934        104 IKALAKVYSSYYDEIITINIHEEHTLEFFDIPFTNLSAMPAIAEYIKEKLVDPLVL---APDKGALERAKEVAEILGCEY  180 (286)
T ss_pred             HHHHHHHHHHHCCEEEEEECCHHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCCEEE---CCCCCHHHHHHHHHHHHCCCE
T ss_conf             89999999753174699947887884046898311105714589998438887898---479748999999999753646


Q ss_pred             EEEEEEEEECCCEEEEEEECCCCEEEEEECCCEEEEEECCCCC
Q ss_conf             3324433432865999983589679999639889998435565
Q gi|254780368|r  140 ATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNE  182 (249)
Q Consensus       140 vt~v~~i~~~~~~~~v~r~~e~g~e~v~~~lPavisv~~~~n~  182 (249)
                      .. ..+-...++.+.+.-..      ..++.--++-|+.=+.+
T Consensus       181 ~~-~~K~R~~~~~v~~~~~~------~dV~Gr~~IIvDDiidT  216 (286)
T PRK00934        181 DY-LEKKRISPTEVEMKPKD------LDVKGKDVLIVDDIIST  216 (286)
T ss_pred             EE-EEEECCCCCCCEEECCC------CCCCCCEEEEECCHHHC
T ss_conf             58-99743899852362353------22258789996562215


No 56 
>PRK02458 ribose-phosphate pyrophosphokinase; Provisional
Probab=63.46  E-value=12  Score=17.96  Aligned_cols=132  Identities=17%  Similarity=0.235  Sum_probs=78.3

Q ss_pred             EEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHH---HHHCCCCCCEEEEE--ECCCHHH----------
Q ss_conf             98603038876059807888163248773326013689999999---98559985289999--7141015----------
Q gi|254780368|r    5 VPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQ---LREKGIATEVIVVS--IGSCKVE----------   69 (249)
Q Consensus         5 V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~---lke~~~g~~V~~ls--vG~~~~~----------   69 (249)
                      +.+++-||-+..+++..+-.+=|-==+...-.|.+++-+|.-+-   +|+. +..+||++.  +|-.+.+          
T Consensus        36 ~~~~~FpDGE~~v~i~e~Vrg~dV~iiqs~~~p~nd~lmELll~idA~r~a-gA~~It~ViPY~~YaRQDr~~~~gepIs  114 (323)
T PRK02458         36 LSSRQFSDGEIMINIEESVRGDDIYIIQSTSFPVNDHLWELLIMIDACKRA-SANTVNVVLPYFGYARQDRIAKPREPIT  114 (323)
T ss_pred             EEEEECCCCCEEEEECCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCCEEEEEECCCCCCCCCCCCCCCCCCC
T ss_conf             188988999889864787789838998689989308999999999999873-8871899832465454776658998741


Q ss_pred             -HHHHHHH-HHCCCCCEEEECC----CC-----CCHHHHHHHHHHHHHCCC---CCEEEEEECCCCCCCEEHHHHHHHHH
Q ss_conf             -8888878-5077762376336----54-----788999999999861268---64999961135888612899999985
Q gi|254780368|r   70 -EVLKNSL-AMGADRGILIESN----ET-----LEPLSIAKILREIVKKEN---PIIVIAGKQTTDNESNQTGQMLAALM  135 (249)
Q Consensus        70 -~~Lr~al-AmGaD~ai~i~d~----~~-----~D~~~~A~~La~~i~~~~---~DLIl~G~~S~D~~~g~v~~~lA~~L  135 (249)
                       ..+=+.| ++|+|+.+-+.-.    .+     .|-+.....++.+++..+   .++|+.   |.|.++..-.-.+|++|
T Consensus       115 ak~vA~lL~~~G~d~vitvDlH~~~i~gfF~ipv~nl~a~~~~~~~~~~~~~~~~~~vvV---sPD~G~~~ra~~~A~~L  191 (323)
T PRK02458        115 AKLVANMLVKAGVDRVLTLDLHAVQVQGFFDIPVDNLFTVPLFAEHYSKLGLSGSDVVVV---SPKNSGIKRARSLAEYL  191 (323)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHCCCCCCCEEEEEHHHHHHHHHHCCCCCCCEEE---CCCCCHHHHHHHHHHHH
T ss_conf             999999987538865788427818774046897234771099999999837997670897---57830568899999860


Q ss_pred             CCCCE
Q ss_conf             79613
Q gi|254780368|r  136 RWPQA  140 (249)
Q Consensus       136 g~p~v  140 (249)
                      |.|+.
T Consensus       192 ~~~~~  196 (323)
T PRK02458        192 DSPIA  196 (323)
T ss_pred             CCCEE
T ss_conf             58713


No 57 
>PRK07940 DNA polymerase III subunit delta'; Validated
Probab=62.75  E-value=10  Score=18.34  Aligned_cols=46  Identities=11%  Similarity=0.077  Sum_probs=36.6

Q ss_pred             EECCCHHHHHHHHHHHHC-------------CCCCEEEECCCCCCHHHHHHHHHHHHHC
Q ss_conf             971410158888878507-------------7762376336547889999999998612
Q gi|254780368|r   62 SIGSCKVEEVLKNSLAMG-------------ADRGILIESNETLEPLSIAKILREIVKK  107 (249)
Q Consensus        62 svG~~~~~~~Lr~alAmG-------------aD~ai~i~d~~~~D~~~~A~~La~~i~~  107 (249)
                      -+|.+.+..+||+|+.-+             ...||+...+.|.--..+|+++|+++.-
T Consensus         7 ivGQe~v~~~L~~A~~~~R~~~~~~~~~~~~~~HAyLF~Gp~G~Gk~~~A~~~A~~l~C   65 (395)
T PRK07940          7 LVGQDAVVAELRAAARAARADSAHSAAAGSGMTHAWLFTGPPGSGRSNAARAFAAALQC   65 (395)
T ss_pred             HCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCC
T ss_conf             15929999999999983634344333346876603763689987889999999999669


No 58 
>pfam05636 DUF795 Protein of unknown function (DUF795). This family consists of several bacterial proteins of unknown function.
Probab=61.79  E-value=13  Score=17.77  Aligned_cols=84  Identities=18%  Similarity=0.261  Sum_probs=48.6

Q ss_pred             ECCCHH---HHHHHHHHHHHHCCCCCCEEEEEECC--------CHHHHHHH--HHHHHCCCCCEEEECC---CCCCHHHH
Q ss_conf             326013---68999999998559985289999714--------10158888--8785077762376336---54788999
Q gi|254780368|r   34 SMNPFD---EIALEESLQLREKGIATEVIVVSIGS--------CKVEEVLK--NSLAMGADRGILIESN---ETLEPLSI   97 (249)
Q Consensus        34 ~in~~D---~~AlE~Al~lke~~~g~~V~~lsvG~--------~~~~~~Lr--~alAmGaD~ai~i~d~---~~~D~~~~   97 (249)
                      --|||-   .|-|+.+   |+.. +..+++..|.+        +-.+..-|  -||..|+|=.+-+...   ..++-++.
T Consensus         9 EYNPFHnGH~Yhi~~a---r~~~-~~d~iIavMSGnFvQRGEPAi~dKw~Ra~~AL~~GaDLViELP~~ya~qsAe~FA~   84 (389)
T pfam05636         9 EYNPFHNGHLYHLNEA---KKLT-KADVKIAVMSGNFVQRGEPAIIDKWERAKMALSSGADLVIELPVTYSTQSADIFAE   84 (389)
T ss_pred             EECCCCCHHHHHHHHH---HHHC-CCCEEEEEECCCCCCCCCCHHCCHHHHHHHHHHCCCCEEEECCHHHHHCCHHHHHH
T ss_conf             1079740189999999---9864-99859999448852188620078889999999849998998865988615999999


Q ss_pred             HHHHHHHHHCCCCCEEEEEECCCCCC
Q ss_conf             99999986126864999961135888
Q gi|254780368|r   98 AKILREIVKKENPIIVIAGKQTTDNE  123 (249)
Q Consensus        98 A~~La~~i~~~~~DLIl~G~~S~D~~  123 (249)
                      +.+  ..+.+.|.|-+.+|.++.|-+
T Consensus        85 gaV--~lL~~lgvd~l~FGsE~~d~~  108 (389)
T pfam05636        85 GAV--SILDSLGIDTLAFGSEEGDIE  108 (389)
T ss_pred             HHH--HHHHHCCCCEEEECCCCCCHH
T ss_conf             999--999986999899658889899


No 59 
>PRK01259 ribose-phosphate pyrophosphokinase; Provisional
Probab=61.71  E-value=13  Score=17.76  Aligned_cols=131  Identities=21%  Similarity=0.248  Sum_probs=78.1

Q ss_pred             EEEEEECCCCCCEEECCCC--CEEEECCCCEECCCHHHHHHHHHHH---HHHCCCCCCEEEEE--ECCCH----------
Q ss_conf             9860303887605980788--8163248773326013689999999---98559985289999--71410----------
Q gi|254780368|r    5 VPIKGVINYNTKVRIKNDY--SGIETENTKISMNPFDEIALEESLQ---LREKGIATEVIVVS--IGSCK----------   67 (249)
Q Consensus         5 V~vK~VpD~~~~i~i~~~~--~~i~~~~~~~~in~~D~~AlE~Al~---lke~~~g~~V~~ls--vG~~~----------   67 (249)
                      +-+|+-||-+..+++..+-  ..+-  -+...-.|-+.+=+|.-+-   +|+. +..+||++.  +|-.+          
T Consensus        27 ~~~~~F~DGE~~v~i~~~vrg~dV~--ivqs~~~p~nd~lmElll~i~A~r~a-~A~~It~ViPY~~Y~RQDr~~~~re~  103 (309)
T PRK01259         27 ASVGRFSDGEISVEINENVRGKDVF--IIQSTCAPTNDNLMELLIMIDALRRA-SAGRITAVIPYFGYARQDRKASARVP  103 (309)
T ss_pred             EEEEECCCCCEEEEECCCCCCCCEE--EECCCCCCCCHHHHHHHHHHHHHHHC-CCCCEEEECCCCCCCCCCCCCCCCCC
T ss_conf             2788889998898637887798289--98679999517799999999999874-88717997246650368777799986


Q ss_pred             -HHHHHHHHH-HHCCCCCEEEECCC----C-----CCHHHHHHHHHHHHHCCCC-CEEEEEECCCCCCCEEHHHHHHHHH
Q ss_conf             -158888878-50777623763365----4-----7889999999998612686-4999961135888612899999985
Q gi|254780368|r   68 -VEEVLKNSL-AMGADRGILIESNE----T-----LEPLSIAKILREIVKKENP-IIVIAGKQTTDNESNQTGQMLAALM  135 (249)
Q Consensus        68 -~~~~Lr~al-AmGaD~ai~i~d~~----~-----~D~~~~A~~La~~i~~~~~-DLIl~G~~S~D~~~g~v~~~lA~~L  135 (249)
                       +...+-+.| ++|+|+.+.++-..    +     .|-+.....|++++++.+. +.++.   |.|.++..-.-.+|..|
T Consensus       104 isak~va~ll~~~G~d~vit~DlH~~qi~gfF~ipvd~l~a~~~l~~~i~~~~~~~~vvV---sPD~G~~~ra~~~A~~l  180 (309)
T PRK01259        104 ITAKLVANLLSSAGADRVLTVDLHADQIQGFFDIPVDNLYGSPILLEDIKKKNLENLVVV---SPDVGGVVRARALAKRL  180 (309)
T ss_pred             EEHHHHHHHHHHCCCCEEEEEECCHHHHHHHCCCCCEEEECCHHHHHHHHHCCCCCCEEE---ECCCCHHHHHHHHHHHH
T ss_conf             759999999852378738998167677754248971167440899999986388873899---14986899999999972


Q ss_pred             CCCCEE
Q ss_conf             796133
Q gi|254780368|r  136 RWPQAT  141 (249)
Q Consensus       136 g~p~vt  141 (249)
                      |.|+.-
T Consensus       181 g~~~~~  186 (309)
T PRK01259        181 DTDLAI  186 (309)
T ss_pred             CCCEEE
T ss_conf             998799


No 60 
>pfam07287 DUF1446 Protein of unknown function (DUF1446). This family consists of several bacterial and plant proteins of around 400 residues in length. The function of this family is unknown.
Probab=61.46  E-value=13  Score=17.73  Aligned_cols=37  Identities=24%  Similarity=0.312  Sum_probs=24.1

Q ss_pred             HHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCC
Q ss_conf             99999986126864999961135888612899999985796
Q gi|254780368|r   98 AKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWP  138 (249)
Q Consensus        98 A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p  138 (249)
                      |.-|+++++ .|.|+|+||+-+ |  +..+-+-++...||.
T Consensus       149 a~~I~~AL~-~GADIVItGRva-D--~al~lgp~~~~fgW~  185 (362)
T pfam07287       149 AEGIVEALR-AGADIVITGRVA-D--ASLVLGPAAHEFGWA  185 (362)
T ss_pred             HHHHHHHHH-CCCCEEEECCCC-C--HHHHHHHHHHHHCCC
T ss_conf             589999997-199889855514-5--688788999984998


No 61 
>PRK13670 hypothetical protein; Provisional
Probab=61.27  E-value=13  Score=17.71  Aligned_cols=84  Identities=17%  Similarity=0.236  Sum_probs=48.5

Q ss_pred             ECCCHH---HHHHHHHHHHHHCCCCCCEEEEEECC---CHH-----HHHHH--HHHHHCCCCCEEEECC---CCCCHHHH
Q ss_conf             326013---68999999998559985289999714---101-----58888--8785077762376336---54788999
Q gi|254780368|r   34 SMNPFD---EIALEESLQLREKGIATEVIVVSIGS---CKV-----EEVLK--NSLAMGADRGILIESN---ETLEPLSI   97 (249)
Q Consensus        34 ~in~~D---~~AlE~Al~lke~~~g~~V~~lsvG~---~~~-----~~~Lr--~alAmGaD~ai~i~d~---~~~D~~~~   97 (249)
                      --|||-   .|-+|++   |+.. +..+++..|.+   .+-     +..-|  -||..|+|=.+-+...   ..++-++.
T Consensus         9 EYNPFHnGH~Yhi~~a---r~~t-~ad~iIaVMSGnFvQRGEPAi~dKw~Ra~~AL~~GaDLViELP~~ya~qsAe~FA~   84 (390)
T PRK13670          9 EYNPFHNGHLYHLNQA---KKLT-KADVTIAVMSGNFVQRGEPAIVDKWTRAKMALANGADLVVELPFVFAVQSADYFAE   84 (390)
T ss_pred             EECCCCCHHHHHHHHH---HHHC-CCCEEEEEECCCCCCCCCCHHCCHHHHHHHHHHCCCCEEEECCHHHHHCCHHHHHH
T ss_conf             1079741089999999---9753-99879999438851088720078789999999859988998865988625999999


Q ss_pred             HHHHHHHHHCCCCCEEEEEECCCCCC
Q ss_conf             99999986126864999961135888
Q gi|254780368|r   98 AKILREIVKKENPIIVIAGKQTTDNE  123 (249)
Q Consensus        98 A~~La~~i~~~~~DLIl~G~~S~D~~  123 (249)
                      ..+  ..+...|.|-+.+|.++.|-+
T Consensus        85 gaV--~lL~~lgvd~l~FGsE~~d~~  108 (390)
T PRK13670         85 GAV--SILDALGVDDLVFGSESGDIE  108 (390)
T ss_pred             HHH--HHHHHCCCCEEEECCCCCCHH
T ss_conf             999--999986999899668889899


No 62 
>pfam02595 Gly_kinase Glycerate kinase family. This is family of Glycerate kinases.
Probab=59.08  E-value=14  Score=17.47  Aligned_cols=44  Identities=9%  Similarity=0.222  Sum_probs=27.5

Q ss_pred             CCHHHHHHHHHHHHHCCCCCEEEE--EECCCCCCCEEHHHHHHHHH
Q ss_conf             788999999999861268649999--61135888612899999985
Q gi|254780368|r   92 LEPLSIAKILREIVKKENPIIVIA--GKQTTDNESNQTGQMLAALM  135 (249)
Q Consensus        92 ~D~~~~A~~La~~i~~~~~DLIl~--G~~S~D~~~g~v~~~lA~~L  135 (249)
                      ..++.+-..|.+++.+.--.+|++  |..+.|++.|..-.+=+.+|
T Consensus       109 atTyG~GelI~~Al~~G~~~iiiGlGGSaTnDgG~GmL~ALG~~fl  154 (378)
T pfam02595       109 ATSYGTGELIAAALDAGAERIILGIGGSATNDGGAGMIQALGGQFL  154 (378)
T ss_pred             CCCCCHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHCCCHHH
T ss_conf             1577779999999987998899931785331168899997085001


No 63 
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional
Probab=58.12  E-value=13  Score=17.75  Aligned_cols=67  Identities=18%  Similarity=0.242  Sum_probs=41.9

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHC
Q ss_conf             2601368999999998559985289999714101588888785077762376336547889999999998612
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKK  107 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~  107 (249)
                      ++-.|.+.+|.+-++++.+...-|..+|.-  ...+..-+++..|||. |+.   .+.++.....-+.+.+++
T Consensus        52 i~lP~~dG~~l~~~iR~~~~~~PII~lta~--~~~~d~i~~l~~GAdD-Yl~---KPf~~~eL~ari~allrr  118 (219)
T PRK10336         52 LTLPGMDGRDILREWREKGQREPVLILTAR--DALAERVEGLRLGADD-YLC---KPFALIEVAARLEALMRR  118 (219)
T ss_pred             CCCCCCCCCCCCCCHHHHCCCCCEEEEECC--CCHHHHHHHHHCCCCE-EEE---CCCCHHHHHHHHHHHHHH
T ss_conf             999999856310104652788878998068--9999999999769988-868---897679999999999611


No 64 
>TIGR01919 hisA-trpF bifunctional HisA/TrpF protein; InterPro: IPR010188   This entry represents a bifunctional protein possessing both hisA (1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase) and trpF (N-(5'phosphoribosyl)anthranilate isomerase) activities . Thus, it is involved in both the histidine and tryptophan biosynthetic pathways. Enzymes with this property have been described only in the Actinobacteria (High-GC Gram-positive). The enzyme is closely related to the monofunctional HisA proteins and in Actinobacteria, the classical monofunctional TrpF is generally absent.; GO: 0003949 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase activity, 0004640 phosphoribosylanthranilate isomerase activity, 0000105 histidine biosynthetic process, 0000162 tryptophan biosynthetic process, 0005737 cytoplasm.
Probab=57.13  E-value=12  Score=17.97  Aligned_cols=55  Identities=27%  Similarity=0.286  Sum_probs=42.4

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCE
Q ss_conf             28999971410158888878507776237633654788999999999861268649
Q gi|254780368|r   57 EVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPII  112 (249)
Q Consensus        57 ~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~~~~DL  112 (249)
                      .|-+=--|.-+.+++|..||+.||-| +-|-..+-..|-.+|++|.++=.+...+|
T Consensus        77 rV~vELsGGiRDD~SL~~AL~tGa~R-VNiGTAALE~P~W~A~vI~~yGd~vAVgl  131 (246)
T TIGR01919        77 RVDVELSGGIRDDESLEAALATGAAR-VNIGTAALENPEWIASVIKKYGDKVAVGL  131 (246)
T ss_pred             EEEEEEECCCCCHHHHHHHHHHCCCE-EECCHHCCCCCHHHHHHHHHCCCEEEEEE
T ss_conf             78898506855678999999807734-40010104682378899876077687545


No 65 
>pfam00764 Arginosuc_synth Arginosuccinate synthase. This family contains a PP-loop motif.
Probab=56.17  E-value=16  Score=17.16  Aligned_cols=93  Identities=31%  Similarity=0.321  Sum_probs=64.2

Q ss_pred             HHHHHHCCCCCCEEEEEE--CC--CHHHHHHHHHHHHCCCCCEEEECC------------------CC-------CCHHH
Q ss_conf             999985599852899997--14--101588888785077762376336------------------54-------78899
Q gi|254780368|r   46 SLQLREKGIATEVIVVSI--GS--CKVEEVLKNSLAMGADRGILIESN------------------ET-------LEPLS   96 (249)
Q Consensus        46 Al~lke~~~g~~V~~lsv--G~--~~~~~~Lr~alAmGaD~ai~i~d~------------------~~-------~D~~~   96 (249)
                      ...|+|++  .+|+++++  |.  .+.+..-++|+..||.+.+.+.-+                  ++       ..--.
T Consensus        14 l~wL~e~~--~eVia~~~d~Gq~~ed~~~i~~kA~~~GA~~~~v~D~r~ef~~~~i~p~i~ana~Yeg~Y~L~tslaRpl   91 (389)
T pfam00764        14 IPWLKEKY--YEVIAVAVDVGQGEEDLDEAREKALKLGAVKHYVIDAKEEFVEDYIFPAIKANALYEGRYPLGTALARPL   91 (389)
T ss_pred             HHHHHHCC--CEEEEEEEECCCCHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHHHHCCCCCCCCEEECCCCHHHH
T ss_conf             99999709--9289999979997787899999999829978999737999999989999966867446478524321669


Q ss_pred             HHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEE
Q ss_conf             9999999861268649999611358886128999999857961332
Q gi|254780368|r   97 IAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATF  142 (249)
Q Consensus        97 ~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~  142 (249)
                      +|+.+..++++.+.+.|--|  ++-.++.||=..++-..=-|.+..
T Consensus        92 ia~~~v~~A~~~ga~aiaHG--~TGkGNDQvRFe~~~~aL~P~l~i  135 (389)
T pfam00764        92 IAKKLVEAAKKEGADAVAHG--CTGKGNDQVRFELSIRSLAPDLKV  135 (389)
T ss_pred             HHHHHHHHHHHCCCEEEEEC--CCCCCCCHHHHHHHHHHHCCCCEE
T ss_conf             99999999876397699436--667997453547889974999758


No 66 
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO). In green plants, glycolate oxidase is one of the key enzymes in photorespiration where it oxidizes glycolate to glyoxylate. LMO catalyzes the oxidation of L-lactate to acetate and carbon dioxide. MDH oxidizes (S)-mandelate to phenylglyoxalate. It is an enzyme in the mandelate pathway that occurs in several strains of Pseudomonas which converts (R)-mandelate to benzoate.
Probab=55.78  E-value=13  Score=17.83  Aligned_cols=63  Identities=21%  Similarity=0.173  Sum_probs=28.3

Q ss_pred             CCCCCHHHHHHHHHCCCCEECHHHHCC----CC----CCCEEEEEEECCCCCC-CCEEECCHHHHHHHHHHHHC
Q ss_conf             454698889988521661204989076----66----6845799951788524-74553799999999998617
Q gi|254780368|r  183 PRYISLPNIIKARKKRIEKKKATDFAI----DL----TPRLKVLRFEENRAER-KGLRLYSTTKLIEILKSKHD  247 (249)
Q Consensus       183 PR~psl~~im~A~kk~i~~~~~~dlg~----d~----~~~~~v~~~~~p~~~~-~g~~~e~~~eLv~~L~~e~~  247 (249)
                      +..-.|+.|.++-+..++++  -|=|+    |.    +-..+.+-+-.|.--. ..--.++++..+++|++|-.
T Consensus       212 ~~i~~L~~i~~~v~~~~~v~--~DgGvR~G~Dv~KAlaLGA~~V~iGRp~l~~l~~~G~~Gv~~~~~~l~~El~  283 (299)
T cd02809         212 ATIDALPEIVAAVGGRIEVL--LDGGIRRGTDVLKALALGADAVLIGRPFLYGLAAGGEAGVAHVLEILRDELE  283 (299)
T ss_pred             CHHHHHHHHHHHHCCCEEEE--ECCCCCCHHHHHHHHHCCCCEEEECHHHHHHHHHCCHHHHHHHHHHHHHHHH
T ss_conf             78999999999854672899--7188475368999997699889877899999885449999999999999999


No 67 
>PRK10610 chemotaxis regulatory protein CheY; Provisional
Probab=55.58  E-value=16  Score=17.10  Aligned_cols=14  Identities=21%  Similarity=0.472  Sum_probs=6.3

Q ss_pred             CCCCHHHHHHHHHH
Q ss_conf             54788999999999
Q gi|254780368|r   90 ETLEPLSIAKILRE  103 (249)
Q Consensus        90 ~~~D~~~~A~~La~  103 (249)
                      .+.|.+...+.|.+
T Consensus        61 P~~dG~el~~~ir~   74 (129)
T PRK10610         61 PNMDGLELLKTIRA   74 (129)
T ss_pred             CCCCHHHHHHHHHH
T ss_conf             99989999999985


No 68 
>PRK04262 hypothetical protein; Provisional
Probab=55.28  E-value=16  Score=17.07  Aligned_cols=91  Identities=18%  Similarity=0.030  Sum_probs=41.8

Q ss_pred             EEECCC-CEECCCHHH----HHHHHHHHHHHCCC-C-C---CEEEEEECCCHHHHH----HHHHHHHCCCC-CEEEECCC
Q ss_conf             632487-733260136----89999999985599-8-5---289999714101588----88878507776-23763365
Q gi|254780368|r   26 IETENT-KISMNPFDE----IALEESLQLREKGI-A-T---EVIVVSIGSCKVEEV----LKNSLAMGADR-GILIESNE   90 (249)
Q Consensus        26 i~~~~~-~~~in~~D~----~AlE~Al~lke~~~-g-~---~V~~lsvG~~~~~~~----Lr~alAmGaD~-ai~i~d~~   90 (249)
                      ..+.|+ ++.+-..||    -|+++|.++-++.+ . .   -+++-|.-|+.....    |..  .+|+.+ +.-.+-..
T Consensus        34 ~~rtGI~~R~va~~dE~t~~lA~~AA~~aL~~agi~~~dIdlIi~aT~Tpd~~~pstA~~vq~--~LGl~~~~~afDi~a  111 (346)
T PRK04262         34 KKGLGVEEKSVPGPDEDTATIAVEAARNALKRAGIDPKEIGAVYVGSESHPYAVKPTATIVAE--ALGATPDLTAADLEF  111 (346)
T ss_pred             EECCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCHHHCCEEEEEECCCCCCCCCHHHHHHH--HHCCCCCEEEEEHHC
T ss_conf             136685078778999999999999999999875999778898999647888667650689999--838998805986102


Q ss_pred             CCCHHHHHHHHHHH-HHCC--CCCEEEEEEC
Q ss_conf             47889999999998-6126--8649999611
Q gi|254780368|r   91 TLEPLSIAKILREI-VKKE--NPIIVIAGKQ  118 (249)
Q Consensus        91 ~~D~~~~A~~La~~-i~~~--~~DLIl~G~~  118 (249)
                      ..-.+..|-.+|.. |+..  ..-||+++.-
T Consensus       112 aCsGf~~aL~~A~~~I~sg~~~~~LVV~aD~  142 (346)
T PRK04262        112 ACKAGTAALQAAMGLVKSGMIKYALAIGADT  142 (346)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             2114999999999999739997699983133


No 69 
>pfam02585 PIG-L GlcNAc-PI de-N-acetylase. Members of this family are related to PIG-L an N-acetylglucosaminylphosphatidylinositol de-N-acetylase (EC:3.5.1.89) that catalyses the second step in GPI biosynthesis.
Probab=54.78  E-value=17  Score=17.02  Aligned_cols=68  Identities=22%  Similarity=0.402  Sum_probs=38.8

Q ss_pred             HHHHHCCCCCCEEEEEE--CCC-----------HHHHHHHHHHHHCCCCCEEEECCC-CCC---HHHHHHHHHHHHHCCC
Q ss_conf             99985599852899997--141-----------015888887850777623763365-478---8999999999861268
Q gi|254780368|r   47 LQLREKGIATEVIVVSI--GSC-----------KVEEVLKNSLAMGADRGILIESNE-TLE---PLSIAKILREIVKKEN  109 (249)
Q Consensus        47 l~lke~~~g~~V~~lsv--G~~-----------~~~~~Lr~alAmGaD~ai~i~d~~-~~D---~~~~A~~La~~i~~~~  109 (249)
                      .+++++  |..|.++++  |..           +..+..+-+=.+|++..+.+.-+. ..+   .....+.|...+++..
T Consensus        19 ~~~~~~--g~~v~vv~~t~g~~~~~~~~~~~~~R~~E~~~a~~~lG~~~~~~l~~~d~~~~~~~~~~~~~~i~~~i~~~k   96 (111)
T pfam02585        19 AKLAEQ--GHEVHVVTLTDGEAGGLSPEELGAIRRREARAAAAILGVERVIFLDFPDGGLDEWDLEELLAALARLIREIR   96 (111)
T ss_pred             HHHHHC--CCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             999976--998799995688767777378999999999999998099825899999975133579999999999999859


Q ss_pred             CCEEEEE
Q ss_conf             6499996
Q gi|254780368|r  110 PIIVIAG  116 (249)
Q Consensus       110 ~DLIl~G  116 (249)
                      ||+|++=
T Consensus        97 Pd~V~t~  103 (111)
T pfam02585        97 PDVVLTP  103 (111)
T ss_pred             CCEEEEC
T ss_conf             9799978


No 70 
>pfam09370 TIM-br_sig_trns TIM-barrel signal transduction protein. This domain is likely to have a TIM barrel fold related to IGPS. Although this family of proteins are functionally uncharacterized this domain is found as an N-terminal domain of sigma 54 -dependent transcriptional activators (enhancer-binding proteins) suggesting a potential role in signal recognition/receiving and signal transduction.
Probab=54.71  E-value=17  Score=17.01  Aligned_cols=28  Identities=25%  Similarity=0.175  Sum_probs=17.4

Q ss_pred             CEEEEEECCCCCCCEEHHHHHHHHHCCCC
Q ss_conf             49999611358886128999999857961
Q gi|254780368|r  111 IIVIAGKQTTDNESNQTGQMLAALMRWPQ  139 (249)
Q Consensus       111 DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~  139 (249)
                      -=||+|...+|-. -.++..|-....+.+
T Consensus        82 tPViaGv~~tDP~-~~~~~~L~~l~~~Gf  109 (268)
T pfam09370        82 TPVLAGVCGTDPF-RDMDRFLDELKEMGF  109 (268)
T ss_pred             CCEEEECCCCCCC-CCHHHHHHHHHHHCC
T ss_conf             8758761588974-529999999997197


No 71 
>TIGR01814 kynureninase kynureninase; InterPro: IPR010111   This entry describes kynureninase, it is a pyridoxal-5'-phosphate (PLP)-dependent enzyme that catalyzes the hydrolytic cleavage of L-kynurenine to anthranilic acid and L-alanine. Kynurinine is a Trp breakdown product and a precursor for NAD. This reaction is a key step in the catabolism of L-tryptophan by Pseudomonas fluorescens and some other bacteria (1). In fungi and vertebrates, kynurenine is first hydroxylated to 3-hydroxykynurenine, which is the preferred substrate of kynureninase in those organisms, resulting in 3-hydroxyanthranilate and L-alanine.   Sequence alignment with other PLP-dependent enzymes indicated that kynureninase is in subgroup IVa of the aminotransferases, along with nifS, CsdB, and serine-pyruvate aminotransferase, which suggests that kynureninase has an aminotransferase fold .; GO: 0030170 pyridoxal phosphate binding, 0030429 kynureninase activity, 0006569 tryptophan catabolic process, 0009435 NAD biosynthetic process, 0005737 cytoplasm.
Probab=54.50  E-value=9.9  Score=18.47  Aligned_cols=37  Identities=30%  Similarity=0.335  Sum_probs=26.3

Q ss_pred             CCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHH
Q ss_conf             601368999999998559985289999714101588888
Q gi|254780368|r   36 NPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKN   74 (249)
Q Consensus        36 n~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~   74 (249)
                      =|-|.||+|.++||+-.  .-+=.-+.+-|.+++++||.
T Consensus       144 FPSD~Ya~e~Q~~L~g~--~~e~~l~~~~p~~~e~tLr~  180 (444)
T TIGR01814       144 FPSDLYAIESQLRLHGL--EPEEHLVQVEPREAEETLRL  180 (444)
T ss_pred             CCHHHHHHHHHHHCCCC--CCCCCEEEEEECCCCCHHHH
T ss_conf             87279999999746798--73441267742234421107


No 72 
>PRK09230 cytosine deaminase; Provisional
Probab=54.45  E-value=17  Score=16.99  Aligned_cols=57  Identities=19%  Similarity=0.289  Sum_probs=35.1

Q ss_pred             CCEEEECCCCEECCCHHHHHHHHHHHHHHCCCC---CCEEEEE----ECCCHHHHHHHHHHHHCCC
Q ss_conf             881632487733260136899999999855998---5289999----7141015888887850777
Q gi|254780368|r   23 YSGIETENTKISMNPFDEIALEESLQLREKGIA---TEVIVVS----IGSCKVEEVLKNSLAMGAD   81 (249)
Q Consensus        23 ~~~i~~~~~~~~in~~D~~AlE~Al~lke~~~g---~~V~~ls----vG~~~~~~~Lr~alAmGaD   81 (249)
                      |..-.|+.+.. -+|. .-++|.-+++||+..+   -+++++-    +..+...+.|++|+.+|||
T Consensus       115 Gtt~iRtHvDv-~dp~-l~~leal~~~re~~~~~idlQiVAFPQ~Gl~~~~~~~~Ll~eAl~~Gad  178 (426)
T PRK09230        115 GIQHVRTHVDV-SDPT-LTALKAMLEVKEEVAPWVDLQIVAFPQEGILSYPNGEALLEEALRLGAD  178 (426)
T ss_pred             CHHHEECCCCC-CCCH-HHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHCCC
T ss_conf             82440133453-7703-5169999999998435201688830365424688779999999980898


No 73 
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase; InterPro: IPR012773    Members of this family of class III pyridoxal-phosphate-dependent aminotransferases are diaminobutyrate--2-oxoglutarate aminotransferase (2.6.1.76 from EC) that catalyze the first step in ectoine biosynthesis from L-aspartate beta-semialdehyde. This family is readily separated phylogenetically from enzymes with the same substrate and product but involved in other process such as siderophore (Q9Z3R2 from SWISSPROT) or 1,3-diaminopropane (P44951 from SWISSPROT) biosynthesis. Ectoine is a compatible solute particularly effective in conferring salt tolerance.; GO: 0030170 pyridoxal phosphate binding, 0047307 diaminobutyrate-pyruvate transaminase activity, 0019491 ectoine biosynthetic process.
Probab=53.57  E-value=13  Score=17.72  Aligned_cols=106  Identities=15%  Similarity=0.123  Sum_probs=47.3

Q ss_pred             CCCHHHHHHHHHHHHHHCCCC-CCEEEEEEC-------CCHHH--HHHHHHHHHCCCCCEEEECCCCCC-HHHHHHHHHH
Q ss_conf             260136899999999855998-528999971-------41015--888887850777623763365478-8999999999
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIA-TEVIVVSIG-------SCKVE--EVLKNSLAMGADRGILIESNETLE-PLSIAKILRE  103 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g-~~V~~lsvG-------~~~~~--~~Lr~alAmGaD~ai~i~d~~~~D-~~~~A~~La~  103 (249)
                      -.|==.||||.||+|.-|..| ..|+++|=|       --+..  ..-|+.--+=-...+.+-.|..++ .+-+..-|-+
T Consensus       104 pGPTGTNaVEsAlKLARKvtGR~nvvaFTNaFHGmt~GsLsvTGN~~~R~~aG~~~~~v~~mPYDgY~~~~~D~~~Yfe~  183 (413)
T TIGR02407       104 PGPTGTNAVESALKLARKVTGRSNVVAFTNAFHGMTLGSLSVTGNRFKRQGAGVPLSNVSRMPYDGYLGGEVDTIAYFEK  183 (413)
T ss_pred             CCCCCHHHHHHHHHHHHCCCCCCCEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEECCCCCCCCCCCCHHHHHHH
T ss_conf             88786407999999985038984068851773023489888643344430267447782568765577864322899998


Q ss_pred             HHHCC--CCC---EEEEEECCCCCCCEEHHHHHHHHHCCCCEEE
Q ss_conf             86126--864---9999611358886128999999857961332
Q gi|254780368|r  104 IVKKE--NPI---IVIAGKQTTDNESNQTGQMLAALMRWPQATF  142 (249)
Q Consensus       104 ~i~~~--~~D---LIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~  142 (249)
                      ++.+.  |.|   -|+.  ++.=++.|.=.+...++-.+--++.
T Consensus       184 ~L~D~sSGvd~PAAvIL--ETVQGEGGiNvAs~eWLq~l~~lCr  225 (413)
T TIGR02407       184 LLEDSSSGVDLPAAVIL--ETVQGEGGINVASKEWLQRLEKLCR  225 (413)
T ss_pred             HHCCCCCCCCCCCEEEE--ECCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             61788898476725898--1103757703123557999999998


No 74 
>PRK09390 fixJ response regulator FixJ; Provisional
Probab=53.51  E-value=18  Score=16.89  Aligned_cols=41  Identities=20%  Similarity=0.169  Sum_probs=16.5

Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCC
Q ss_conf             3689999999985599852899997141015888887850777
Q gi|254780368|r   39 DEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGAD   81 (249)
Q Consensus        39 D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD   81 (249)
                      |.+.+|..-+|++.+....|.++|+-  .......+|+..||+
T Consensus        59 ~~~G~e~l~~l~~~~p~~~vivlT~~--~~~~~~~~al~~GA~   99 (202)
T PRK09390         59 GIDGIELLRRLKARGSPLPVIVMTGH--GDVPLAVEAMKLGAI   99 (202)
T ss_pred             CCCCHHHHHHHHHCCCCCCEEEEEEC--CCHHHHHHHHHCCCH
T ss_conf             98960799998722899867999745--748888999982946


No 75 
>PRK01506 consensus
Probab=52.98  E-value=18  Score=16.84  Aligned_cols=168  Identities=18%  Similarity=0.228  Sum_probs=91.7

Q ss_pred             EEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHH---HHHCCCCCCEEEEE--ECCCHHH----------
Q ss_conf             98603038876059807888163248773326013689999999---98559985289999--7141015----------
Q gi|254780368|r    5 VPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQ---LREKGIATEVIVVS--IGSCKVE----------   69 (249)
Q Consensus         5 V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~---lke~~~g~~V~~ls--vG~~~~~----------   69 (249)
                      +-+++-||-+..+++..+-.+=|--=+...-.|-|++=+|.-+-   +|+. +...||++.  +|..+.+          
T Consensus        36 ~~~~~F~DGE~~vri~~~vrg~dV~ivqs~~~p~nd~lmELll~i~a~r~~-gA~~It~ViPY~~YaRQDr~~~~ge~is  114 (317)
T PRK01506         36 CSVDRFSDGEVQINIEESIRGCDVFIIQSTSAPVNEHIMELLIMIDALKRA-SAKTINIVIPYYGYARQDRKARSREPIT  114 (317)
T ss_pred             EEEEECCCCCEEEEECCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCCEEEEECCCCCCCCCCCCCCCCCCEE
T ss_conf             178887999889987787789828998589999208999999999998873-8974899626765243764335887613


Q ss_pred             -HHHHHHH-HHCCCCCEEEECCC---------CCCHHHHHHHHHHHHHCCCC-CEEEEEECCCCCCCEEHHHHHHHHHCC
Q ss_conf             -8888878-50777623763365---------47889999999998612686-499996113588861289999998579
Q gi|254780368|r   70 -EVLKNSL-AMGADRGILIESNE---------TLEPLSIAKILREIVKKENP-IIVIAGKQTTDNESNQTGQMLAALMRW  137 (249)
Q Consensus        70 -~~Lr~al-AmGaD~ai~i~d~~---------~~D~~~~A~~La~~i~~~~~-DLIl~G~~S~D~~~g~v~~~lA~~Lg~  137 (249)
                       ..+=+.| ++|+|+.+.+.-..         ..|.+.....|+.++++.+. ++++.   |.|.++..-.-.+|..||.
T Consensus       115 ak~vA~ll~~~G~d~vitvDlH~~~i~~fF~ip~~~l~~~~~l~~~~~~~~~~~~vVV---sPD~Ga~kra~~~a~~L~~  191 (317)
T PRK01506        115 AKLVANLLETAGATRVITLDLHAPQIQGFFDIPIDHLMGVPILSDYFETKGLKDIVIV---SPDHGGVTRARKMADRLKA  191 (317)
T ss_pred             HHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCEEEECHHHHHHHHHCCCCCCEEE---ECCCHHHHHHHHHHHHCCC
T ss_conf             8988878741588537996278487750169984315850888889985488774899---0492489999999997299


Q ss_pred             CCEEEEEEEEECCCEEEEEEECCCCEEEEEECCCEEEEEECCCCCC
Q ss_conf             6133244334328659999835896799996398899984355654
Q gi|254780368|r  138 PQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEP  183 (249)
Q Consensus       138 p~vt~v~~i~~~~~~~~v~r~~e~g~e~v~~~lPavisv~~~~n~P  183 (249)
                      |+. .+.+-....+.......      .-.++.--++-|+.=+.+-
T Consensus       192 ~~~-~~~K~R~~~~~v~~~~~------~gdV~Gr~vIIVDDiI~TG  230 (317)
T PRK01506        192 PIA-IIDKRRPRPNVAEVMNI------IGNIEGKTAILIDDIIDTA  230 (317)
T ss_pred             CEE-EEEEECCCCCEEEEECC------CCCCCCCEEEEECCHHHCC
T ss_conf             668-89864179980463024------5655796278751322135


No 76 
>pfam06032 DUF917 Protein of unknown function (DUF917). This family consists of hypothetical bacterial and archaeal proteins of unknown function.
Probab=52.88  E-value=18  Score=16.83  Aligned_cols=28  Identities=11%  Similarity=0.087  Sum_probs=11.8

Q ss_pred             CCEEEEEECCCCCCCEEHHHHHHHHHCCCC
Q ss_conf             649999611358886128999999857961
Q gi|254780368|r  110 PIIVIAGKQTTDNESNQTGQMLAALMRWPQ  139 (249)
Q Consensus       110 ~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~  139 (249)
                      ++-|++-.  +.+.++.+|-.+|..+|+|.
T Consensus        92 ~~ai~~~E--iGG~N~~~pl~~Aa~~GlPv  119 (352)
T pfam06032        92 VDAIMPIE--IGGSNSLIPLLVAARLGLPV  119 (352)
T ss_pred             CCEEEEEC--CCCCCHHHHHHHHHHHCCCE
T ss_conf             66898564--47621588999999839967


No 77 
>cd01999 Argininosuccinate_Synthase Argininosuccinate synthase. The Argininosuccinate synthase is a urea cycle enzyme that catalyzes the penultimate step in arginine biosynthesis: the ATP-dependent ligation of citrulline to aspartate to form argininosuccinate, AMP and pyrophosphate .  In humans, a defect in the AS gene causes citrullinemia, a genetic disease characterized by severe vomiting spells and mental retardation. AS is a homotetrameric enzyme of chains of about 400 amino-acid residues. An arginine seems to be important for the enzyme's catalytic mechanism. The sequences of AS from various prokaryotes, archaebacteria and eukaryotes show significant similarity
Probab=52.51  E-value=18  Score=16.79  Aligned_cols=95  Identities=29%  Similarity=0.334  Sum_probs=63.8

Q ss_pred             HHHHHHCCCCCCEEEEEE--CCCHH--HHHHHHHHHHCCCCCEEEECC------------------CC-------CCHHH
Q ss_conf             999985599852899997--14101--588888785077762376336------------------54-------78899
Q gi|254780368|r   46 SLQLREKGIATEVIVVSI--GSCKV--EEVLKNSLAMGADRGILIESN------------------ET-------LEPLS   96 (249)
Q Consensus        46 Al~lke~~~g~~V~~lsv--G~~~~--~~~Lr~alAmGaD~ai~i~d~------------------~~-------~D~~~   96 (249)
                      -..|+|+ ++.+|+++++  |..+-  +..-++|+..||.+.+.+..+                  ++       ..--.
T Consensus        15 l~wL~e~-~~~eVia~~~d~Gq~~e~~~~i~~kA~~~GA~~~~v~D~r~ef~~~~i~pai~ana~Yeg~Y~L~tslaRpl   93 (385)
T cd01999          15 LKWLKEK-GGYEVIAVTADVGQPEEEIEAIEEKALKLGAKKHVVVDLREEFVEDYIFPAIQANALYEGTYPLGTALARPL   93 (385)
T ss_pred             HHHHHHH-CCCEEEEEEEECCCCHHHHHHHHHHHHHHCCCEEEEECHHHHHHHHHHHHHHHHCCCCCCCEECCCCHHHHH
T ss_conf             9999974-598499999989996677789999999819978999612999999999999960864337532135015789


Q ss_pred             HHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEE
Q ss_conf             99999998612686499996113588861289999998579613324
Q gi|254780368|r   97 IAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFV  143 (249)
Q Consensus        97 ~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v  143 (249)
                      +|+.+.+++++.+.+.|--|  ++-.++-||=.-++-..=.|.+..+
T Consensus        94 Iak~~ve~A~~~ga~aiaHG--~TGkGNDQvRFe~~~~aL~P~l~ii  138 (385)
T cd01999          94 IAKALVEVAKEEGADAVAHG--CTGKGNDQVRFELAFYALNPDLKII  138 (385)
T ss_pred             HHHHHHHHHHHHCCEEEEEC--CCCCCCCHHHHHHHHHHHCCCCEEE
T ss_conf             99999999998098499745--6668884068999999859997585


No 78 
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism]
Probab=51.76  E-value=19  Score=16.71  Aligned_cols=81  Identities=17%  Similarity=0.202  Sum_probs=52.4

Q ss_pred             EEEEEECCCHHHHHHHHHHHH----CCCCCEEE-ECCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHH
Q ss_conf             899997141015888887850----77762376-3365478899999999986126864999961135888612899999
Q gi|254780368|r   58 VIVVSIGSCKVEEVLKNSLAM----GADRGILI-ESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLA  132 (249)
Q Consensus        58 V~~lsvG~~~~~~~Lr~alAm----GaD~ai~i-~d~~~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA  132 (249)
                      .+++-||..+.-++.++|..+    |.+--..| +..-.  |-- -...++-.++.|+..|+.|.    |++.++|+|+|
T Consensus         4 ~V~IIMGS~SD~~~mk~Aa~~L~~fgv~ye~~VvSAHRT--Pe~-m~~ya~~a~~~g~~viIAgA----GgAAHLPGmvA   76 (162)
T COG0041           4 KVGIIMGSKSDWDTMKKAAEILEEFGVPYEVRVVSAHRT--PEK-MFEYAEEAEERGVKVIIAGA----GGAAHLPGMVA   76 (162)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCC--HHH-HHHHHHHHHHCCCEEEEECC----CCHHHCCHHHH
T ss_conf             189995570239999999999998499759999844679--899-99999999878975999657----51110620265


Q ss_pred             HHHCCCCEEEEEE
Q ss_conf             9857961332443
Q gi|254780368|r  133 ALMRWPQATFVSN  145 (249)
Q Consensus       133 ~~Lg~p~vt~v~~  145 (249)
                      .+--.|-+..=..
T Consensus        77 a~T~lPViGVPv~   89 (162)
T COG0041          77 AKTPLPVIGVPVQ   89 (162)
T ss_pred             HCCCCCEEECCCC
T ss_conf             5587986741476


No 79 
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair]
Probab=51.34  E-value=12  Score=17.84  Aligned_cols=75  Identities=20%  Similarity=0.263  Sum_probs=39.7

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCC--------CCH------------HHHHHHHHHHHHCCCCCEE
Q ss_conf             98528999971410158888878507776237633654--------788------------9999999998612686499
Q gi|254780368|r   54 IATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNET--------LEP------------LSIAKILREIVKKENPIIV  113 (249)
Q Consensus        54 ~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~--------~D~------------~~~A~~La~~i~~~~~DLI  113 (249)
                      .|..+.=+-.|.-   ..=-+||+.||+++++|+-+..        .+.            -+. +.|....++..||+|
T Consensus        43 ~g~~~LDlFAGSG---aLGlEAlSRGA~~~~~vE~~~~a~~~l~~N~~~l~~~~~~~~~~~da~-~~L~~~~~~~~FDlV  118 (187)
T COG0742          43 EGARVLDLFAGSG---ALGLEALSRGAARVVFVEKDRKAVKILKENLKALGLEGEARVLRNDAL-RALKQLGTREPFDLV  118 (187)
T ss_pred             CCCEEEEECCCCC---HHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEEECHH-HHHHHCCCCCCCCEE
T ss_conf             7988999468764---768999857885699996598999999999998487612599840089-998722778851289


Q ss_pred             EEEECCCCCCCEEHHHHHHHHH
Q ss_conf             9961135888612899999985
Q gi|254780368|r  114 IAGKQTTDNESNQTGQMLAALM  135 (249)
Q Consensus       114 l~G~~S~D~~~g~v~~~lA~~L  135 (249)
                      |.-   .=...+......+-.+
T Consensus       119 flD---PPy~~~l~~~~~~~~~  137 (187)
T COG0742         119 FLD---PPYAKGLLDKELALLL  137 (187)
T ss_pred             EEC---CCCCCCHHHHHHHHHH
T ss_conf             968---9975360668999988


No 80 
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]
Probab=51.18  E-value=19  Score=16.66  Aligned_cols=31  Identities=16%  Similarity=0.194  Sum_probs=18.5

Q ss_pred             CEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEE
Q ss_conf             4999961135888612899999985796133244
Q gi|254780368|r  111 IIVIAGKQTTDNESNQTGQMLAALMRWPQATFVS  144 (249)
Q Consensus       111 DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~  144 (249)
                      -+++.|-   -++-|+...++|..+|...+.-+.
T Consensus       145 ~VLv~ga---aGgVG~~aiQlAk~~G~~~v~~~~  175 (326)
T COG0604         145 TVLVHGA---AGGVGSAAIQLAKALGATVVAVVS  175 (326)
T ss_pred             EEEEECC---CCHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             7999778---546999999999984995899981


No 81 
>KOG0538 consensus
Probab=49.82  E-value=20  Score=16.52  Aligned_cols=61  Identities=20%  Similarity=0.174  Sum_probs=30.6

Q ss_pred             CCCCHHHHHHHHHCCCCEECHHHHCC----CC----CCCEEEEEEECCCCC-CCCEEECCHHHHHHHHHHHH
Q ss_conf             54698889988521661204989076----66----684579995178852-47455379999999999861
Q gi|254780368|r  184 RYISLPNIIKARKKRIEKKKATDFAI----DL----TPRLKVLRFEENRAE-RKGLRLYSTTKLIEILKSKH  246 (249)
Q Consensus       184 R~psl~~im~A~kk~i~~~~~~dlg~----d~----~~~~~v~~~~~p~~~-~~g~~~e~~~eLv~~L~~e~  246 (249)
                      .+-.|+.+++|-.-.|++|=  |=|+    |.    +=..+-+-+-.|--= -+..-..++.+.++.|++|-
T Consensus       264 tI~~L~Evv~aV~~ri~V~l--DGGVR~G~DVlKALALGAk~VfiGRP~v~gLA~~Ge~GV~~vl~iL~~ef  333 (363)
T KOG0538         264 TIEALPEVVKAVEGRIPVFL--DGGVRRGTDVLKALALGAKGVFIGRPIVWGLAAKGEAGVKKVLDILRDEF  333 (363)
T ss_pred             HHHHHHHHHHHHCCCEEEEE--ECCCCCCHHHHHHHHCCCCEEEECCCCEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             18879999998628547997--26733542799998516736885672102000256032999999999999


No 82 
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria. amsK in Erwinia amylovora, has been reported to be involved in the biosynthesis of amylovoran, a exopolysaccharide acting as a virulence factor.
Probab=49.73  E-value=20  Score=16.51  Aligned_cols=95  Identities=19%  Similarity=0.154  Sum_probs=55.9

Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECC---CCCCHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             368999999998559985289999714101588888785077762376336---54788999999999861268649999
Q gi|254780368|r   39 DEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESN---ETLEPLSIAKILREIVKKENPIIVIA  115 (249)
Q Consensus        39 D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~---~~~D~~~~A~~La~~i~~~~~DLIl~  115 (249)
                      ..+-++++..|..+  |-+|++++..++.....-      ..+......-.   .....+..+..|...+++.+||+|-+
T Consensus        14 etfv~~la~~L~~~--GHeV~v~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~~DiIH~   85 (355)
T cd03799          14 ETFILREILALEAA--GHEVEIFSLRPPEDTLVH------PEDRAELARTRYLARSLALLAQALVLARELRRLGIDHIHA   85 (355)
T ss_pred             CHHHHHHHHHHHHC--CCEEEEEECCCCCCCCCC------CCCCCEECCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             17999999999967--984999953488777306------4302121552154777999999999999997779989997


Q ss_pred             EECCCCCCCEEHHHHHHHHHCCCCEEEEE
Q ss_conf             61135888612899999985796133244
Q gi|254780368|r  116 GKQTTDNESNQTGQMLAALMRWPQATFVS  144 (249)
Q Consensus       116 G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~  144 (249)
                      -  + -...+.++...+...|+|.+....
T Consensus        86 H--~-~~~~~~~~~~~~~~~~ip~v~t~H  111 (355)
T cd03799          86 H--F-GTTPATVAMLASRLGGIPYSFTAH  111 (355)
T ss_pred             C--C-CCHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             6--8-833799999999974999999981


No 83 
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain.  FCB2 (AKA L-lactate:cytochrome c oxidoreductase) is a respiratory enzyme located in the intermembrane space of fungal mitochondria which catalyzes the oxidation of L-lactate to pyruvate. FCB2 also participates in a short electron-transport chain involving cytochrome c and cytochrome oxidase which ultimately directs the reducing equivalents gained from L-lactate oxidation to oxygen, yielding one molecule of ATP for every L-lactate molecule consumed. FCB2  is composed of 2 domains: a C-terminal flavin-binding domain, which includes the active site for lacate oxidation, and an N-terminal b2-cytochrome domain, required for efficient cytochrome c reduction. FCB2 is a homotetramer and contains two noncovalently bound cofactors, FMN and heme per subunit.
Probab=49.58  E-value=17  Score=16.91  Aligned_cols=81  Identities=15%  Similarity=0.165  Sum_probs=31.6

Q ss_pred             CCCEECCCHHHHHH-----HHHHH-HHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHH
Q ss_conf             87733260136899-----99999-9855998528999971410158888878507776237633654788999999999
Q gi|254780368|r   30 NTKISMNPFDEIAL-----EESLQ-LREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILRE  103 (249)
Q Consensus        30 ~~~~~in~~D~~Al-----E~Al~-lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~  103 (249)
                      ..|..+.|.--..+     |.++. -..+ .|.-.++-|++....++. .++..-|.-.-+.+.-  ..|.-.+...|..
T Consensus        64 ~~P~~iAP~g~~~l~hp~gE~a~AraA~~-~gi~~~lSt~ss~slEdV-a~a~~~~~~~wfQLY~--~~dr~~~~~li~R  139 (344)
T cd02922          64 SLPFFISPAALAKLAHPDGELNLARAAGK-HGILQMISTNASCSLEEI-VDARPPDQPLFFQLYV--NKDRTKTEELLKR  139 (344)
T ss_pred             CCCEEECHHHHHHHCCCCHHHHHHHHHHH-CCCCEEEECCCCCCHHHH-HHHCCCCCCEEEEEEC--CCCHHHHHHHHHH
T ss_conf             77515664777643288456999999997-488657405777888999-9865689866999824--7767999999999


Q ss_pred             HHHCCCCC-EEEE
Q ss_conf             86126864-9999
Q gi|254780368|r  104 IVKKENPI-IVIA  115 (249)
Q Consensus       104 ~i~~~~~D-LIl~  115 (249)
                       +++.||. ||++
T Consensus       140 -A~~aG~~alvlT  151 (344)
T cd02922         140 -AEKLGAKAIFLT  151 (344)
T ss_pred             -HHHCCCCEEEEE
T ss_conf             -998699889995


No 84 
>pfam04007 DUF354 Protein of unknown function (DUF354). Members of this family are around 350 amino acids in length. They are found in archaebacteria and have no known function.
Probab=49.21  E-value=20  Score=16.46  Aligned_cols=171  Identities=18%  Similarity=0.241  Sum_probs=79.5

Q ss_pred             HHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCC-------HHHHHHHHHHHHHCCCCCEEEEEECCC
Q ss_conf             9985599852899997141015888887850777623763365478-------899999999986126864999961135
Q gi|254780368|r   48 QLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLE-------PLSIAKILREIVKKENPIIVIAGKQTT  120 (249)
Q Consensus        48 ~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D-------~~~~A~~La~~i~~~~~DLIl~G~~S~  120 (249)
                      +|+++  |-+|.+.+-.-....+-|+.   .|-+- +.+... +.+       ...-..-|...+++..||+.++. .|.
T Consensus        22 eL~k~--GheV~iTaR~~~~~~~LL~~---y~i~~-~~iG~~-g~s~~~Kl~~~~~R~~~L~~~~~~~~PDv~is~-~S~   93 (335)
T pfam04007        22 ELEKE--GYEVLLTCRKFGELPELLRS---LGFQV-KSIGKH-GATLIKKLLSSAERVYLLTKLIPEKKPDVAIMK-NSM   93 (335)
T ss_pred             HHHHC--CCEEEEEEECCCHHHHHHHH---CCCCE-EEECCC-CCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEC-CCH
T ss_conf             99868--98899999613519999997---69976-997588-888899999999999999999886299789944-880


Q ss_pred             CCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEECCCCEEEEEECCCEEEEEE----C------CC-CC-CCCCCH
Q ss_conf             888612899999985796133244334328659999835896799996398899984----3------55-65-454698
Q gi|254780368|r  121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD----L------NL-NE-PRYISL  188 (249)
Q Consensus       121 D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g~e~v~~~lPavisv~----~------~~-n~-PR~psl  188 (249)
                            -.+++|..||+|++.....     .....       ...+..++.-++-+=    .      |. +. -||+++
T Consensus        94 ------~a~~va~~LgipsI~f~Dt-----eha~~-------~~~Lt~Pf~~~i~~P~~~~~~~~~~~G~~~~i~~y~g~  155 (335)
T pfam04007        94 ------ELPRVAFGLRIPSIIVLDN-----EHALA-------ANKLTFPLADYILVPEIIDDEFLRFFGADNRIRTYPGI  155 (335)
T ss_pred             ------HHHHHHHHCCCCEEEEECC-----HHHCC-------CCEEEEECCCEEECCCCCCHHHHHHHCCCCCEEEECCC
T ss_conf             ------1999998829987999477-----55412-------33023123868881244677899860877856766684


Q ss_pred             HHHHHHHHCCCCEECHHHHCCCCCCCEEEEEEECCCCC-CCCEEECCHHHHHHHHHHHH
Q ss_conf             88998852166120498907666684579995178852-47455379999999999861
Q gi|254780368|r  189 PNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAE-RKGLRLYSTTKLIEILKSKH  246 (249)
Q Consensus       189 ~~im~A~kk~i~~~~~~dlg~d~~~~~~v~~~~~p~~~-~~g~~~e~~~eLv~~L~~e~  246 (249)
                      +..+--..-....--..++|++.. +.-++|..+-.+. -.|. .+-..++++.|+.+.
T Consensus       156 ~E~a~l~~F~Pd~~vl~~lgl~~~-~yIvvR~~~~~A~y~~g~-~~i~~~ii~~l~~~~  212 (335)
T pfam04007       156 KEIANISDYVPDPEILKKLGLEFE-EYIVMRPEPLASSYVNGH-ESILPEIIEMLTKEG  212 (335)
T ss_pred             CEEEECCCCCCCHHHHHHCCCCCC-CEEEEEECCCCCEECCCC-CCHHHHHHHHHHHCC
T ss_conf             414321666898657876499879-889996164556001144-215999999998759


No 85 
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed
Probab=49.06  E-value=21  Score=16.45  Aligned_cols=13  Identities=8%  Similarity=-0.097  Sum_probs=8.2

Q ss_pred             HHHHHHHHCCCCE
Q ss_conf             9999998579613
Q gi|254780368|r  128 GQMLAALMRWPQA  140 (249)
Q Consensus       128 ~~~lA~~Lg~p~v  140 (249)
                      .....+.|++|++
T Consensus       125 ~~~~~~~l~~P~i  137 (304)
T PRK01372        125 LLAAIDKLGLPLV  137 (304)
T ss_pred             HHHHHHHHCCCEE
T ss_conf             9999876189879


No 86 
>PRK11197 lldD L-lactate dehydrogenase; Provisional
Probab=48.77  E-value=19  Score=16.65  Aligned_cols=14  Identities=7%  Similarity=0.380  Sum_probs=9.8

Q ss_pred             CCHHHHHHHHHHHH
Q ss_conf             79999999999861
Q gi|254780368|r  233 YSTTKLIEILKSKH  246 (249)
Q Consensus       233 e~~~eLv~~L~~e~  246 (249)
                      ++++.++++|++|.
T Consensus       342 ~GV~~~l~iL~~El  355 (381)
T PRK11197        342 AGVANLLDLIEKEM  355 (381)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             89999999999999


No 87 
>cd06259 YdcF-like YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX,  which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.
Probab=48.40  E-value=21  Score=16.38  Aligned_cols=97  Identities=12%  Similarity=0.206  Sum_probs=66.2

Q ss_pred             CHHHHHHHHHHHHHHCCCCCCEEEEEECC------CHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             01368999999998559985289999714------101588888785077762376336547889999999998612686
Q gi|254780368|r   37 PFDEIALEESLQLREKGIATEVIVVSIGS------CKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENP  110 (249)
Q Consensus        37 ~~D~~AlE~Al~lke~~~g~~V~~lsvG~------~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~~~~  110 (249)
                      +.-..=++.|++|-.++. ....++|-|.      .+++-.-+.++..|.+..-.+.++...+|+..|......+++.+.
T Consensus        17 ~~~~~R~~~a~~L~~~~~-~~~ii~sGg~~~~~~~~Ea~~~~~~l~~~gv~~~~i~~e~~s~~T~ena~~~~~~~~~~~~   95 (150)
T cd06259          17 PILAERLDAAAELYRAGP-APKLIVSGGQGPGEGYSEAEAMARYLIELGVPAEAILLEDRSTNTYENARFSAELLRERGI   95 (150)
T ss_pred             HHHHHHHHHHHHHHHHCC-CCEEEEECCCCCCCCCCHHHHHHHHHHHCCCCHHHEEECCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             799999999999998199-9889995887999988999999999998599989968313477702459999999997699


Q ss_pred             -CEEEEEECCCCCCCEEHHHHHHHHHCCC
Q ss_conf             -4999961135888612899999985796
Q gi|254780368|r  111 -IIVIAGKQTTDNESNQTGQMLAALMRWP  138 (249)
Q Consensus       111 -DLIl~G~~S~D~~~g~v~~~lA~~Lg~p  138 (249)
                       .+++.    +|..+-.=..+++...+..
T Consensus        96 ~~i~lV----Ts~~H~~Ra~~~~~~~~~~  120 (150)
T cd06259          96 RSVLLV----TSAYHMPRALLIFRKAGLD  120 (150)
T ss_pred             CEEEEE----CCHHHHHHHHHHHHHHCCC
T ss_conf             879999----9888999999999980998


No 88 
>pfam00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain. The central domain of TPP enzymes contains a 2-fold Rossman fold.
Probab=48.02  E-value=21  Score=16.34  Aligned_cols=82  Identities=11%  Similarity=0.162  Sum_probs=44.4

Q ss_pred             HHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEE-ECCCE-EEEEEECCC----CEEEEEECCCEEE
Q ss_conf             99986126864999961135888612899999985796133244334-32865-999983589----6799996398899
Q gi|254780368|r  101 LREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIK-IIDNH-AIVTREVGH----GTMTMETPLPAVI  174 (249)
Q Consensus       101 La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~-~~~~~-~~v~r~~e~----g~e~v~~~lPavi  174 (249)
                      +++.+++-.-=+|++|....-.+...--..+|+.+|+|.++....-. +.+++ .-+-.-.-.    ..+.+ -..-+|+
T Consensus         4 ~~~~l~~AkrPvii~G~g~~~~~a~~~l~~lae~~~~Pv~~t~~~~~~~~~~hp~~~G~~g~~~~~~~~~~l-~~aDlvl   82 (138)
T pfam00205         4 AAELLAAAKRPVILVGGGVRRSGASEELRALAEKLGIPVVTTLMGKGAFPEDHPLYLGMLGMHGTPAANEAL-EEADLVL   82 (138)
T ss_pred             HHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHH-HCCCEEE
T ss_conf             999999689919998978352218999999999849987921112567898886557757765779998655-3399999


Q ss_pred             EEECCCCCC
Q ss_conf             984355654
Q gi|254780368|r  175 TVDLNLNEP  183 (249)
Q Consensus       175 sv~~~~n~P  183 (249)
                      .+....+..
T Consensus        83 ~lG~~l~~~   91 (138)
T pfam00205        83 AIGARFDDI   91 (138)
T ss_pred             EECCCCCCC
T ss_conf             978887865


No 89 
>cd00858 GlyRS_anticodon GlyRS Glycyl-anticodon binding domain. GlyRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only.
Probab=47.79  E-value=21  Score=16.32  Aligned_cols=71  Identities=14%  Similarity=0.055  Sum_probs=49.5

Q ss_pred             CHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEECCCCEEEEEE
Q ss_conf             8899999999986126864999961135888612899999985796133244334328659999835896799996
Q gi|254780368|r   93 EPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMET  168 (249)
Q Consensus        93 D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g~e~v~~  168 (249)
                      +-...|.-|+..+++.|+...+.     |.++--.-..-|+.+|+|+.--+-.=+++++++++++...+-.+.+.+
T Consensus        39 ~~~~~a~~i~~~L~~~gi~v~~D-----d~~s~G~K~~~~d~~giP~~ivIg~~~le~~~VtiR~Rdt~~q~~v~i  109 (121)
T cd00858          39 ELVEIAKEISEELRELGFSVKYD-----DSGSIGRRYARQDEIGTPFCVTVDFDTLEDGTVTIRERDSMRQVRVKI  109 (121)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEE-----CCCCHHHHHHHHHHHCCCEEEEEECCEECCCEEEEEECCCCCEEEEEH
T ss_conf             77999999999998779779970-----388831444678874898399992761037879999989995789999


No 90 
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator; InterPro: IPR014264   Members of this protein family share full-length homology with (but do not include) the acetoacetate metabolism regulatory protein AtoC (see Q06065 from SWISSPROT). These proteins have a Fis family DNA binding sequence, a response regulator receiver domain, and sigma-54 interaction domain. They are found strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system  common in Gram-positive bacteria, where members of IPR014265 from INTERPRO and IPR014266 from INTERPRO also occur..
Probab=47.37  E-value=22  Score=16.28  Aligned_cols=108  Identities=19%  Similarity=0.223  Sum_probs=53.8

Q ss_pred             HHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHH-----CCCCCEEEE
Q ss_conf             899999999855998528999971410158888878507776237633654788999999999861-----268649999
Q gi|254780368|r   41 IALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVK-----KENPIIVIA  115 (249)
Q Consensus        41 ~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~-----~~~~DLIl~  115 (249)
                      .+|++=|++   ...++|+|+|- ..+-+++|| |..|||=+   .. .++.|+-...-++..+..     .++=-|   
T Consensus        63 ~~L~qIL~~---~P~TKVIViTG-N~~r~NAlk-Ai~lGAYD---Fy-qKP~d~d~L~liv~RAf~L~~Le~ENRrL---  130 (451)
T TIGR02915        63 AALQQILAI---APDTKVIVITG-NDDRENALK-AIGLGAYD---FY-QKPIDPDVLKLIVDRAFRLYTLETENRRL---  130 (451)
T ss_pred             HHHHHHHHH---CCCCEEEEEEC-CCCCHHHHH-HHHCCCCC---CC-CCCCCHHHHHHHHHHHHHHHHHHHHHHHH---
T ss_conf             999999963---89804899866-898388999-96437510---13-57875789999999988888888876998---


Q ss_pred             EECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEECCCC
Q ss_conf             61135888612899999985796133244334328659999835896
Q gi|254780368|r  116 GKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHG  162 (249)
Q Consensus       116 G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g  162 (249)
                       ..+.++++....+.++.-=++-.+..-+. .+....+||.=..|.|
T Consensus       131 -~~~~~~Gst~~~Gli~~~~~m~kic~tIe-kvA~sd~TvllLGESG  175 (451)
T TIGR02915       131 -QSALGGGSTALEGLITSSPGMQKICRTIE-KVAPSDITVLLLGESG  175 (451)
T ss_pred             -HHCCCCCCCCCCCEEECCCCHHHHHHHHH-HHCCCCCEEEEECCCC
T ss_conf             -74068874103652206850678988865-2120000130104667


No 91 
>PRK02910 light-independent protochlorophyllide reductase subunit B; Provisional
Probab=46.50  E-value=22  Score=16.19  Aligned_cols=110  Identities=14%  Similarity=0.039  Sum_probs=61.3

Q ss_pred             CCEECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHH-HHCCCCCE----------------EEECCCCCC
Q ss_conf             7733260136899999999855998528999971410158888878-50777623----------------763365478
Q gi|254780368|r   31 TKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSL-AMGADRGI----------------LIESNETLE   93 (249)
Q Consensus        31 ~~~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~al-AmGaD~ai----------------~i~d~~~~D   93 (249)
                      ...-+-+|-|++...|.-|.++.+---+...-+|-......||+.. -.|.|-.-                ..+-...++
T Consensus       210 A~~Nv~lYrE~g~~aa~~Le~~fg~P~~~~~PiGv~~T~~flrel~~~lg~~~~~~~~~i~~~~~~~s~~~W~srSvD~~  289 (524)
T PRK02910        210 AWFNVVLYREIGESAAEYLEREFGMPYVTTVPIGVGATARFIREVAELLNLDGADLEAFILDELSAPSRLPWFSRSVDST  289 (524)
T ss_pred             CCEEEECCHHHHHHHHHHHHHHHCCCEECCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCCCEEEECCCCH
T ss_conf             40746425877799999999885897010347541799999999999968996422555544201423353012136501


Q ss_pred             HH-----------HHHHHHHHHHHC-CCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEE
Q ss_conf             89-----------999999998612-6864999961135888612899999985796133
Q gi|254780368|r   94 PL-----------SIAKILREIVKK-ENPIIVIAGKQTTDNESNQTGQMLAALMRWPQAT  141 (249)
Q Consensus        94 ~~-----------~~A~~La~~i~~-~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt  141 (249)
                      .+           .-|..++.++++ .|+.++-+|.-+- .....+-..+.++.+=+.+|
T Consensus       290 ~ltgKr~fVfGDaTha~a~~kil~~ElG~~vvg~GTY~r-~~Ar~~r~~~~~~~~e~lIt  348 (524)
T PRK02910        290 YLTGKRVFVFGDATHAVAAAKILRDELGFEVVGAGTYLR-EDARWVRAAAKGYGDEALIT  348 (524)
T ss_pred             HHCCCEEEEECCCHHHHHHHHHHHHHHCEEEEEECCCHH-HHHHHHHHHHHHHCCCCEEC
T ss_conf             213644799656079999999988864807873135518-77899999998606450640


No 92 
>pfam01983 CofC Guanylyl transferase CofC like. Coenzyme F420 is a hydride carrier cofactor that functions during methanogenesis. This family of proteins represents CofC, a nucleotidyl transferase that is involved in coenzyme F420 biosynthesis. CofC has been shown to catalyse the formation of lactyl-2-diphospho-5'-guanosine from 2-phospho-L-lactate and GTP.
Probab=46.50  E-value=22  Score=16.19  Aligned_cols=152  Identities=17%  Similarity=0.231  Sum_probs=62.1

Q ss_pred             CEEEEEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHH--HHHCCCCCCEEEEEECCCHHHHHHHHHH-H
Q ss_conf             969998603038876059807888163248773326013689999999--9855998528999971410158888878-5
Q gi|254780368|r    1 MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQ--LREKGIATEVIVVSIGSCKVEEVLKNSL-A   77 (249)
Q Consensus         1 M~I~V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~--lke~~~g~~V~~lsvG~~~~~~~Lr~al-A   77 (249)
                      |++++.+|..-..  +-|            +..+++|-.+..|-.++-  .-....+..+.++|-.    +..+..+. .
T Consensus         1 M~vvIPvK~f~~a--KtR------------Ls~~Ls~eeR~~La~~Ml~dVl~al~~~~v~vvs~d----~~v~~~a~~~   62 (217)
T pfam01983         1 MRIIIPVSANNHP--KTR------------LSSILSEEERKELLRLMLLDVIDALKPVDVLVFSED----EVVLPSALDV   62 (217)
T ss_pred             CEEEEECCCCCCC--CHH------------CCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEECC----HHHHHHHHHC
T ss_conf             9799971688754--000------------231079999999999999999998633866999375----8877888861


Q ss_pred             HCCCCCEEEECC-CCCCHHHHHHHHHHHHHCCCCC-EEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEE
Q ss_conf             077762376336-5478899999999986126864-99996113588861289999998579613324433432865999
Q gi|254780368|r   78 MGADRGILIESN-ETLEPLSIAKILREIVKKENPI-IVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIV  155 (249)
Q Consensus        78 mGaD~ai~i~d~-~~~D~~~~A~~La~~i~~~~~D-LIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v  155 (249)
                      .|+.   .+.+. .+.+.     ++..++...+++ ++++-   .|- --..+.-+..+|...          .+..+.+
T Consensus        63 ~g~~---v~~~~~~gLN~-----Av~~a~~~~~~~~v~Iv~---aDL-Pli~~~~l~~ll~~~----------~~~~vvI  120 (217)
T pfam01983        63 LGVE---VVVETESDLNT-----AVNQAFMAPEEAPVIIIP---SDI-PLISKEVLKRFLETE----------GRADVVI  120 (217)
T ss_pred             CCCE---EEECCCCCHHH-----HHHHHHHHCCCCCEEEEE---CCC-CCCCHHHHHHHHHHC----------CCCCEEE
T ss_conf             7954---87348746789-----999999728998689970---766-789989999999837----------7888897


Q ss_pred             EEECCCCEEEEEECCCEEEEEECCCCCCCCCCHH-HHHHHHHCC
Q ss_conf             9835896799996398899984355654546988-899885216
Q gi|254780368|r  156 TREVGHGTMTMETPLPAVITVDLNLNEPRYISLP-NIIKARKKR  198 (249)
Q Consensus       156 ~r~~e~g~e~v~~~lPavisv~~~~n~PR~psl~-~im~A~kk~  198 (249)
                      .=..+||+-.+-++ |..+.+.-+.     -|+. .+-.|++..
T Consensus       121 ~P~r~gGTN~L~~~-p~~~~~~Yg~-----~Sf~~H~~~A~~~g  158 (217)
T pfam01983       121 APGRGGGTNMLLLR-KRGFRVSYHF-----GSFFKHLEEARKRG  158 (217)
T ss_pred             CCCCCCCEEEEEEC-CCCCCCCCCC-----CCHHHHHHHHHHCC
T ss_conf             45678963379876-7775227787-----78999999999879


No 93 
>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed
Probab=46.43  E-value=23  Score=16.19  Aligned_cols=78  Identities=9%  Similarity=0.027  Sum_probs=37.0

Q ss_pred             HHHHHHHHHHHCCCC--CC---EEEEEECCCHHH----HHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHH-HHHCCCC
Q ss_conf             899999999855998--52---899997141015----8888878507776237633654788999999999-8612686
Q gi|254780368|r   41 IALEESLQLREKGIA--TE---VIVVSIGSCKVE----EVLKNSLAMGADRGILIESNETLEPLSIAKILRE-IVKKENP  110 (249)
Q Consensus        41 ~AlE~Al~lke~~~g--~~---V~~lsvG~~~~~----~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~-~i~~~~~  110 (249)
                      -|.++|.+.-++.+-  .+   +++-|..|....    ..+..  .+|+..+-..+-....-.+..+-.+|. +|+...+
T Consensus        66 ma~~Aa~~AL~~Agi~~~dIDliI~aT~tpd~~~P~tA~~Vq~--~LGl~~~~~fDi~~aCsgf~~aL~~A~~~I~sG~~  143 (378)
T PRK06816         66 MAAHAIRDLLDDAGFGLEDVELLACGTSQGDQLMPGHAVMVHG--ELGNPPCEVVSFHGVCAAGMMALKYAYLSVKAGES  143 (378)
T ss_pred             HHHHHHHHHHHHCCCCHHHCCEEEEECCCCCCCCCCHHHHHHH--HHCCCCCCEEEHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             9999999999975999899999999668689878548999999--81899854032110123789999999999974898


Q ss_pred             C--EEEEEECCC
Q ss_conf             4--999961135
Q gi|254780368|r  111 I--IVIAGKQTT  120 (249)
Q Consensus       111 D--LIl~G~~S~  120 (249)
                      .  ||+++...+
T Consensus       144 k~vLVV~aE~~S  155 (378)
T PRK06816        144 SNAVATASELAS  155 (378)
T ss_pred             CEEEEEEECCHH
T ss_conf             879999344011


No 94 
>PRK02039 consensus
Probab=46.19  E-value=23  Score=16.16  Aligned_cols=128  Identities=16%  Similarity=0.239  Sum_probs=76.8

Q ss_pred             EEEEEECCCCCCEEECCCCCEEEECCCCEEC----CCHHHHHHHHHHH---HHHCCCCCCEEEEE--ECCCHHH------
Q ss_conf             9860303887605980788816324877332----6013689999999---98559985289999--7141015------
Q gi|254780368|r    5 VPIKGVINYNTKVRIKNDYSGIETENTKISM----NPFDEIALEESLQ---LREKGIATEVIVVS--IGSCKVE------   69 (249)
Q Consensus         5 V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~i----n~~D~~AlE~Al~---lke~~~g~~V~~ls--vG~~~~~------   69 (249)
                      +.+++-||-+..+++..+-    |..--+++    .|-|++=+|.-+-   +|+. +..+||++.  +|..+.+      
T Consensus        32 ~~~~~F~DGE~~v~i~esv----rg~dV~ivqs~~~p~nd~lmELll~idA~r~a-~A~~It~ViPY~~YaRQDr~~~~g  106 (316)
T PRK02039         32 AMVSRFSDGEIQVEIQENV----RGKDVFVLQSTCAPTNDNLMELMIMVDALKRA-SAGRITAAIPYFGYARQDRRPRSA  106 (316)
T ss_pred             EEEEECCCCCEEEEECCCC----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHC-CCCEEEEEECCCCCCCCCCCCCCC
T ss_conf             1899889998898637876----89988999289998207899999999999873-887489984254533477655688


Q ss_pred             ------HHHHHHH-HHCCCCCEEEECCC----C-----CCHHHHHHHHHHHHHCCCC-CEEEEEECCCCCCCEEHHHHHH
Q ss_conf             ------8888878-50777623763365----4-----7889999999998612686-4999961135888612899999
Q gi|254780368|r   70 ------EVLKNSL-AMGADRGILIESNE----T-----LEPLSIAKILREIVKKENP-IIVIAGKQTTDNESNQTGQMLA  132 (249)
Q Consensus        70 ------~~Lr~al-AmGaD~ai~i~d~~----~-----~D~~~~A~~La~~i~~~~~-DLIl~G~~S~D~~~g~v~~~lA  132 (249)
                            ..+=+.| +.|+|+.+.+.-..    +     .|.+.....+++++++.++ +.++.   |.|.++..-.-.+|
T Consensus       107 r~pisak~vA~ll~~aG~d~vitvDlH~~qi~gfF~iPv~~l~a~~~~~~~~~~~~~~~~vvV---sPD~G~~~ra~~~a  183 (316)
T PRK02039        107 RVAISAKVVANMLEIAGVERIITMDLHADQIQGFFDIPVDNIYATPILLGDLRKQNYSDLLVV---SPDVGGVVRARALA  183 (316)
T ss_pred             CCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHCCCCCCCCEECCHHHHHHHHHHCCCCCEEE---CCCCHHHHHHHHHH
T ss_conf             765309999987623277704885278388830679970002140888899986177873898---46940889999999


Q ss_pred             HHHCCCCE
Q ss_conf             98579613
Q gi|254780368|r  133 ALMRWPQA  140 (249)
Q Consensus       133 ~~Lg~p~v  140 (249)
                      ..||.|+.
T Consensus       184 ~~L~~~~~  191 (316)
T PRK02039        184 KQLNCDLA  191 (316)
T ss_pred             HHHCCCEE
T ss_conf             98299979


No 95 
>pfam00107 ADH_zinc_N Zinc-binding dehydrogenase.
Probab=46.18  E-value=23  Score=16.16  Aligned_cols=61  Identities=28%  Similarity=0.302  Sum_probs=32.4

Q ss_pred             HHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             99999855998528999971410158888878507776237633654788999999999861268649999
Q gi|254780368|r   45 ESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIA  115 (249)
Q Consensus        45 ~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~~~~DLIl~  115 (249)
                      .++|+.-..+..+|+++...    ++-+..+..+|||+.+-..++   |   ....+.+.....++|.|+-
T Consensus         5 ~~iq~ak~~Ga~~Vi~~~~~----~~r~~~a~~lGa~~~i~~~~~---~---~~~~i~~~~~~~g~d~vid   65 (131)
T pfam00107         5 AAVQLAKALGAARVIAVDRS----EEKLELAKELGADHVINYRDE---D---FVERVRELTGGRGVDVVID   65 (131)
T ss_pred             HHHHHHHHCCCCEEEEEECC----HHHHHHHHHCCCCCCCCCCCC---C---HHHHHHHCCCCCCCEEEEE
T ss_conf             99999998499879999698----899999997599732353322---1---2455654049977649886


No 96 
>PRK02812 ribose-phosphate pyrophosphokinase; Provisional
Probab=46.14  E-value=23  Score=16.16  Aligned_cols=132  Identities=17%  Similarity=0.230  Sum_probs=78.4

Q ss_pred             EEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHH---HHHCCCCCCEEEEE--ECCCHH-----------
Q ss_conf             98603038876059807888163248773326013689999999---98559985289999--714101-----------
Q gi|254780368|r    5 VPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQ---LREKGIATEVIVVS--IGSCKV-----------   68 (249)
Q Consensus         5 V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~---lke~~~g~~V~~ls--vG~~~~-----------   68 (249)
                      +.+++-||-+..+++..+-.+=|-=-+...-.|-+++=+|.-+-   +|.. ...+||++-  +|..+.           
T Consensus        48 ~~~~kF~DGE~~v~i~esVrg~dV~iiqs~~~pvnd~lmELll~idA~kra-sA~~It~ViPY~~YaRQDrk~~~re~Is  126 (331)
T PRK02812         48 MIRKRFADGELYVQIQESIRGCDVYLIQPTCAPVNDHLMELLIMVDACRRA-SARQITAVIPYYGYARADRKTAGRESIT  126 (331)
T ss_pred             EEEEECCCCCEEEEECCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHC-CCCEEEEEECCCCCCCCCCCCCCCCCCC
T ss_conf             078988999889865687788769998379998418999999999998775-7872799832554355676668999834


Q ss_pred             HHHHHHHH-HHCCCCCEEEECC----CC-----CCHHHHHHHHHHHHHCCC-CCEEEEEECCCCCCCEEHHHHHHHHH-C
Q ss_conf             58888878-5077762376336----54-----788999999999861268-64999961135888612899999985-7
Q gi|254780368|r   69 EEVLKNSL-AMGADRGILIESN----ET-----LEPLSIAKILREIVKKEN-PIIVIAGKQTTDNESNQTGQMLAALM-R  136 (249)
Q Consensus        69 ~~~Lr~al-AmGaD~ai~i~d~----~~-----~D~~~~A~~La~~i~~~~-~DLIl~G~~S~D~~~g~v~~~lA~~L-g  136 (249)
                      ...+=+.| ++|+|+.+.++-.    ++     .|-+.....++.+++..+ .|+|+.   |.|.+...-.-.+|+.| |
T Consensus       127 aklvA~lL~~aG~d~vitvDlH~~qiqgfF~iPvd~l~a~~~l~~yi~~~~~~~~vVV---sPD~G~~krA~~~A~~L~~  203 (331)
T PRK02812        127 AKLVANLITKAGVDRVLAMDLHSAQIQGYFDIPCDHIYGSPVLIDYLASKNLEDIVVV---SPDVGGVARARAFAKKLND  203 (331)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCHHHHHHCCCCCCCCEECCCHHHHHHHHCCCCCCEEE---CCCCCHHHHHHHHHHHCCC
T ss_conf             9999978873488758873466288863369974314676067999986288871797---4794089999999997279


Q ss_pred             CCCE
Q ss_conf             9613
Q gi|254780368|r  137 WPQA  140 (249)
Q Consensus       137 ~p~v  140 (249)
                      .|+.
T Consensus       204 ~~~a  207 (331)
T PRK02812        204 APLA  207 (331)
T ss_pred             CCEE
T ss_conf             9589


No 97 
>pfam02153 PDH Prephenate dehydrogenase. Members of this family are prephenate dehydrogenases EC:1.3.1.12 involved in tyrosine biosynthesis.
Probab=45.88  E-value=23  Score=16.13  Aligned_cols=150  Identities=13%  Similarity=0.147  Sum_probs=72.9

Q ss_pred             HHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCC-CCCEEE-ECCCCCC-------HHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             99998559985289999714101588888785077-762376-3365478-------89999999998612686499996
Q gi|254780368|r   46 SLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGA-DRGILI-ESNETLE-------PLSIAKILREIVKKENPIIVIAG  116 (249)
Q Consensus        46 Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGa-D~ai~i-~d~~~~D-------~~~~A~~La~~i~~~~~DLIl~G  116 (249)
                      |+.||+++.+.+|+++    ....++++.|+.+|+ |++.-- +.-..+|       +..+..+|.......+.+.+++-
T Consensus         2 Alalk~~~~~~~I~g~----d~~~~~~~~A~~~g~id~~~~~~~~~~~aDlvila~Pv~~~~~~l~~l~~~~~~~~ivtD   77 (258)
T pfam02153         2 ALALRRKGFNVTVIGY----DIDEEAAVAAVELGLGDEATNDIEAAQEADIVVLAVPIEVTLEVLKELAPHLKEGALITD   77 (258)
T ss_pred             HHHHHHCCCCCEEEEE----ECCHHHHHHHHHCCCCCCCCCCHHHHCCCCEEEEECCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             2888616999679998----599999999998699032468677766799999969999999999998865589958995


Q ss_pred             ECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEECCCCEEEEEECCCEEEEEECCCCCCCCCCHHHHHHHHH
Q ss_conf             11358886128999999857961332443343286599998358967999963988999843556545469888998852
Q gi|254780368|r  117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARK  196 (249)
Q Consensus       117 ~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g~e~v~~~lPavisv~~~~n~PR~psl~~im~A~k  196 (249)
                      ..|+-..   +-..+...+. ..+.+|-.==+-|....   -.+.....+=-.-+++++-....+...+..++++.++-.
T Consensus        78 v~SvK~~---i~~~~~~~~~-~~~~fvg~HPMaG~e~s---G~~~a~~~LF~~~~~il~p~~~~~~~~~~~v~~l~~~lG  150 (258)
T pfam02153        78 VGSVKVE---IVKDAEQLLS-DGVGFIPGHPMAGTEKS---GPDAARANLFENAPVILTPTEKTDTEALALVRELLEGIG  150 (258)
T ss_pred             CCCCCHH---HHHHHHHHCC-CCCCEECCCCCCCCCCC---CCHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHHHCC
T ss_conf             3555579---9999998555-67864605886478767---701100125417159961888887999999999999869


Q ss_pred             CCCCEECHHH
Q ss_conf             1661204989
Q gi|254780368|r  197 KRIEKKKATD  206 (249)
Q Consensus       197 k~i~~~~~~d  206 (249)
                      ..+...++.+
T Consensus       151 a~~~~m~~~~  160 (258)
T pfam02153       151 AKVILMDPEE  160 (258)
T ss_pred             CEEEECCHHH
T ss_conf             9699827777


No 98 
>TIGR02397 dnaX_nterm DNA polymerase III, subunits gamma and tau; InterPro: IPR012763    This entry represents the well-conserved first N-terminal domain of DnaX, approx. 365 aa. The full-length product of the dnaX gene in Escherichia coli encodes the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the extreme thermophile Thermus thermophilis.; GO: 0003887 DNA-directed DNA polymerase activity, 0005524 ATP binding, 0006260 DNA replication, 0009360 DNA polymerase III complex.
Probab=45.80  E-value=23  Score=16.12  Aligned_cols=60  Identities=22%  Similarity=0.267  Sum_probs=45.9

Q ss_pred             ECCCHHHHHHHHHHHHC-CCCCEEEECCCCCCHHHHHHHHHHHHH-CCCCCEEEEEECCCCCC
Q ss_conf             71410158888878507-776237633654788999999999861-26864999961135888
Q gi|254780368|r   63 IGSCKVEEVLKNSLAMG-ADRGILIESNETLEPLSIAKILREIVK-KENPIIVIAGKQTTDNE  123 (249)
Q Consensus        63 vG~~~~~~~Lr~alAmG-aD~ai~i~d~~~~D~~~~A~~La~~i~-~~~~DLIl~G~~S~D~~  123 (249)
                      +|..-...+|++|+..| -..||+.+..-|--=-.+||+||+++. . ++|--=||.-.+...
T Consensus        17 ~GQ~~iv~tL~NAi~~~ri~HAYLF~GpRGtGKTS~ARIfAKaLNC~-~~~~~PCn~C~~C~~   78 (363)
T TIGR02397        17 IGQEHIVKTLKNAIKNGRIAHAYLFSGPRGTGKTSIARIFAKALNCQ-GPDGEPCNECESCKE   78 (363)
T ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHHHHHCCC-CCCCCCCCCCCHHHH
T ss_conf             35179999999999718966234502859976355899999986588-787787777502277


No 99 
>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed
Probab=45.69  E-value=23  Score=16.11  Aligned_cols=78  Identities=12%  Similarity=0.175  Sum_probs=34.7

Q ss_pred             HHHHHHHHHHHCCC-C-CC---EEEEEECCCHHH----HHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHH-HHHCC-C
Q ss_conf             89999999985599-8-52---899997141015----8888878507776237633654788999999999-86126-8
Q gi|254780368|r   41 IALEESLQLREKGI-A-TE---VIVVSIGSCKVE----EVLKNSLAMGADRGILIESNETLEPLSIAKILRE-IVKKE-N  109 (249)
Q Consensus        41 ~AlE~Al~lke~~~-g-~~---V~~lsvG~~~~~----~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~-~i~~~-~  109 (249)
                      -|+++|-+.-++.+ . .+   ++..|..|....    ..+...  +|..++.-.+-..+.-.+.+|-.+|. +++.. .
T Consensus        56 ma~~Aa~~aL~~agi~~~dIdllI~~t~t~d~~~P~~A~~v~~~--LGl~~~~~fDi~~aC~g~~~al~~A~~~i~~~~~  133 (327)
T PRK05963         56 LAASAADMALADAGIERSDIALTLLATSTPDHLLPPTAPLLAHW--LGLQNSGAADLAGACTGFLYALVLADGFVRAQGK  133 (327)
T ss_pred             HHHHHHHHHHHHCCCCHHHCCEEEEEEECCCCCCCCHHHHHHHH--HCCCCCEEEEHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99999999999759898998799998607999897099999998--5778611435976689999999999999973486


Q ss_pred             CCEEEEEECCC
Q ss_conf             64999961135
Q gi|254780368|r  110 PIIVIAGKQTT  120 (249)
Q Consensus       110 ~DLIl~G~~S~  120 (249)
                      .-||+++...+
T Consensus       134 ~vLvv~~e~~S  144 (327)
T PRK05963        134 PVLVVAANILS  144 (327)
T ss_pred             EEEEEEEHHHC
T ss_conf             37996410210


No 100
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2.  This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).
Probab=45.15  E-value=19  Score=16.65  Aligned_cols=14  Identities=14%  Similarity=0.230  Sum_probs=8.7

Q ss_pred             CCHHHHHHHHHHHH
Q ss_conf             79999999999861
Q gi|254780368|r  233 YSTTKLIEILKSKH  246 (249)
Q Consensus       233 e~~~eLv~~L~~e~  246 (249)
                      ++++..+++|++|-
T Consensus       318 ~GV~~~l~iL~~El  331 (351)
T cd04737         318 QGVASVLEHLNKEL  331 (351)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999999


No 101
>PRK10848 phosphohistidine phosphatase; Provisional
Probab=45.04  E-value=24  Score=16.05  Aligned_cols=86  Identities=10%  Similarity=0.109  Sum_probs=38.6

Q ss_pred             HHHHHHHHHHCCCCCCEEEEEECC-CHHHHHHHHHH-HHCCCCCEEEECC--CCCCHHHHHHHHHHHHHCCCC-CEEEEE
Q ss_conf             999999998559985289999714-10158888878-5077762376336--547889999999998612686-499996
Q gi|254780368|r   42 ALEESLQLREKGIATEVIVVSIGS-CKVEEVLKNSL-AMGADRGILIESN--ETLEPLSIAKILREIVKKENP-IIVIAG  116 (249)
Q Consensus        42 AlE~Al~lke~~~g~~V~~lsvG~-~~~~~~Lr~al-AmGaD~ai~i~d~--~~~D~~~~A~~La~~i~~~~~-DLIl~G  116 (249)
                      |-..|-.|++.  +..+..+-..| .++.++..-.. +++....+.+.++  .+.|+..++..|....+ .++ .+.+-|
T Consensus        31 a~~~a~~l~~~--~~~~d~vl~Sp~~RA~QTa~i~~~~~~~~~~~~~~~~L~P~~~~~~v~~~l~~l~~-~~~~~vllVG  107 (159)
T PRK10848         31 SRLMANWLKGQ--KVDIERVLVSPFLRAEQTLEVVGDCLNLPASAEVLPELTPCGDVGLVSAYLQALAN-EGVASVLVIS  107 (159)
T ss_pred             HHHHHHHHHHC--CCCCCEEEECCHHHHHHHHHHHHHHCCCCCCCEECCCCCCCCCHHHHHHHHHHHHH-CCCCEEEEEE
T ss_conf             99999999965--99988899774288999999999873998420462566889998999999998742-5776389980


Q ss_pred             ECCCCCCCEEHHHHHHHHHC
Q ss_conf             11358886128999999857
Q gi|254780368|r  117 KQTTDNESNQTGQMLAALMR  136 (249)
Q Consensus       117 ~~S~D~~~g~v~~~lA~~Lg  136 (249)
                      .+=      .++.+++++++
T Consensus       108 H~P------~ls~lv~~L~~  121 (159)
T PRK10848        108 HLP------LVGYLVAELCP  121 (159)
T ss_pred             CCC------CHHHHHHHHHC
T ss_conf             587------69999999808


No 102
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit; InterPro: IPR006537   These sequences are related to the Pseudomonas denitrificans CobS gene product, which is a cobalt chelatase subunit of MW ~37kDa  that functions in cobalamin biosynthesis. Cobalamin (vitamin B12) can be synthesized via several pathways, including an aerobic pathway (found in P. denitrificans) and an anaerobic pathway (found in Salmonella typhimurium). These pathways differ in the point of cobalt insertion during corrin ring formation . There are apparently a number of variations on these two pathways, where the major differences seem to be concerned with the process of ring contraction . Confusion regarding the functions of enzymes found in the aerobic vs. anaerobic pathways has arisen because nonhomologous genes in these different pathways were given the same gene symbols. Thus, cobS in the aerobic pathway (P. denitrificans) is not a homolog of cobS in the anaerobic pathway (S. typhimurium). It should be noted that Escherichia coli synthesizes cobalamin only when it is supplied with the precursor cobinamide, which is a complex intermediate. Additionally, all E. coli cobalamin synthesis genes (cobU, cobS and cobT) were named after their S. typhimurium homologs which function in the anaerobic cobalamin synthesis pathway . The aerobic pathway cobalt chelatase is a heterotrimeric, ATP-dependent enzyme that catalyzes cobalt insertion during cobalamin biosynthesis. The other two subunits are the P. denitrificans CobT (IPR006538 from INTERPRO) and CobN (IPR003672 from INTERPRO CobN/magnesium chelatase) proteins..
Probab=44.74  E-value=22  Score=16.20  Aligned_cols=84  Identities=20%  Similarity=0.371  Sum_probs=49.0

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCE-----EEEEEEEECCCEEEEEEECCC----
Q ss_conf             47889999999998612686499996113588861289999998579613-----324433432865999983589----
Q gi|254780368|r   91 TLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQA-----TFVSNIKIIDNHAIVTREVGH----  161 (249)
Q Consensus        91 ~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~v-----t~v~~i~~~~~~~~v~r~~e~----  161 (249)
                      ..|+..|..++|...-..  -+.+.|-+.+ |-+.++ -++|.+|+||++     +.|+++++-|....+.+....    
T Consensus        48 ~fd~~tt~ai~aGfay~r--rvmv~GyhGt-Gksthi-eq~aarlnWP~vrvnldshvsridlvGkdaiv~kdG~qitef  123 (327)
T TIGR01650        48 LFDKATTKAILAGFAYDR--RVMVSGYHGT-GKSTHI-EQVAARLNWPLVRVNLDSHVSRIDLVGKDAIVLKDGKQITEF  123 (327)
T ss_pred             CCCHHHHHHHHHHCEECC--EEEEEECCCC-CCCHHH-HHHHHHHCCCEEEEECCCCEEEEEEECCCEEEEECCCCHHHH
T ss_conf             125567676553000034--4798511478-852268-878876338658985034213333313626897367401134


Q ss_pred             --CEEEEEECCCEEEEEEC
Q ss_conf             --67999963988999843
Q gi|254780368|r  162 --GTMTMETPLPAVITVDL  178 (249)
Q Consensus       162 --g~e~v~~~lPavisv~~  178 (249)
                        |+--....-|..+.+++
T Consensus       124 r~GilPW~~q~~val~fde  142 (327)
T TIGR01650       124 REGILPWALQRNVALVFDE  142 (327)
T ss_pred             HCCCCCHHHCCCEEEEEEC
T ss_conf             3143430012644688733


No 103
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain. LMO is a FMN-containing enzyme that catalyzes the conversion of L-lactate and oxygen to acetate, carbon dioxide, and water. LMO is a member of the family of alpha-hydroxy acid oxidases.  It is thought to be a homooctamer with two- and four- fold axes in the center of the octamer.
Probab=44.42  E-value=24  Score=16.00  Aligned_cols=14  Identities=7%  Similarity=0.064  Sum_probs=9.1

Q ss_pred             CCHHHHHHHHHHHH
Q ss_conf             79999999999861
Q gi|254780368|r  233 YSTTKLIEILKSKH  246 (249)
Q Consensus       233 e~~~eLv~~L~~e~  246 (249)
                      ++++..+++|++|-
T Consensus       350 ~GV~~~l~iL~~El  363 (383)
T cd03332         350 DGVEHVLRNLLAEL  363 (383)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999999


No 104
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed
Probab=43.76  E-value=25  Score=15.92  Aligned_cols=41  Identities=17%  Similarity=0.300  Sum_probs=22.3

Q ss_pred             EEECCCCEEC---CCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHH
Q ss_conf             6324877332---601368999999998559985289999714101
Q gi|254780368|r   26 IETENTKISM---NPFDEIALEESLQLREKGIATEVIVVSIGSCKV   68 (249)
Q Consensus        26 i~~~~~~~~i---n~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~   68 (249)
                      +...+-|..|   -+||-..+-.+..||+.  |-+.+.+..-|+..
T Consensus       558 liLGsGP~RIGqgiEFDYc~vha~~aLr~~--G~etImiN~NPETV  601 (1068)
T PRK12815        558 LILGSGPIRIGQGIEFDYMCVHAAFALKKE--GYETIMINNNPETV  601 (1068)
T ss_pred             EEECCCCCEECCCCCCHHHHHHHHHHHHHC--CCEEEEECCCCCCC
T ss_conf             995678714224424002589999999968--97489962784312


No 105
>pfam02540 NAD_synthase NAD synthase. NAD synthase (EC:6.3.5.1) is involved in the de novo synthesis of NAD and is induced by stress factors such as heat shock and glucose limitation.
Probab=43.72  E-value=25  Score=15.92  Aligned_cols=31  Identities=16%  Similarity=0.066  Sum_probs=11.1

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             2899997141015888887850777623763
Q gi|254780368|r   57 EVIVVSIGSCKVEEVLKNSLAMGADRGILIE   87 (249)
Q Consensus        57 ~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~   87 (249)
                      -|..+|-|-.++--+.--+-|+|.++.+-+.
T Consensus        21 vViGlSGGIDSav~a~La~~AlG~~~v~~v~   51 (243)
T pfam02540        21 VVLGLSGGIDSAVVAYLAVKALGKENVLALI   51 (243)
T ss_pred             EEEECCCCHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             9997888799999999999955974289996


No 106
>KOG3347 consensus
Probab=43.22  E-value=25  Score=15.87  Aligned_cols=33  Identities=18%  Similarity=0.267  Sum_probs=26.2

Q ss_pred             CCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEE
Q ss_conf             26864999961135888612899999985796133
Q gi|254780368|r  107 KENPIIVIAGKQTTDNESNQTGQMLAALMRWPQAT  141 (249)
Q Consensus       107 ~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt  141 (249)
                      ...|.+++||.-  -.+-..++.++|+++|++++.
T Consensus         5 r~~PNILvtGTP--G~GKstl~~~lae~~~~~~i~   37 (176)
T KOG3347           5 RERPNILVTGTP--GTGKSTLAERLAEKTGLEYIE   37 (176)
T ss_pred             HCCCCEEEECCC--CCCCHHHHHHHHHHHCCCEEE
T ss_conf             137887986799--988025999999973985674


No 107
>PRK10046 dpiA two-component response regulator DpiA; Provisional
Probab=43.21  E-value=25  Score=15.87  Aligned_cols=66  Identities=12%  Similarity=0.103  Sum_probs=45.0

Q ss_pred             ECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             326013689999999985599852899997141015888887850777623763365478899999999986
Q gi|254780368|r   34 SMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIV  105 (249)
Q Consensus        34 ~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i  105 (249)
                      -++-.|.+.+|..-+|++......|+.+|.  ....+..++|+..||+. |++.   ..+.-.....|..+.
T Consensus        57 Di~LPd~~Glell~~lr~~~~~~~VI~iTA--~~d~~~~~~Al~~Ga~D-YLvK---Pf~~erl~~~L~~y~  122 (225)
T PRK10046         57 DNYLPDGRGINLLHELVQAHYPGDVVFTTA--ASDMETVSEAVRCGVFD-YLIK---PIAYERLGQTLTRFR  122 (225)
T ss_pred             ECCCCCCCHHHHHHHHHHHCCCCCEEEEEC--CCCHHHHHHHHHCCCCC-CEEC---CCCHHHHHHHHHHHH
T ss_conf             289899979999999996487998899968--99999999999749983-1028---999999999999999


No 108
>TIGR02470 sucr_synth sucrose synthase; InterPro: IPR012820    This entry represents sucrose synthase an enzyme that despite its name, generally uses rather produces sucrose. Sucrose plus UDP (or ADP) becomes D-fructose plus UDP-glucose (or ADP-glucose), which is then available for cell wall (or starch) biosynthesis. The enzyme is homologous to sucrose phosphate synthase, which catalyses the penultimate step in sucrose synthesis. Sucrose synthase is found, so far, exclusively in plants and cyanobacteria.; GO: 0016157 sucrose synthase activity.
Probab=41.15  E-value=16  Score=17.09  Aligned_cols=145  Identities=17%  Similarity=0.303  Sum_probs=78.0

Q ss_pred             CCEECCCHHHHHHHHHHH--HHHCCCC-----CCEEEEEECCCHHHHH-----HHHHHHHCCCCCEEEE--CC--CC---
Q ss_conf             773326013689999999--9855998-----5289999714101588-----8887850777623763--36--54---
Q gi|254780368|r   31 TKISMNPFDEIALEESLQ--LREKGIA-----TEVIVVSIGSCKVEEV-----LKNSLAMGADRGILIE--SN--ET---   91 (249)
Q Consensus        31 ~~~~in~~D~~AlE~Al~--lke~~~g-----~~V~~lsvG~~~~~~~-----Lr~alAmGaD~ai~i~--d~--~~---   91 (249)
                      |-|+++  =--|||.-+.  +|.++-.     -+|.+||===|+++.+     |-+-  .|++.+-.+.  -+  .|   
T Consensus       285 VVYiLD--QVRaLE~em~~ri~~~GL~vL~~~PkIlIvTRLiPdA~GT~CnqRLEKv--~Gt~~~~ILRVPFr~~nG~~~  360 (790)
T TIGR02470       285 VVYILD--QVRALENEMLERIKLQGLEVLEITPKILIVTRLIPDAEGTTCNQRLEKV--SGTEHAHILRVPFRTENGIIL  360 (790)
T ss_pred             EEEEEH--HHHHHHHHHHHHHHHCCCCEECCCCEEEEEECCCCCCCCCCCCCEEECC--CCCCCCEEEECCCCCCCCCCC
T ss_conf             775104--4699999999999873840115655289985017689886057245201--279853164216643477300


Q ss_pred             ------CC------HHHH--HHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEE---------
Q ss_conf             ------78------8999--999999861268649999611358886128999999857961332443343---------
Q gi|254780368|r   92 ------LE------PLSI--AKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKI---------  148 (249)
Q Consensus        92 ------~D------~~~~--A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~---------  148 (249)
                            .|      +++.  ++-|.+-++ ..|||| -|.-| ||+  .|+.+||.+||--|-+-+..||-         
T Consensus       361 ~~WISRFeiWPYLE~FA~D~~~e~~~el~-g~PDLI-IGNYS-DGN--LVA~LLA~kLgVTQC~IAHALEKtKY~~Sd~y  435 (790)
T TIGR02470       361 RKWISRFEIWPYLETFAEDAEKEILAELQ-GKPDLI-IGNYS-DGN--LVASLLARKLGVTQCTIAHALEKTKYPDSDIY  435 (790)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHC-CCCCEE-EECCC-CHH--HHHHHHHHHCCCCCCCHHHHCCCCCCCCCCCH
T ss_conf             36633012472045668999999999846-899706-73256-358--99999985336222203331334367664540


Q ss_pred             ----CCC-EE----------------EEE---------EECCCCEEEEEE-CCCEEEEEECCCC--CCC
Q ss_conf             ----286-59----------------999---------835896799996-3988999843556--545
Q gi|254780368|r  149 ----IDN-HA----------------IVT---------REVGHGTMTMET-PLPAVITVDLNLN--EPR  184 (249)
Q Consensus       149 ----~~~-~~----------------~v~---------r~~e~g~e~v~~-~lPavisv~~~~n--~PR  184 (249)
                          ++. ++                .++         ++..|=+|.... .+|-+-=|..||+  .|.
T Consensus       436 W~~~e~kYHFS~QFTADLIAMN~aDFIITSTYQEIaGt~~~~GQYESh~aFTMP~LYrVV~GIDvFdPK  504 (790)
T TIGR02470       436 WQELEDKYHFSCQFTADLIAMNAADFIITSTYQEIAGTKDSVGQYESHQAFTMPGLYRVVHGIDVFDPK  504 (790)
T ss_pred             HHHCCCCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCC
T ss_conf             420257656430578999964158965871122014688778842122110588750476103225877


No 109
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase  family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc). The enzyme serves to produce an activated form of ManNAc residues (UDP-ManNAc) for use in the biosynthesis of a variety of cell surface polysaccharides; The mammalian enzyme is bifunctional, catalyzing both the inversion of stereochemistry at C-2 and the hydrolysis of the UDP-sugar linkage to generate free ManNAc. It also catalyzes the phosphorylation of ManNAc to generate ManNAc 6-phosphate, a precursor to salic acids. In mammals, sialic acids are found at the termini of oligosaccharides in a large variety of cell surface glycoconjugates and are key mediators of cell-cell recognition events. Mutations in human members of this family have been associated with Sialuria, a rare disease caused by the disorders of sialic acid metabolism. This family belongs to the GT-B st
Probab=41.09  E-value=27  Score=15.66  Aligned_cols=88  Identities=16%  Similarity=0.165  Sum_probs=48.0

Q ss_pred             HHHHCCCCCCEEEEEECCCHH---HHHHHHHHHHCCCCCEEEE--CCCCC---CHHHHHHHHHHHHHCCCCCEEEEEECC
Q ss_conf             998559985289999714101---5888887850777623763--36547---889999999998612686499996113
Q gi|254780368|r   48 QLREKGIATEVIVVSIGSCKV---EEVLKNSLAMGADRGILIE--SNETL---EPLSIAKILREIVKKENPIIVIAGKQT  119 (249)
Q Consensus        48 ~lke~~~g~~V~~lsvG~~~~---~~~Lr~alAmGaD~ai~i~--d~~~~---D~~~~A~~La~~i~~~~~DLIl~G~~S  119 (249)
                      .|++. .+-++..+.-|.-..   ..+.++-+ ...+..+.+.  .+...   .+......+...+.+..||+|+.   -
T Consensus        21 ~l~~~-~~~~~~li~TGqH~~~~~g~t~~~i~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~kPD~VlV---~   95 (363)
T cd03786          21 ALKKD-PGFELVLVVTGQHYDMEMGVTFFEIL-FIIKPDYDLLLGSDSQSLGAQTAGLLIGLEAVLLEEKPDLVLV---L   95 (363)
T ss_pred             HHHHC-CCCCEEEEEECCCCCHHCCCHHHHHH-CCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEE---E
T ss_conf             99748-99988999938976701088899982-6888877854599997699999999999999999729999999---4


Q ss_pred             CCCCCEEHHHHHHHHHCCCCE
Q ss_conf             588861289999998579613
Q gi|254780368|r  120 TDNESNQTGQMLAALMRWPQA  140 (249)
Q Consensus       120 ~D~~~g~v~~~lA~~Lg~p~v  140 (249)
                      .|..+..-++..|.++++|.+
T Consensus        96 GDr~e~la~Alaa~~~~Ipi~  116 (363)
T cd03786          96 GDTNETLAAALAAFKLGIPVA  116 (363)
T ss_pred             CCCCHHHHHHHHHHHHCCCEE
T ss_conf             888428799999998198189


No 110
>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed
Probab=41.04  E-value=27  Score=15.66  Aligned_cols=81  Identities=11%  Similarity=0.123  Sum_probs=36.3

Q ss_pred             HHHHHHHHHHCCC-C-CC---EEEEEECCCHHHHH--HHHHHHHCCC-CCEEEECCCCCCHHHHHHHHHH-HHHCCC--C
Q ss_conf             9999999985599-8-52---89999714101588--8887850777-6237633654788999999999-861268--6
Q gi|254780368|r   42 ALEESLQLREKGI-A-TE---VIVVSIGSCKVEEV--LKNSLAMGAD-RGILIESNETLEPLSIAKILRE-IVKKEN--P  110 (249)
Q Consensus        42 AlE~Al~lke~~~-g-~~---V~~lsvG~~~~~~~--Lr~alAmGaD-~ai~i~d~~~~D~~~~A~~La~-~i~~~~--~  110 (249)
                      |+++|-+.-++.+ . .+   |+..|..|......  -+=.-.+|.. ++.-.+-..+.-.+..|-.+|. .++...  .
T Consensus        60 a~~Aa~~AL~~agi~p~dIDllI~at~tpd~~~P~tA~~v~~~LGl~~~~~afDi~~aCsGf~~aL~~A~~~i~sg~~~~  139 (339)
T PRK09258         60 ATEAARKALAEAGIDASDIGLLINTSVCRDQLEPATACRVHAELGLSKDCAIFDISNACLGFLNGMLDAANMIELGQIDY  139 (339)
T ss_pred             HHHHHHHHHHHCCCCHHHCCEEEEECCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCCE
T ss_conf             99999999997599989999999905114853781899999984799874786510431679999999999997699988


Q ss_pred             CEEEEEECCCCC
Q ss_conf             499996113588
Q gi|254780368|r  111 IIVIAGKQTTDN  122 (249)
Q Consensus       111 DLIl~G~~S~D~  122 (249)
                      -||+++...++.
T Consensus       140 ~LvV~aE~~s~~  151 (339)
T PRK09258        140 GLVVSGESARDI  151 (339)
T ss_pred             EEEEEECCCCCC
T ss_conf             999975412100


No 111
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=40.91  E-value=27  Score=15.65  Aligned_cols=37  Identities=27%  Similarity=0.451  Sum_probs=27.7

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHH
Q ss_conf             478899999999986126864999961135888612899
Q gi|254780368|r   91 TLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQ  129 (249)
Q Consensus        91 ~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~  129 (249)
                      |.|+..-+++|.++++ ++||+||.|..- |.+|=...-
T Consensus       181 G~dT~sF~~aLraALR-eDPDVIlvGEmR-D~ETi~~AL  217 (353)
T COG2805         181 GRDTLSFANALRAALR-EDPDVILVGEMR-DLETIRLAL  217 (353)
T ss_pred             CCCHHHHHHHHHHHHH-CCCCEEEEECCC-CHHHHHHHH
T ss_conf             5427889999999860-299979982134-699999999


No 112
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center
Probab=40.82  E-value=27  Score=15.64  Aligned_cols=42  Identities=19%  Similarity=0.189  Sum_probs=23.7

Q ss_pred             HHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEE
Q ss_conf             9999986126864999961135888612899999985796133244
Q gi|254780368|r   99 KILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVS  144 (249)
Q Consensus        99 ~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~  144 (249)
                      ..+...+++..||+|-+  +.  +.+|..+..+|..+|+|++.-..
T Consensus        72 ~~l~r~lr~~~pDlIHa--H~--~~~g~~~~~~a~~~~iP~V~T~H  113 (367)
T cd05844          72 PQLRRLLRRHRPDLVHA--HF--GFDGVYALPLARRLGVPLVVTFH  113 (367)
T ss_pred             HHHHHHHHHCCCCEEEE--CC--CCHHHHHHHHHHHHCCCEEEEEE
T ss_conf             89999999769999997--68--60689999999996999999981


No 113
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional
Probab=40.75  E-value=28  Score=15.63  Aligned_cols=50  Identities=30%  Similarity=0.337  Sum_probs=41.0

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             26013689999999985599852899997141015888887850777623763
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIE   87 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~   87 (249)
                      ++-.|.+.||..-+|++.+....|+.+|.  ....+..++|+..||.. |++.
T Consensus        57 i~mPd~~Glell~~lR~~~~~~~VI~ITa--~~d~~~v~~Al~~Ga~D-YLiK  106 (239)
T PRK10430         57 IYMQQENGLDLLPVLHEAGCKSDVIVISS--AADAATIKDSLHYGVVD-YLIK  106 (239)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCEEEEEEE--CCCHHHHHHHHHCCCHH-HEEC
T ss_conf             99999978999999998589981999972--68899999999839503-0489


No 114
>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed
Probab=40.50  E-value=28  Score=15.61  Aligned_cols=77  Identities=13%  Similarity=0.169  Sum_probs=36.1

Q ss_pred             HHHHHHHHHHHCCCC--CC---EEEEEECCCHH----HHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHH-HHCC--
Q ss_conf             899999999855998--52---89999714101----588888785077762376336547889999999998-6126--
Q gi|254780368|r   41 IALEESLQLREKGIA--TE---VIVVSIGSCKV----EEVLKNSLAMGADRGILIESNETLEPLSIAKILREI-VKKE--  108 (249)
Q Consensus        41 ~AlE~Al~lke~~~g--~~---V~~lsvG~~~~----~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~-i~~~--  108 (249)
                      -|+++|.+.-++.+-  .+   ++..|..|...    ...+...  +|+.++.-.+-..+.-.+..|-.+|.. ++..  
T Consensus        55 ma~~Aa~~aL~~ag~~~~dIdlli~~t~t~d~~~P~~a~~v~~~--LGl~~~~~fDi~~~C~g~~~aL~~A~~~i~~g~~  132 (319)
T PRK09352         55 LATEAAKKALEAAGIDPEDIDLIIVATTTPDYLFPSTACLVQAR--LGAKNAPAFDLSAACSGFVYALSTADQFIRSGAY  132 (319)
T ss_pred             HHHHHHHHHHHHCCCCHHHCCEEEEEECCCCCCCCHHHHHHHHH--HCCCCCCEEEHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             99999999999759898899799997417899896699999999--7899973753743456899999999999866987


Q ss_pred             CCCEEEEEECC
Q ss_conf             86499996113
Q gi|254780368|r  109 NPIIVIAGKQT  119 (249)
Q Consensus       109 ~~DLIl~G~~S  119 (249)
                      ..-||+++...
T Consensus       133 ~~~Lvv~~e~~  143 (319)
T PRK09352        133 KNALVIGAEKL  143 (319)
T ss_pred             CEEEEEECHHC
T ss_conf             62699611010


No 115
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed
Probab=40.40  E-value=28  Score=15.59  Aligned_cols=28  Identities=32%  Similarity=0.426  Sum_probs=15.3

Q ss_pred             CHHHHHHHHHHHHHHCCCCCCEEEEEECCC
Q ss_conf             013689999999985599852899997141
Q gi|254780368|r   37 PFDEIALEESLQLREKGIATEVIVVSIGSC   66 (249)
Q Consensus        37 ~~D~~AlE~Al~lke~~~g~~V~~lsvG~~   66 (249)
                      +||-..+-.+..||+.  |-+.+.+.--|+
T Consensus       571 EFDY~~v~a~~alk~~--G~~~imIN~NPE  598 (1063)
T PRK05294        571 EFDYCCVHAALALREA--GYETIMVNCNPE  598 (1063)
T ss_pred             CCHHHHHHHHHHHHHC--CCEEEEECCCCC
T ss_conf             3006799999999965--981589537811


No 116
>PRK10867 signal recognition particle protein; Provisional
Probab=40.37  E-value=28  Score=15.59  Aligned_cols=77  Identities=22%  Similarity=0.215  Sum_probs=34.1

Q ss_pred             HHHHHHHHHHCCCCCCEEEEEECC--CHHHHHHHHHHHHCCCCCE-EEECCCCCCHHHHHHHHHHHHHCCCCCEEEE---
Q ss_conf             999999998559985289999714--1015888887850777623-7633654788999999999861268649999---
Q gi|254780368|r   42 ALEESLQLREKGIATEVIVVSIGS--CKVEEVLKNSLAMGADRGI-LIESNETLEPLSIAKILREIVKKENPIIVIA---  115 (249)
Q Consensus        42 AlE~Al~lke~~~g~~V~~lsvG~--~~~~~~Lr~alAmGaD~ai-~i~d~~~~D~~~~A~~La~~i~~~~~DLIl~---  115 (249)
                      +=-.|..++.+ .+-.|..++...  +.+-+.|+. +|--.+  + .+....+.||..+|+---...+..+||+|+.   
T Consensus       117 ~aKLA~~lk~k-~~k~vllvaaDt~RpaA~eQL~~-la~~~~--v~~~~~~~~~dp~~ia~~a~~~ak~~~~DvvivDTA  192 (453)
T PRK10867        117 VGKLGKFLREK-HKKKVLVVSADVYRPAAIKQLET-LAEQVG--VDFFPSDVGQKPVDIVNAALKEAKLKFYDVLLVDTA  192 (453)
T ss_pred             HHHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHH-HHHHCC--CCEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             99999999973-89837985588770589999999-998519--804367889988999999999999779999999787


Q ss_pred             EECCCCC
Q ss_conf             6113588
Q gi|254780368|r  116 GKQTTDN  122 (249)
Q Consensus       116 G~~S~D~  122 (249)
                      |+...|.
T Consensus       193 GRl~~d~  199 (453)
T PRK10867        193 GRLHVDE  199 (453)
T ss_pred             CCHHCCH
T ss_conf             6012108


No 117
>TIGR01166 cbiO cobalt ABC transporter, ATP-binding protein; InterPro: IPR005876   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This entry represents the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. This superfamily includes two groups, one which catalyses the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drives both the process of uptake and efflux.; GO: 0006824 cobalt ion transport, 0009276 1-2nm peptidoglycan-based cell wall.
Probab=39.62  E-value=29  Score=15.52  Aligned_cols=92  Identities=18%  Similarity=0.313  Sum_probs=60.3

Q ss_pred             CCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHHHHHCC-CCCC-EEEEEECCCHHHHHHHHHHHHCCCCCEEEECC
Q ss_conf             887605980788816324877332601368999999998559-9852-89999714101588888785077762376336
Q gi|254780368|r   12 NYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKG-IATE-VIVVSIGSCKVEEVLKNSLAMGADRGILIESN   89 (249)
Q Consensus        12 D~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~lke~~-~g~~-V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~   89 (249)
                      +...++.|.|-+-++..+-+...        +++||++-+.. ...+ .-.||-|.. ---++=-|+||=+|  |+|-|+
T Consensus        85 ~V~~DVaFGPlNLGL~e~Ev~~R--------V~eAL~~vg~~~~~~rp~h~LS~Gek-kRvAIAGAvAM~Pd--~l~LDE  153 (190)
T TIGR01166        85 DVDQDVAFGPLNLGLSEAEVERR--------VREALTAVGISGLEERPTHLLSGGEK-KRVAIAGAVAMRPD--VLLLDE  153 (190)
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHH--------HHHHHHHCCHHHHHHCCHHHCCCCCH-HHHHHHHHHHHCCC--EEEEEC
T ss_conf             62210033545673371576787--------89999860632244122411558613-57777758861663--466427


Q ss_pred             --CCCCHHHHHHHHHHHHHC---CCCCEEEE
Q ss_conf             --547889999999998612---68649999
Q gi|254780368|r   90 --ETLEPLSIAKILREIVKK---ENPIIVIA  115 (249)
Q Consensus        90 --~~~D~~~~A~~La~~i~~---~~~DLIl~  115 (249)
                        ++.||....++++ .+.+   .|--+|+.
T Consensus       154 PTAGLDp~G~~q~~~-~l~~L~~~G~tvv~S  183 (190)
T TIGR01166       154 PTAGLDPAGAEQLLA-ILRRLRAEGTTVVIS  183 (190)
T ss_pred             CCCCCCHHHHHHHHH-HHHHHHHCCCEEEEE
T ss_conf             888978747999999-988787239989997


No 118
>cd00553 NAD_synthase NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD). The conversion of NaAD to NAD+ occurs via an NAD-adenylate intermediate and requires ATP and Mg2+. The intemediate is subsequently cleaved into NAD+ and AMP. In many prokaryotes, such as E. coli , NAD synthetase consists of a single domain and is strictly ammonia dependent. In contrast, eukaryotes and other prokaryotes have an additional N-terminal amidohydrolase domain that prefer glutamine, Interestingly, NAD+ synthases in these prokaryotes, can also utilize ammonia as an amide source .
Probab=39.20  E-value=29  Score=15.48  Aligned_cols=52  Identities=19%  Similarity=0.038  Sum_probs=23.9

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCC---CCHHHHHHHHHHHH
Q ss_conf             98528999971410158888878507776237633654---78899999999986
Q gi|254780368|r   54 IATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNET---LEPLSIAKILREIV  105 (249)
Q Consensus        54 ~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~---~D~~~~A~~La~~i  105 (249)
                      .-+-|..+|-|-.++--+.--+-|+|.++.+-+..+..   ..+..-|+.+++.+
T Consensus        23 ~~~~viGlSGGIDSav~a~La~~Alg~~~v~~v~mP~~~ss~~s~~~A~~la~~l   77 (248)
T cd00553          23 FKGVVLGLSGGIDSALVAALAVRALGRENVLALFMPSRYSSEETREDAKELAEAL   77 (248)
T ss_pred             CCCEEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHH
T ss_conf             9919995888899999999999972887599988999789875899999999995


No 119
>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed
Probab=38.69  E-value=30  Score=15.43  Aligned_cols=79  Identities=11%  Similarity=0.123  Sum_probs=35.5

Q ss_pred             HHHHHHHHHHHCCC--CCC---EEEEEECCCHHHHH--HHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCC---C
Q ss_conf             89999999985599--852---89999714101588--88878507776237633654788999999999861268---6
Q gi|254780368|r   41 IALEESLQLREKGI--ATE---VIVVSIGSCKVEEV--LKNSLAMGADRGILIESNETLEPLSIAKILREIVKKEN---P  110 (249)
Q Consensus        41 ~AlE~Al~lke~~~--g~~---V~~lsvG~~~~~~~--Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~~~---~  110 (249)
                      -|+++|.++-++.+  ..+   ++..|..|......  .+=+=.+|+.++.-..-..+.-.+..|-.+|...-+.+   .
T Consensus        56 ma~~Aa~~aL~~ag~~~~dIdllI~~t~~~d~~~P~~a~~v~~~LGl~~~~~fdi~~~C~g~~~aL~~A~~~i~~g~~~~  135 (326)
T PRK12879         56 LAIKAAERALARAGLDASDIDLIIVATTTPDYLFPSTASQVQARLGIPNAAAFDINAACSGFLYGLELANGLITSGSYKK  135 (326)
T ss_pred             HHHHHHHHHHHHCCCCHHHCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99999999999759798899699995267898277599999998684995145401220379999999999986687550


Q ss_pred             CEEEEEECC
Q ss_conf             499996113
Q gi|254780368|r  111 IIVIAGKQT  119 (249)
Q Consensus       111 DLIl~G~~S  119 (249)
                      -||+|+...
T Consensus       136 ~Lvv~~e~~  144 (326)
T PRK12879        136 VLVIGAERL  144 (326)
T ss_pred             EEEECHHHC
T ss_conf             365020221


No 120
>PRK08304 stage V sporulation protein AD; Validated
Probab=38.59  E-value=24  Score=15.98  Aligned_cols=74  Identities=14%  Similarity=0.175  Sum_probs=40.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEECC-CCCCHHHHHH------HHHHHHHCC-----CCCEEEEEECCCCCCCEE
Q ss_conf             9999714101588888785077762376336-5478899999------999986126-----864999961135888612
Q gi|254780368|r   59 IVVSIGSCKVEEVLKNSLAMGADRGILIESN-ETLEPLSIAK------ILREIVKKE-----NPIIVIAGKQTTDNESNQ  126 (249)
Q Consensus        59 ~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~-~~~D~~~~A~------~La~~i~~~-----~~DLIl~G~~S~D~~~g~  126 (249)
                      ++-.+||.+.+-.|.+.+    |.  ...|+ -+.++|.-|.      ++..+++|.     +.|++|.|.    --+..
T Consensus        21 ~~svvGpkEgeGPL~~~F----D~--i~~D~~~g~~swEkAE~~m~~~A~~~al~Ka~l~~~dId~~~aGD----LlnQ~   90 (336)
T PRK08304         21 TGTIVGPKEGEGPLGKYF----DK--IYDDDYCGEKSWEKAESKLMSDAIQQALQKANLKESDIDYLLAGD----LLNQT   90 (336)
T ss_pred             EEEEECCCCCCCCCHHHC----CE--EECCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHCEEEEECH----HHHHH
T ss_conf             657866746668774427----73--511544571429999999999999999997499977873897222----45546


Q ss_pred             HH-HHHHHHHCCCCEEE
Q ss_conf             89-99999857961332
Q gi|254780368|r  127 TG-QMLAALMRWPQATF  142 (249)
Q Consensus       127 v~-~~lA~~Lg~p~vt~  142 (249)
                      ++ ...|.-|++|++..
T Consensus        91 i~s~f~ar~l~IPf~Gl  107 (336)
T PRK08304         91 ISANFVARELGIPFLGL  107 (336)
T ss_pred             HHHHHHHHHCCCCEEEH
T ss_conf             77667798659980102


No 121
>TIGR00628 ung uracil-DNA glycosylase; InterPro: IPR002043   Uracil-DNA glycosylase 3.2.2 from EC (UNG)  is a DNA repair enzyme that excises uracil residues from DNA by cleaving the N-glycosylic bond. Uracil in DNA can arise as a result of mis-incorporation of dUMP residues by DNA polymerase or deamination of cytosine. The sequence of uracil-DNA glycosylase is extremely well conserved  in bacteria and eukaryotes as well as in herpes viruses. More distantly related uracil-DNA glycosylases are also found in poxviruses . In eukaryotic cells, UNG activity is found in both the nucleus and the mitochondria. Human UNG1 protein is transported to both the mitochondria and the nucleus . The N-terminal 77 amino acids of UNG1 seem to be required for mitochondrial localisation , but the presence of a mitochondrial transit peptide has not been directly demonstrated. The most N-terminal conserved region contains an aspartic acid residue which has been proposed, based on X-ray structures ,  to act as a general base in the catalytic mechanism. ; GO: 0004844 uracil DNA N-glycosylase activity, 0006284 base-excision repair.
Probab=38.31  E-value=18  Score=16.83  Aligned_cols=31  Identities=23%  Similarity=0.220  Sum_probs=24.8

Q ss_pred             EEEEECCCCCCCCCCHHHHHHHHHCCCCE-ECHH
Q ss_conf             99984355654546988899885216612-0498
Q gi|254780368|r  173 VITVDLNLNEPRYISLPNIIKARKKRIEK-KKAT  205 (249)
Q Consensus       173 visv~~~~n~PR~psl~~im~A~kk~i~~-~~~~  205 (249)
                      -+||..+.--|  |||++|.++=++.++. +..-
T Consensus        76 AFSV~~~~~~P--PSL~NIf~EL~~~~p~~~~~p  107 (225)
T TIGR00628        76 AFSVKRGVPIP--PSLKNIFKELEADYPDFFSPP  107 (225)
T ss_pred             CCCCCCCCCCC--CCHHHHHHHHHHCCHHHCCCC
T ss_conf             32558646778--246789999972102112688


No 122
>PRK12404 stage V sporulation protein AD; Provisional
Probab=38.20  E-value=30  Score=15.38  Aligned_cols=74  Identities=18%  Similarity=0.125  Sum_probs=37.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEECC-CCCCHHHHHH------HHHHHHHCC-----CCCEEEEEECCCCCCCEE
Q ss_conf             9999714101588888785077762376336-5478899999------999986126-----864999961135888612
Q gi|254780368|r   59 IVVSIGSCKVEEVLKNSLAMGADRGILIESN-ETLEPLSIAK------ILREIVKKE-----NPIIVIAGKQTTDNESNQ  126 (249)
Q Consensus        59 ~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~-~~~D~~~~A~------~La~~i~~~-----~~DLIl~G~~S~D~~~g~  126 (249)
                      ++-.+||.+.+-.|.+.+    |  ++..|+ -+-|+|.-|.      ++..+++|.     +.|++|.|.    --+..
T Consensus        19 ~asvvGpkEg~GPL~~~F----D--~i~~D~~~G~~swEkAE~~m~~~A~~~al~Ka~l~~~dId~~~aGD----LlnQ~   88 (334)
T PRK12404         19 TGVVGGPFEAKGKIPEDF----D--TLHEDLWLGQDSYEKAHKKLFEEACSRATEKAKLRKDDIQFVLAGD----LINQI   88 (334)
T ss_pred             EEEEECCCCCCCCCHHHC----C--EEECCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHCEEEEECH----HHHHH
T ss_conf             767877735668875538----7--3403644572439999999999999999987499978864896122----44325


Q ss_pred             HH-HHHHHHHCCCCEEE
Q ss_conf             89-99999857961332
Q gi|254780368|r  127 TG-QMLAALMRWPQATF  142 (249)
Q Consensus       127 v~-~~lA~~Lg~p~vt~  142 (249)
                      ++ ...|.-|++|++..
T Consensus        89 i~ssf~ar~l~iPf~Gl  105 (334)
T PRK12404         89 TPTSFAARTLGTPYLGL  105 (334)
T ss_pred             HHHHHHHHHCCCCEEEH
T ss_conf             78778898649980111


No 123
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase. Members of this protein family, found exclusively in the Actinobacteria, are MshA, the glycosyltransferase of mycothiol biosynthesis. Mycothiol replaces glutathione in these species.
Probab=38.12  E-value=30  Score=15.37  Aligned_cols=96  Identities=17%  Similarity=0.170  Sum_probs=53.6

Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECC-----CCCC----HH----HHHHHHHHHH
Q ss_conf             368999999998559985289999714101588888785077762376336-----5478----89----9999999986
Q gi|254780368|r   39 DEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESN-----ETLE----PL----SIAKILREIV  105 (249)
Q Consensus        39 D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~-----~~~D----~~----~~A~~La~~i  105 (249)
                      ..|..+.|-+|.+.  |-+|+++|.+.........+     ...++.+..-     .+..    +.    .....+....
T Consensus        23 e~~v~~La~~La~r--GheV~V~t~~~~~~~~~~~~-----~~~gv~v~~~~~~p~~~~~~~~l~~~l~~~~~~~l~~~~   95 (405)
T TIGR03449        23 NVYILETATELARR--GIEVDIFTRATRPSQPPVVE-----VAPGVRVRNVVAGPYEGLDKEDLPTQLCAFTGGVLRAEA   95 (405)
T ss_pred             HHHHHHHHHHHHHC--CCEEEEEECCCCCCCCCEEE-----ECCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999978--99699993588877888467-----049849998257862324566769999999999999999


Q ss_pred             HC--CCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEE
Q ss_conf             12--68649999611358886128999999857961332443
Q gi|254780368|r  106 KK--ENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSN  145 (249)
Q Consensus       106 ~~--~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~  145 (249)
                      +.  ..||+|-+-    +.-++.++.+++..+++|.+.-...
T Consensus        96 ~~~~~~~DvIH~h----~~~~~~~~~~~~~~~~iP~V~t~H~  133 (405)
T TIGR03449        96 RHEPGYYDLIHSH----YWLSGQVGWLLRDRWGVPLVHTAHT  133 (405)
T ss_pred             HHCCCCCCEEEEC----CCCHHHHHHHHHHHCCCCEEEEECC
T ss_conf             8568997689988----7107899999998649998998144


No 124
>COG2062 SixA Phosphohistidine phosphatase SixA [Signal transduction mechanisms]
Probab=37.90  E-value=30  Score=15.35  Aligned_cols=83  Identities=11%  Similarity=0.118  Sum_probs=36.7

Q ss_pred             CCCHHHHHHHHH-HHHHHCCCCCCEEEEEECC-CHHHHHHHHHH-HHCCCCCEEEECC-CCCCHHHHHHHHHHHHHCCCC
Q ss_conf             260136899999-9998559985289999714-10158888878-5077762376336-547889999999998612686
Q gi|254780368|r   35 MNPFDEIALEES-LQLREKGIATEVIVVSIGS-CKVEEVLKNSL-AMGADRGILIESN-ETLEPLSIAKILREIVKKENP  110 (249)
Q Consensus        35 in~~D~~AlE~A-l~lke~~~g~~V~~lsvG~-~~~~~~Lr~al-AmGaD~ai~i~d~-~~~D~~~~A~~La~~i~~~~~  110 (249)
                      +++.-....|.. -.|+..  +.++.-+-+.| -++.++.+.-. .+|.+......+. -+.|+..+...|.+... .-.
T Consensus        26 Lt~~G~~ea~~~a~~L~~~--~~~~D~VL~Spa~Ra~QTae~v~~~~~~~~~~~~~~l~p~~d~~~~l~~l~~~~d-~v~  102 (163)
T COG2062          26 LTERGRKEAELVAAWLAGQ--GVEPDLVLVSPAVRARQTAEIVAEHLGEKKVEVFEELLPNGDPGTVLDYLEALGD-GVG  102 (163)
T ss_pred             CCHHHHHHHHHHHHHHHHC--CCCCCEEEECHHHHHHHHHHHHHHHHCCCCCEECCCCCCCCCHHHHHHHHHHHCC-CCC
T ss_conf             8888899999999999866--9998879947058899999999986085653461365889998999999997313-476


Q ss_pred             CEEEEEECCC
Q ss_conf             4999961135
Q gi|254780368|r  111 IIVIAGKQTT  120 (249)
Q Consensus       111 DLIl~G~~S~  120 (249)
                      -+.+.|.+..
T Consensus       103 ~vllVgH~P~  112 (163)
T COG2062         103 SVLLVGHNPL  112 (163)
T ss_pred             EEEEECCCCC
T ss_conf             5999788856


No 125
>pfam06925 MGDG_synth Monogalactosyldiacylglycerol (MGDG) synthase. This family represents a conserved region of approximately 180 residues within plant and bacterial monogalactosyldiacylglycerol (MGDG) synthase (EC:2.4.1.46). In Arabidopsis, there are two types of MGDG synthase which differ in their N-terminal portion: type A and type B.
Probab=37.58  E-value=31  Score=15.32  Aligned_cols=99  Identities=15%  Similarity=0.082  Sum_probs=50.2

Q ss_pred             HHHHHHHHHHHHCCCCCCEEEE---EECCCHHHHHHHHHHHHCCCC------CEEEECCC-CCC------HHHHHHHHHH
Q ss_conf             6899999999855998528999---971410158888878507776------23763365-478------8999999999
Q gi|254780368|r   40 EIALEESLQLREKGIATEVIVV---SIGSCKVEEVLKNSLAMGADR------GILIESNE-TLE------PLSIAKILRE  103 (249)
Q Consensus        40 ~~AlE~Al~lke~~~g~~V~~l---svG~~~~~~~Lr~alAmGaD~------ai~i~d~~-~~D------~~~~A~~La~  103 (249)
                      ..||++|++.+.. .+.+|.++   ....+......++.+-.-...      .+.-.++. ..+      ....++-|.+
T Consensus         5 A~Al~ea~~~~~~-~~~ev~i~D~~~~~~p~~~~~~~~~Y~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~   83 (169)
T pfam06925         5 AEALREAFNNEFG-DEYQVVVHDSLKELNPFLLKFVLRSYLFLVKHSRLYRLLYYGTEPKIPHKSILAKLATFFARELAA   83 (169)
T ss_pred             HHHHHHHHHHHCC-CCCEEEEEEHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             9999999985669-987799986388538448989999999999871999988974377520246999999999999999


Q ss_pred             HHHCCCCCEEEEEECCCCCCCEEHHHHH-----HHH--H-CCCCEEEEEEEE
Q ss_conf             8612686499996113588861289999-----998--5-796133244334
Q gi|254780368|r  104 IVKKENPIIVIAGKQTTDNESNQTGQML-----AAL--M-RWPQATFVSNIK  147 (249)
Q Consensus       104 ~i~~~~~DLIl~G~~S~D~~~g~v~~~l-----A~~--L-g~p~vt~v~~i~  147 (249)
                      .+++..||+|+|        |--.|..+     -..  + ..|.+|.++++.
T Consensus        84 ~i~~~~PD~IV~--------Thp~~~~~~l~~lk~~~~~~~~p~~tViTD~~  127 (169)
T pfam06925        84 LLKEFQPDIIIS--------THPLPAAVPLSVLKSKGLLKRVLVVTVVTDFR  127 (169)
T ss_pred             HHHHHCCCEEEE--------CCHHHHHHHHHHHHHCCCCCCCCEEEEECCCC
T ss_conf             999849399999--------97626678999999838788997899989886


No 126
>PRK13856 two-component response regulator VirG; Provisional
Probab=37.48  E-value=31  Score=15.31  Aligned_cols=49  Identities=22%  Similarity=0.247  Sum_probs=30.2

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEE
Q ss_conf             2601368999999998559985289999714101588888785077762376
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILI   86 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i   86 (249)
                      +|..|.+.++..-+++++. ...+..+|....+..+.+ .++..|||. |+.
T Consensus        53 i~lp~~~Gl~~~~~ir~~~-~~piiilt~~~~~~~d~i-~~l~~GADD-Yl~  101 (241)
T PRK13856         53 LNLGREDGLEIVRSLATKS-DVPIIIISGDRLEEADKV-VALELGATD-FIA  101 (241)
T ss_pred             CCCCCCCCHHHHHHHCCCC-CCCEEEEECCCCCHHHHH-HHHHCCCCE-EEE
T ss_conf             9998766134555640369-973699972678789999-998769988-997


No 127
>PRK03482 phosphoglycerate mutase; Provisional
Probab=37.41  E-value=31  Score=15.30  Aligned_cols=37  Identities=5%  Similarity=0.058  Sum_probs=26.5

Q ss_pred             CEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEECCC
Q ss_conf             61289999998579613324433432865999983589
Q gi|254780368|r  124 SNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGH  161 (249)
Q Consensus       124 ~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~  161 (249)
                      .|.+..+++..||+|.- .-..+.++..++++-...++
T Consensus       151 g~vir~ll~~~Lg~~~~-~~~~~~i~N~Sit~i~y~~~  187 (215)
T PRK03482        151 GIALGCLVSTILGLPAW-AERRLRLRNCSISRVDYQES  187 (215)
T ss_pred             HHHHHHHHHHHHCCCHH-HCCCEEECCCEEEEEEEECC
T ss_conf             69999999999689952-26214633888999998689


No 128
>PRK04527 argininosuccinate synthase; Provisional
Probab=37.37  E-value=31  Score=15.29  Aligned_cols=85  Identities=18%  Similarity=0.164  Sum_probs=53.2

Q ss_pred             HHHHHCCCCCCEEEEEE--CCCH---HHHHHHHHHHHCCCCCEEEECC-------------CC-----------CCHHHH
Q ss_conf             99985599852899997--1410---1588888785077762376336-------------54-----------788999
Q gi|254780368|r   47 LQLREKGIATEVIVVSI--GSCK---VEEVLKNSLAMGADRGILIESN-------------ET-----------LEPLSI   97 (249)
Q Consensus        47 l~lke~~~g~~V~~lsv--G~~~---~~~~Lr~alAmGaD~ai~i~d~-------------~~-----------~D~~~~   97 (249)
                      ..|+|+  |.+|+++++  |..+   .+..-++|++.||.+.+.+...             ++           ++-..+
T Consensus        21 ~wL~e~--g~~Vi~~~ad~G~~~~e~~~~i~~kA~~~GA~~~~v~D~~~ef~~~~v~~~i~ana~Yeg~YpL~tsaRplI   98 (397)
T PRK04527         21 PYLQER--GYAVHTVFADTGGVDAEERDFIEKRAAELGAASHVTVDGGPAIWEGFVKPFVWAGEGYQGQYPLLVSDRYLI   98 (397)
T ss_pred             HHHHHC--CCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHHHHHCHHHCCCCCCCCCHHHHH
T ss_conf             999875--994799999789986151578999999819977999728999999999999860645418555632107999


Q ss_pred             HHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHH
Q ss_conf             99999986126864999961135888612899999985
Q gi|254780368|r   98 AKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALM  135 (249)
Q Consensus        98 A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~L  135 (249)
                      |+.+.+..++.+.|.|--|  ++--++-||=..++-..
T Consensus        99 ak~~ve~A~~~ga~~iaHG--~TGkGNDQvRFe~~~~a  134 (397)
T PRK04527         99 VDAALKRAEELGTRIIAHG--CTGMGNDQVRFDLAVKA  134 (397)
T ss_pred             HHHHHHHHHHCCCEEEECC--CCCCCCCHHHHHHHHHH
T ss_conf             9999999997298384047--66678702567768886


No 129
>pfam07451 SpoVAD Stage V sporulation protein AD (SpoVAD). This family contains the bacterial stage V sporulation protein AD (SpoVAD), which is approximately 340 residues long. This is one of six proteins encoded by the spoVA operon, which is transcribed exclusively in the forespore at about the time of dipicolinic acid (DPA) synthesis in the mother cell. The functions of the proteins encoded by the spoVA operon are unknown, but it has been suggested they are involved in DPA transport during sporulation.
Probab=37.07  E-value=31  Score=15.26  Aligned_cols=74  Identities=16%  Similarity=0.150  Sum_probs=40.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEECC-CCCCHHHHHH------HHHHHHHCC-----CCCEEEEEECCCCCCCEE
Q ss_conf             9999714101588888785077762376336-5478899999------999986126-----864999961135888612
Q gi|254780368|r   59 IVVSIGSCKVEEVLKNSLAMGADRGILIESN-ETLEPLSIAK------ILREIVKKE-----NPIIVIAGKQTTDNESNQ  126 (249)
Q Consensus        59 ~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~-~~~D~~~~A~------~La~~i~~~-----~~DLIl~G~~S~D~~~g~  126 (249)
                      ++-.+||.+.+-.|.+..    |.  +..|+ -+.|+|.-|.      ++..+++|.     +.|++|.|.    --+..
T Consensus        16 ~asvvGpkEg~GPL~~~F----D~--i~~D~~~G~~swEkAE~~m~~~A~~~al~Ka~l~~~dId~~~aGD----LlnQ~   85 (329)
T pfam07451        16 TASVVGPKEGEGPLGDYF----DI--IYEDDLFGEDSWEKAESKMLEEAVKLALKKAGLKKDDIDYLLAGD----LLNQI   85 (329)
T ss_pred             EEEEECCCCCCCCCHHHC----CE--EECCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHCEEEEECH----HHHHH
T ss_conf             767867735678875537----72--402644573439999999999999999987499988864895012----44325


Q ss_pred             HH-HHHHHHHCCCCEEE
Q ss_conf             89-99999857961332
Q gi|254780368|r  127 TG-QMLAALMRWPQATF  142 (249)
Q Consensus       127 v~-~~lA~~Lg~p~vt~  142 (249)
                      ++ ...|.-|++|++..
T Consensus        86 i~ssf~ar~l~iPf~Gl  102 (329)
T pfam07451        86 ISSSFAARTLGIPFLGL  102 (329)
T ss_pred             HHHHHHHHHCCCCEEEH
T ss_conf             77778898639981211


No 130
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
Probab=36.90  E-value=32  Score=15.25  Aligned_cols=38  Identities=18%  Similarity=0.249  Sum_probs=26.5

Q ss_pred             HHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEE
Q ss_conf             99986126864999961135888612899999985796133244
Q gi|254780368|r  101 LREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVS  144 (249)
Q Consensus       101 La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~  144 (249)
                      +...++..++|+|+++.      ...-+..+|+.+|+|+++...
T Consensus        96 ~~~~~~~~~pD~vi~d~------~~~~~~~~A~~~giP~v~~~~  133 (401)
T cd03784          96 LVAAARDWGPDLVVADP------LAFAGAVAAEALGIPAVRLLL  133 (401)
T ss_pred             HHHHHHCCCCCEEEECC------CHHHHHHHHHHHCCCEEEEEC
T ss_conf             99996167998899897------078999999992999899956


No 131
>PRK07832 short chain dehydrogenase; Provisional
Probab=36.67  E-value=32  Score=15.22  Aligned_cols=71  Identities=11%  Similarity=0.124  Sum_probs=38.8

Q ss_pred             HHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCC-CCEEEE
Q ss_conf             99999999855998528999971410158888878507776237633654788999999999861268-649999
Q gi|254780368|r   42 ALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKEN-PIIVIA  115 (249)
Q Consensus        42 AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~~~-~DLIl~  115 (249)
                      ..+.|.+|.++  |..|+.+..-.+..++...+.-+.|.+....+..| -.|.-........+.++.+ .|+++.
T Consensus        13 G~a~A~~la~~--Ga~v~l~~r~~~~l~~~~~~l~~~g~~~~~~~~~D-vsd~~~v~~~~~~~~~~~g~iDiLiN   84 (272)
T PRK07832         13 GRATALRLAAQ--GAELFLTDRDADGLAQTVADARALGGTVPEHRALD-ISDYDAVAAFAADIHAAHPSMDVVMN   84 (272)
T ss_pred             HHHHHHHHHHC--CCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECC-CCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             99999999988--99899998988999999999984589714788566-89999999999999997299888998


No 132
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed
Probab=36.46  E-value=32  Score=15.20  Aligned_cols=52  Identities=19%  Similarity=0.243  Sum_probs=32.1

Q ss_pred             CHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEE
Q ss_conf             88999999999861268649999611358886128999999857961332443
Q gi|254780368|r   93 EPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSN  145 (249)
Q Consensus        93 D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~  145 (249)
                      ++..+.+++....+...+ +|++|......+...--..+|+.||+|.++....
T Consensus       193 ~~~~i~~a~~~L~~A~rP-vIl~G~g~~~~~a~~~l~~lae~l~~Pv~tt~~g  244 (562)
T PRK06048        193 NTQQIKRAAEEIANACRP-VIYAGGGVISSNASAELVELAETLNAPVTTTLMG  244 (562)
T ss_pred             CHHHHHHHHHHHHHCCCC-EEEECCCCCCCHHHHHHHHHHHHHCCCEEECCCC
T ss_conf             999999999999827997-8995776451228999999999859887863345


No 133
>smart00828 PKS_MT Methyltransferase  in polyketide synthase (PKS) enzymes.
Probab=36.46  E-value=32  Score=15.20  Aligned_cols=41  Identities=20%  Similarity=0.132  Sum_probs=32.4

Q ss_pred             HHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEE
Q ss_conf             99998559985289999714101588888785077762376
Q gi|254780368|r   46 SLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILI   86 (249)
Q Consensus        46 Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i   86 (249)
                      +..|.+++...+|+.+.+.+...+-+-+++-+.|.+.-+.+
T Consensus        14 ~~~LA~~~p~~~v~GvDiS~~~ie~Ar~r~~~~gl~~rv~~   54 (224)
T smart00828       14 LIDLAERHPHLQLHGYTISPEQAEVGRERIRALGLQGRIRI   54 (224)
T ss_pred             HHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCCCCEEE
T ss_conf             99999977998899997999999999999997299865147


No 134
>PRK11545 gntK gluconate kinase 1; Provisional
Probab=36.17  E-value=29  Score=15.49  Aligned_cols=28  Identities=14%  Similarity=0.143  Sum_probs=16.0

Q ss_pred             CEEEEEECCCCCCCEEHHHHHHHHHCCCCE
Q ss_conf             499996113588861289999998579613
Q gi|254780368|r  111 IIVIAGKQTTDNESNQTGQMLAALMRWPQA  140 (249)
Q Consensus       111 DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~v  140 (249)
                      =+|++|.-.  .+-..+|..+|+.||||++
T Consensus        10 iiVVMGVsG--sGKSTig~~LA~~l~~~fi   37 (177)
T PRK11545         10 IYVLMGVSG--SGKSAVASAVAHQLHAAFL   37 (177)
T ss_pred             EEEEECCCC--CCHHHHHHHHHHHHCCCEE
T ss_conf             999984798--9999999999998199855


No 135
>TIGR01426 MGT glycosyltransferase, MGT family; InterPro: IPR006326   These sequences belong to the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. ; GO: 0016758 transferase activity transferring hexosyl groups, 0016999 antibiotic metabolic process.
Probab=36.13  E-value=32  Score=15.17  Aligned_cols=101  Identities=15%  Similarity=0.189  Sum_probs=51.7

Q ss_pred             HHHHHCCCCCEEEEEECCCCCCCE-EHHHHHHHHHCCCCEEEEEEEEECCCEEEEEE-----ECCCCEEEEEECCCEEEE
Q ss_conf             998612686499996113588861-28999999857961332443343286599998-----358967999963988999
Q gi|254780368|r  102 REIVKKENPIIVIAGKQTTDNESN-QTGQMLAALMRWPQATFVSNIKIIDNHAIVTR-----EVGHGTMTMETPLPAVIT  175 (249)
Q Consensus       102 a~~i~~~~~DLIl~G~~S~D~~~g-~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r-----~~e~g~e~v~~~lPavis  175 (249)
                      .+.+++-.||||+-     |.-+- -+|..+|..|++|.++.....--.++.-.-.|     -.+.|.|-+..=.|=.+-
T Consensus        92 ~~~~~~d~pDlv~y-----D~a~~l~~G~llA~~l~~P~i~~~p~fA~~~~~~~~~~avqdPtadrGeea~~p~~~~~~~  166 (429)
T TIGR01426        92 EEAYKGDRPDLVVY-----DIATPLWAGRLLARKLDVPVISSFPTFASNEEFEEMQRAVQDPTADRGEEALSPIGEDSLE  166 (429)
T ss_pred             HHHHCCCCCCEEEE-----CHHHHHHHHHHHHHHHCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             99714899878985-----3131568999987650788689865455536514567743476655542015788825651


Q ss_pred             EECCCCCCCC------CCHHHHHHH-----HHCCCCEECHHHHCC
Q ss_conf             8435565454------698889988-----521661204989076
Q gi|254780368|r  176 VDLNLNEPRY------ISLPNIIKA-----RKKRIEKKKATDFAI  209 (249)
Q Consensus       176 v~~~~n~PR~------psl~~im~A-----~kk~i~~~~~~dlg~  209 (249)
                        .....||+      =+|-.-+++     ++.-|+.....+|..
T Consensus       167 --~~~~~~r~seqmelfgL~~y~~~~~~ll~~~~~~~~p~~~l~~  209 (429)
T TIGR01426       167 --EAAIAERFSEQMELFGLAEYVARLSALLEEHGITAPPVEFLAA  209 (429)
T ss_pred             --CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHC
T ss_conf             --3778763357889999999999999999860798634388733


No 136
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated
Probab=36.03  E-value=33  Score=15.16  Aligned_cols=52  Identities=12%  Similarity=0.119  Sum_probs=33.3

Q ss_pred             CHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEE
Q ss_conf             88999999999861268649999611358886128999999857961332443
Q gi|254780368|r   93 EPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSN  145 (249)
Q Consensus        93 D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~  145 (249)
                      ++..+.+++.. +++-.-=+|++|......+...---.+|+.||+|.++....
T Consensus       190 ~~~~i~~~~~~-L~~akrPvi~~G~g~~~~~a~~~l~~lae~l~~Pv~tt~~g  241 (560)
T PRK08527        190 NSRQIKKAAEA-IKEAKKPLFYLGGGAISSNASELIRELVKKTGIPAVETLMA  241 (560)
T ss_pred             CHHHHHHHHHH-HHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCEEECCCC
T ss_conf             99999999999-98568986991776014469999999999859985644456


No 137
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275   Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates , . CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate . The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC).   Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain . CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites . The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain.   Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein . The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP . There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia . CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains .    This entry represents glutamine-dependent CPSase (6.3.5.5 from EC) from prokaryotes and eukaryotes (CPSase II). ; GO: 0004086 carbamoyl-phosphate synthase activity, 0006807 nitrogen compound metabolic process.
Probab=35.99  E-value=33  Score=15.16  Aligned_cols=114  Identities=18%  Similarity=0.140  Sum_probs=67.0

Q ss_pred             CEEEECCCCEECC---CHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEE----------EECCC
Q ss_conf             8163248773326---0136899999999855998528999971410158888878507776237----------63365
Q gi|254780368|r   24 SGIETENTKISMN---PFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGIL----------IESNE   90 (249)
Q Consensus        24 ~~i~~~~~~~~in---~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~----------i~d~~   90 (249)
                      .-+....-++.|.   +||.+++-.++.||+.  |.+.+.+-.-|+.+..===.     +||.|+          |-..+
T Consensus       575 ~~lvlGSGp~RIGqgvEFDYc~Vh~~~aLr~~--Gye~ImiN~NPETVSTDyD~-----sDrLYFEplt~E~Vm~I~e~E  647 (1089)
T TIGR01369       575 KVLVLGSGPNRIGQGVEFDYCCVHAVLALREA--GYETIMINYNPETVSTDYDT-----SDRLYFEPLTFEDVMNIIELE  647 (1089)
T ss_pred             EEEEECCCCEECCCCEEEHHHHHHHHHHHHHC--CCEEEEEECCCCCCCCCHHH-----HHHCCCCCCCCCCCEEHEEEC
T ss_conf             68998784514066312056789999999872--99599997789974366665-----101158763503100110005


Q ss_pred             CCC------HHHHHHHHHHHHHCCC-CCEEEEEECCCCCC-CEEHHHHHHHHHCCCCEEEEE
Q ss_conf             478------8999999999861268-64999961135888-612899999985796133244
Q gi|254780368|r   91 TLE------PLSIAKILREIVKKEN-PIIVIAGKQTTDNE-SNQTGQMLAALMRWPQATFVS  144 (249)
Q Consensus        91 ~~D------~~~~A~~La~~i~~~~-~DLIl~G~~S~D~~-~g~v~~~lA~~Lg~p~vt~v~  144 (249)
                      ..+      .=+|+.-||..+++.| .-++=|--+|+|.- ...-=..+=+.||+||--+-.
T Consensus       648 ~~~GVIVq~GGQtp~nlA~~L~~~GG~~iLGTS~~~ID~AEDR~kFs~~l~~Lgi~QP~~~~  709 (1089)
T TIGR01369       648 KPEGVIVQFGGQTPLNLAKELEEAGGVPILGTSPESIDRAEDREKFSELLDELGIPQPEWKI  709 (1089)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEECCCHHHHHHHCCHHHHHHHHHHCCCCCCCCCE
T ss_conf             86679997487326789999997089317368857875131867999999715879898852


No 138
>cd01968 Nitrogenase_NifE_I Nitrogenase_NifE_I: a subgroup of the NifE subunit of the NifEN complex: NifE forms an alpha2beta2 tetramer with NifN.  NifE and NifN are structurally homologous to nitrogenase MoFe protein alpha and beta subunits respectively.  NifEN participates in the synthesis of the iron-molybdenum cofactor (FeMoco) of the MoFe protein.  NifB-co (an iron and sulfur containing precursor of the FeMoco) from NifB is transferred to the NifEN complex where it is further processed to FeMoco. The NifEN bound precursor of FeMoco has been identified as a molybdenum-free, iron- and sulfur- containing analog of FeMoco. It has been suggested that this NifEN bound precursor also acts as a cofactor precursor in nitrogenase systems which require a cofactor other than FeMoco: i.e. iron-vanadium cofactor (FeVco) or iron only cofactor (FeFeco).
Probab=35.44  E-value=33  Score=15.10  Aligned_cols=28  Identities=14%  Similarity=0.028  Sum_probs=13.5

Q ss_pred             CCEEEEEECCCCCCCEEHHHHHHHHHCCC
Q ss_conf             64999961135888612899999985796
Q gi|254780368|r  110 PIIVIAGKQTTDNESNQTGQMLAALMRWP  138 (249)
Q Consensus       110 ~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p  138 (249)
                      +++-+.|.....+|...+--++ +.+|+.
T Consensus       159 ~~vNiig~~~~~~D~~eik~lL-~~~Gl~  186 (410)
T cd01968         159 YDINLIGEFNVAGELWGVKPLL-EKLGIR  186 (410)
T ss_pred             CEEEEECCCCCCCCHHHHHHHH-HHCCCE
T ss_conf             8189968878876689999999-976984


No 139
>PRK09825 idnK D-gluconate kinase; Provisional
Probab=35.43  E-value=33  Score=15.10  Aligned_cols=27  Identities=19%  Similarity=0.226  Sum_probs=15.7

Q ss_pred             EEEEEECCCCCCCEEHHHHHHHHHCCCCE
Q ss_conf             99996113588861289999998579613
Q gi|254780368|r  112 IVIAGKQTTDNESNQTGQMLAALMRWPQA  140 (249)
Q Consensus       112 LIl~G~~S~D~~~g~v~~~lA~~Lg~p~v  140 (249)
                      +|++|.-.  .+-..+|..||..||||++
T Consensus         6 ~VVmGVsG--sGKSTvg~~LA~~L~~~fi   32 (176)
T PRK09825          6 YILMGVSG--SGKSLIGSKIAALFSAKFI   32 (176)
T ss_pred             EEEEECCC--CCHHHHHHHHHHHHCCCEE
T ss_conf             99982898--9989999999999598776


No 140
>PRK13980 NAD synthetase; Provisional
Probab=35.33  E-value=33  Score=15.09  Aligned_cols=11  Identities=27%  Similarity=0.362  Sum_probs=6.0

Q ss_pred             HHHHHHHCCCC
Q ss_conf             99999857961
Q gi|254780368|r  129 QMLAALMRWPQ  139 (249)
Q Consensus       129 ~~lA~~Lg~p~  139 (249)
                      ..+|..||+|.
T Consensus       169 ~~La~~l~vP~  179 (264)
T PRK13980        169 RELARHLGVPE  179 (264)
T ss_pred             HHHHHHHCCCH
T ss_conf             99999939966


No 141
>PRK10840 transcriptional regulator RcsB; Provisional
Probab=34.79  E-value=34  Score=15.03  Aligned_cols=60  Identities=17%  Similarity=0.313  Sum_probs=40.5

Q ss_pred             HHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             899999999855998528999971410158888878507776237633654788999999999861
Q gi|254780368|r   41 IALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVK  106 (249)
Q Consensus        41 ~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~  106 (249)
                      ..++..-+++..+....|.++|+-  .....++.++..||+ +|+..+.   ++-....+|..+.+
T Consensus        66 dGl~~~~~i~~~~p~~~vivls~~--~~~~~v~~al~~Ga~-Gyl~K~~---~~~~L~~AI~~v~~  125 (216)
T PRK10840         66 DGITLIKYIKRHFPSLSIIVLTMN--NNPAILSAVLDLDIE-GIVLKQG---APTDLPKALAALQK  125 (216)
T ss_pred             CHHHHHHHHHHHCCCCEEEEEECC--CCHHHHHHHHHCCCC-EEEECCC---CHHHHHHHHHHHHC
T ss_conf             899999999985899808998477--878999999858974-8998789---99999999999987


No 142
>TIGR00064 ftsY signal recognition particle-docking protein FtsY; InterPro: IPR004390   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).  This family includes the cell division ABC transporter and the periplasmic substrate-binding protein FtsY. There is a weak division between FtsY and SRP54; both are GTPases. In Escherichia coli, ftsY is an essential gene located in an operon with cell division genes ftsE and ftsX, but its apparent function is as the signal recognition particle docking protein.; GO: 0005525 GTP binding.
Probab=34.41  E-value=35  Score=14.99  Aligned_cols=31  Identities=19%  Similarity=0.230  Sum_probs=13.1

Q ss_pred             EEECCCC-CCHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             7633654-788999999999861268649999
Q gi|254780368|r   85 LIESNET-LEPLSIAKILREIVKKENPIIVIA  115 (249)
Q Consensus        85 ~i~d~~~-~D~~~~A~~La~~i~~~~~DLIl~  115 (249)
                      +|....+ +||-++++===+..+..+||+|||
T Consensus       140 vi~~~~gn~DPAaV~fDAi~~Ak~~niDvvli  171 (284)
T TIGR00064       140 VIKQKEGNADPAAVIFDAIQAAKARNIDVVLI  171 (284)
T ss_pred             EEECCCCCCCCHHHHHHHHHHHHHCCCCEEEE
T ss_conf             54078898871789999899998749978997


No 143
>TIGR01169 rplA_bact ribosomal protein L1; InterPro: IPR005878   Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites , . About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.    Many of ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome , .    Ribosomal protein L1 is the largest protein from the large ribosomal subunit. In Escherichia coli, L1 is known to bind to the 23S rRNA. This model describe s bacterial and chloroplast ribosomal protein L1. Most mitochondrial L1 sequences are sufficiently divergent to be the contained in a different entry (IPR005879 from INTERPRO).; GO: 0003723 RNA binding, 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit.
Probab=34.27  E-value=34  Score=15.04  Aligned_cols=129  Identities=16%  Similarity=0.263  Sum_probs=78.2

Q ss_pred             CCCHHHHHHHHHHHHHHCC----CCCCE-EEEEEC--CCHHHHHHHHHH--HHCCCCCEEEE----CC-------CCCCH
Q ss_conf             2601368999999998559----98528-999971--410158888878--50777623763----36-------54788
Q gi|254780368|r   35 MNPFDEIALEESLQLREKG----IATEV-IVVSIG--SCKVEEVLKNSL--AMGADRGILIE----SN-------ETLEP   94 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~----~g~~V-~~lsvG--~~~~~~~Lr~al--AmGaD~ai~i~----d~-------~~~D~   94 (249)
                      ++.--.|.|+||+.|--+.    .+.+| +++..|  |..++..+|.+.  --|-=+-++|.    ++       +|+|-
T Consensus        13 vd~~K~Y~~~eAi~LlK~~~~aKFDeTVeva~~LG~DprKsDQ~vRG~vvLP~GtGK~~RVaVfa~G~~~~eA~~AGAD~   92 (227)
T TIGR01169        13 VDRNKLYSLDEAIALLKETATAKFDETVEVAIRLGIDPRKSDQQVRGTVVLPHGTGKTVRVAVFAKGEKAKEAKAAGADY   92 (227)
T ss_pred             HCCCCCCCHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCCCCCEEEEEEECCCCCCCCEEEEEECCCHHHHHHHHCCCEE
T ss_conf             10436889889999997326554334178888747588537830511386576778625899971643488898709804


Q ss_pred             HHHHHHHHHHHHCC--CCCEEEEEECCCCCCCEEHHHHHHHHHC----CCCEEEEEEEEECCCEEE-----EEEECCCCE
Q ss_conf             99999999986126--8649999611358886128999999857----961332443343286599-----998358967
Q gi|254780368|r   95 LSIAKILREIVKKE--NPIIVIAGKQTTDNESNQTGQMLAALMR----WPQATFVSNIKIIDNHAI-----VTREVGHGT  163 (249)
Q Consensus        95 ~~~A~~La~~i~~~--~~DLIl~G~~S~D~~~g~v~~~lA~~Lg----~p~vt~v~~i~~~~~~~~-----v~r~~e~g~  163 (249)
                      ..-. =|.+-|++.  +||+|+.   |.|- .++| +.|+..||    +|-        ...|++|     +-.+.=.|.
T Consensus        93 VG~~-DLie~Ik~G~~dFDV~IA---TPDm-M~~V-GkLG~iLGPRGLMPN--------PK~GTVT~dva~Av~~~K~G~  158 (227)
T TIGR01169        93 VGSD-DLIEKIKKGWLDFDVVIA---TPDM-MRKV-GKLGRILGPRGLMPN--------PKTGTVTADVAKAVKEAKKGR  158 (227)
T ss_pred             ECCH-HHHHHHHCCCCCEEEEEC---CHHH-HHHH-HHHHHHCCCCCCCCC--------CCCCCCCHHHHHHHHHHHCCC
T ss_conf             4488-799999558985025882---7577-6887-633100478884753--------596652243799999872795


Q ss_pred             EEEEECCCEEEEEE
Q ss_conf             99996398899984
Q gi|254780368|r  164 MTMETPLPAVITVD  177 (249)
Q Consensus       164 e~v~~~lPavisv~  177 (249)
                      -++++.=--+|.+.
T Consensus       159 vefR~DK~G~iH~~  172 (227)
T TIGR01169       159 VEFRADKAGNIHAP  172 (227)
T ss_pred             EEEEECCCEEEEEE
T ss_conf             04651585158777


No 144
>PRK09836 DNA-binding transcriptional activator CusR; Provisional
Probab=34.21  E-value=35  Score=14.98  Aligned_cols=67  Identities=15%  Similarity=0.201  Sum_probs=40.4

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHC
Q ss_conf             2601368999999998559985289999714101588888785077762376336547889999999998612
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKK  107 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~  107 (249)
                      ++-.|.+.++.+-++|+...+.-|..+|.  ....+..-.+|..|||. |+.   .+.++...-.-+.+.++.
T Consensus        52 i~lP~~~G~~l~~~iR~~~~~~PII~Lta--~~~~~d~i~~l~~GADD-Yl~---KPf~~~EL~aRi~allrr  118 (226)
T PRK09836         52 IMLPDVNGWDIVRMLRSANKGMPILLLTA--LGTIEHRVKGLELGADD-YLV---KPFAFAELLARVRTLLRR  118 (226)
T ss_pred             CCCCCCCCCCHHHHHHHHCCCCEEEEEEC--CCCHHHHHHHHHCCCCE-EEE---CCCCHHHHHHHHHHHHCC
T ss_conf             99999987204356776167960999944--58988999999769968-863---687679999999999662


No 145
>PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed
Probab=34.17  E-value=35  Score=14.97  Aligned_cols=87  Identities=11%  Similarity=0.094  Sum_probs=44.2

Q ss_pred             CEECCCHH---HHHHHHHHHHHHCCCC-----CCEEEEEECCCHHH----HHHHHHHHHCC-CCCEEEECCCCCCHHHHH
Q ss_conf             73326013---6899999999855998-----52899997141015----88888785077-762376336547889999
Q gi|254780368|r   32 KISMNPFD---EIALEESLQLREKGIA-----TEVIVVSIGSCKVE----EVLKNSLAMGA-DRGILIESNETLEPLSIA   98 (249)
Q Consensus        32 ~~~in~~D---~~AlE~Al~lke~~~g-----~~V~~lsvG~~~~~----~~Lr~alAmGa-D~ai~i~d~~~~D~~~~A   98 (249)
                      +++.++-.   .-|+++|.++-++.+-     .-|++.|.-|....    ..+...|  |. .++.-.+-..+...|..|
T Consensus        51 R~~a~~~~~~sdla~~AA~~AL~~a~i~~~dID~II~aT~tpD~~~PstA~~vq~~L--Gl~~~~~AfDI~~aCsGfvya  128 (353)
T PRK12880         51 RYICDENTCVSDLGKHAANTLLQGLNIDKNSLDALIVVTQSPDFFMPSTACYLHQLL--NLSSKTIAFDLGQACAGYLYG  128 (353)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHHHCCCCHHHCCEEEEECCCCCCCCCCHHHHHHHHH--CCCCCCEEEEHHHHHHHHHHH
T ss_conf             778799986999999999999997599988999999973788908884789999980--999885088745443469999


Q ss_pred             HHHHHHHHCCCC--CEEEEEECCC
Q ss_conf             999998612686--4999961135
Q gi|254780368|r   99 KILREIVKKENP--IIVIAGKQTT  120 (249)
Q Consensus        99 ~~La~~i~~~~~--DLIl~G~~S~  120 (249)
                      -.+|...-+.|+  -||+||...+
T Consensus       129 L~~A~~~I~sg~~kvLlV~~e~~S  152 (353)
T PRK12880        129 LFVAHSLIQSGLGKILLICGDTLS  152 (353)
T ss_pred             HHHHHHHHHHCCCCEEEEECHHHC
T ss_conf             999999998198748999226753


No 146
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional
Probab=34.01  E-value=35  Score=14.95  Aligned_cols=106  Identities=17%  Similarity=0.159  Sum_probs=56.3

Q ss_pred             HHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCC--CCCHHHHHHHHHHHHHCCCCCEEEEEECC
Q ss_conf             9999999985599852899997141015888887850777623763365--47889999999998612686499996113
Q gi|254780368|r   42 ALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNE--TLEPLSIAKILREIVKKENPIIVIAGKQT  119 (249)
Q Consensus        42 AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~--~~D~~~~A~~La~~i~~~~~DLIl~G~~S  119 (249)
                      .+..|-.||++  |.+|+++--+.....-.|++-+.-=.|+.+..+||.  +.-.+. ...|...+++..||+|++---.
T Consensus       113 ~~piakalk~~--Gn~v~~I~Gar~k~~vilede~~~~~d~~~itTDDGS~G~kG~V-T~~L~~ll~~~~~D~v~aiGP~  189 (760)
T PRK12778        113 MLPIVQALKAA--GNRVITVLAGRSKELIILEKEMRESSDEVIIMTDDGSYGRKGLV-TEGVEEVIKREKVNKCFAIGPA  189 (760)
T ss_pred             HHHHHHHHHHC--CCEEEEEEECCCHHHEEHHHHHHHHCCEEEEECCCCCCCCCCEE-CHHHHHHHHCCCCCEEEEECCH
T ss_conf             79999999986--99599998426633403599999743869998589999727456-6779999748898789997978


Q ss_pred             CCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEE
Q ss_conf             5888612899999985796133244334328659
Q gi|254780368|r  120 TDNESNQTGQMLAALMRWPQATFVSNIKIIDNHA  153 (249)
Q Consensus       120 ~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~  153 (249)
                      .   .=..-..++.-.|+|.+-.+..+=+++-..
T Consensus       190 ~---MMk~v~~~t~~~~i~t~vsln~iMvDgtGm  220 (760)
T PRK12778        190 I---MMKFVCLLTKKYEIPTIVSLNTIMVDGTGM  220 (760)
T ss_pred             H---HHHHHHHHHCCCCCCEEEEEECEEECCCCC
T ss_conf             9---999999872605897489840868726775


No 147
>PRK10651 transcriptional regulator NarL; Provisional
Probab=33.66  E-value=18  Score=16.89  Aligned_cols=43  Identities=33%  Similarity=0.380  Sum_probs=21.5

Q ss_pred             HHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCC
Q ss_conf             136899999999855998528999971410158888878507776
Q gi|254780368|r   38 FDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADR   82 (249)
Q Consensus        38 ~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~   82 (249)
                      .|...+|..-+|++++....|.++|...  ....+..++..||+-
T Consensus        63 p~~~G~~~~~~l~~~~~~~~iivlt~~~--~~~~~~~al~~Ga~g  105 (216)
T PRK10651         63 PGMNGLETLDKLREKSLSGRIVVFSVSN--HEEDVVTALKRGADG  105 (216)
T ss_pred             CCCCCCCCCCCCCCCCCCCCEEEEECCC--CHHHHHHHHHCCCCE
T ss_conf             9988876423233457887467630554--188999999669878


No 148
>cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. Members of this group are sequence-similar to members of the family of ABC-type hydrophobic amino acid transporters, such as leucine-isoleucine-valine-binding protein (LIVBP); however their ligand specificity has not been determined experimentally.
Probab=33.53  E-value=36  Score=14.91  Aligned_cols=35  Identities=20%  Similarity=0.036  Sum_probs=17.6

Q ss_pred             HHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCC
Q ss_conf             999986126864999961135888612899999985796
Q gi|254780368|r  100 ILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWP  138 (249)
Q Consensus       100 ~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p  138 (249)
                      .|++ ++..++|+|+++-...|  ...+ ..=+..+||-
T Consensus       195 ~l~k-ik~~~pD~V~~~~~~~d--~~~~-~kQ~~~~G~~  229 (357)
T cd06337         195 QINA-FKREGVDIVTGFAIPPD--FATF-WRQAAQAGFK  229 (357)
T ss_pred             HHHH-HHHCCCCEEEECCCCHH--HHHH-HHHHHHCCCC
T ss_conf             9999-98559999998787468--9999-9999975999


No 149
>PRK05564 DNA polymerase III subunit delta'; Validated
Probab=33.46  E-value=36  Score=14.90  Aligned_cols=53  Identities=21%  Similarity=0.248  Sum_probs=41.7

Q ss_pred             ECCCHHHHHHHHHHHHCC-CCCEEEECCCCCCHHHHHHHHHHHHHC-----CCCCEEEE
Q ss_conf             714101588888785077-762376336547889999999998612-----68649999
Q gi|254780368|r   63 IGSCKVEEVLKNSLAMGA-DRGILIESNETLEPLSIAKILREIVKK-----ENPIIVIA  115 (249)
Q Consensus        63 vG~~~~~~~Lr~alAmGa-D~ai~i~d~~~~D~~~~A~~La~~i~~-----~~~DLIl~  115 (249)
                      +|.+.....|++++.-|- ..||+.+.+.|.--..+|+.+|+.+-.     ..+|++.+
T Consensus         7 iGq~~i~~~L~~~i~~~rl~HAyLF~Gp~G~GK~~~A~~~A~~ll~~~~~~~~~D~~~~   65 (313)
T PRK05564          7 IGHENIKNRIDNSIIKGKFSHASLIVGEDGIGKSILAKEIANKILGKSEQREYVDIIEY   65 (313)
T ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCEEEE
T ss_conf             68299999999999879987504327999850999999999998289977889865886


No 150
>PRK01132 consensus
Probab=33.04  E-value=36  Score=14.85  Aligned_cols=140  Identities=11%  Similarity=0.100  Sum_probs=83.3

Q ss_pred             EEEEEECCCCCCEEECCCCCEEEECCCCEE---CCCHHHHHHHHHHH---HHHCCCCCCEEEEE--ECCC----------
Q ss_conf             986030388760598078881632487733---26013689999999---98559985289999--7141----------
Q gi|254780368|r    5 VPIKGVINYNTKVRIKNDYSGIETENTKIS---MNPFDEIALEESLQ---LREKGIATEVIVVS--IGSC----------   66 (249)
Q Consensus         5 V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~---in~~D~~AlE~Al~---lke~~~g~~V~~ls--vG~~----------   66 (249)
                      +.+++-||-+..+++..+-.    ..--++   .++ |.+=+|.-+-   +|+. +..+||++-  +|..          
T Consensus        27 ~~~~~F~DGE~~v~i~~~vr----g~dV~iv~s~~~-n~~lmELll~idAlr~~-~A~rIt~ViPY~~YsRQDr~~~~ge  100 (286)
T PRK01132         27 PTERRFPDGELYVRYDTDLK----GRDVFIIGNTHH-DAELIEMILLLSAAYDY-KPKSVNIIAPYYGYARQHQRYNPGE  100 (286)
T ss_pred             EEEEECCCCCEEEEECCCCC----CCEEEEECCCCC-CHHHHHHHHHHHHHHHC-CCCEEEEEECCCCCCCCCCCCCCCC
T ss_conf             18898899978998378768----987999888999-77699999999999874-8872799824654233232358989


Q ss_pred             -HHHHHHHHHHHHCCCCCEEEECC----C-----CCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHC
Q ss_conf             -01588888785077762376336----5-----4788999999999861268649999611358886128999999857
Q gi|254780368|r   67 -KVEEVLKNSLAMGADRGILIESN----E-----TLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMR  136 (249)
Q Consensus        67 -~~~~~Lr~alAmGaD~ai~i~d~----~-----~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg  136 (249)
                       -+...+-+.|..++|+.+-++-.    .     ..+-+.....|+++++..+.++|+    |.|.++.+-.-.+|+.||
T Consensus       101 ~isak~vA~ll~~~~d~vitvDlH~~~i~~ff~ip~~nl~a~~~l~~~~~~~~~~vVV----sPD~G~~~rA~~~A~~Lg  176 (286)
T PRK01132        101 PISSQIFTEIIESYSDSIATVDIHDEETLSYSKVPFTDLHAYDSIADYYKNVDIDYVV----SPDDGGLERVKSIAKYLG  176 (286)
T ss_pred             CCCHHHHHHHHHHHCCEEEEEECCHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCCEEE----CCCCCHHHHHHHHHHHCC
T ss_conf             6309999999874166699982460565402689745654008999998733856125----798528899999999819


Q ss_pred             CCCEEEEEEEEECCCEEEE
Q ss_conf             9613324433432865999
Q gi|254780368|r  137 WPQATFVSNIKIIDNHAIV  155 (249)
Q Consensus       137 ~p~vt~v~~i~~~~~~~~v  155 (249)
                      +++. ...+-..+++.+.+
T Consensus       177 ~~~~-~~~K~R~~~~~v~~  194 (286)
T PRK01132        177 KKAF-YIEKKRIDDRTVEM  194 (286)
T ss_pred             CCEE-EEEEEECCCCCCEE
T ss_conf             9869-99755569985135


No 151
>cd00861 ProRS_anticodon_short ProRS Prolyl-anticodon binding domain, short version found predominantly in bacteria. ProRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only.
Probab=32.66  E-value=37  Score=14.81  Aligned_cols=68  Identities=10%  Similarity=0.101  Sum_probs=49.1

Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHH--HHHHHCCCCEEEEEEEEECCCEEEEEEECCCCEEEEE
Q ss_conf             8999999999861268649999611358886128999--9998579613324433432865999983589679999
Q gi|254780368|r   94 PLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQM--LAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTME  167 (249)
Q Consensus        94 ~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~--lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g~e~v~  167 (249)
                      ....|.-|...+++.|++.++=      ......|..  =|+++|+|+.--+-.=+++++.+++.+...+-.+.+.
T Consensus        16 ~~~~a~~l~~~L~~~gi~v~~D------dr~~~~G~K~~~ael~GiP~~iiiG~k~~~~~~v~vr~R~~~~~~~v~   85 (94)
T cd00861          16 QQELAEKLYAELQAAGVDVLLD------DRNERPGVKFADADLIGIPYRIVVGKKSAAEGIVEIKVRKTGEKEEIS   85 (94)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEE------CCCCHHHHHHHHHHHCCCCEEEEECCCCHHCCEEEEEECCCCCEEEEC
T ss_conf             9999999999998879899998------799727799999997499879999066211799999997899568971


No 152
>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, catalytic subunit; InterPro: IPR000031   Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE. PurK, N5-carboxyaminoimidazole ribonucleotide (N5_CAIR) synthetase, catalyzes the conversion of 5-aminoimidazole ribonucleotide (AIR), ATP, and bicarbonate to N5-CAIR, ADP, and Pi. PurE converts N5-CAIR to CAIR, the sixth step of de novo purine biosynthesis. In the presence of high concentrations of bicarbonate, PurE is reported able to convert AIR to CAIR directly and without ATP. Some members of this family contain two copies of this domain . The crystal structure of PurE indicates a unique quaternary structure that confirms the octameric nature of the enzyme .; GO: 0004638 phosphoribosylaminoimidazole carboxylase activity, 0006189 'de novo' IMP biosynthetic process, 0009320 phosphoribosylaminoimidazole carboxylase complex.
Probab=32.64  E-value=32  Score=15.18  Aligned_cols=82  Identities=20%  Similarity=0.199  Sum_probs=52.0

Q ss_pred             EEEECCCHHHHHHHHHH----HHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCC-CEEEEEECCCCCCCEEHHHHHHHH
Q ss_conf             99971410158888878----5077762376336547889999999998612686-499996113588861289999998
Q gi|254780368|r   60 VVSIGSCKVEEVLKNSL----AMGADRGILIESNETLEPLSIAKILREIVKKENP-IIVIAGKQTTDNESNQTGQMLAAL  134 (249)
Q Consensus        60 ~lsvG~~~~~~~Lr~al----AmGaD~ai~i~d~~~~D~~~~A~~La~~i~~~~~-DLIl~G~~S~D~~~g~v~~~lA~~  134 (249)
                      ++=||-.+.-++.+++.    .+|.+-=..|... --.|--+-+ +++-.+..|+ .+|+.|.    |.+.|+|+++|.+
T Consensus         2 ~iIMGS~SD~~~m~~a~~~L~~fgi~~e~~V~SA-HRTP~~~~~-ya~~a~~~G~P~ViIAgA----GgaAHLPGmvAa~   75 (159)
T TIGR01162         2 GIIMGSDSDLETMKKAAEILEEFGIPYELRVVSA-HRTPELMFE-YAKEAEERGIPKVIIAGA----GGAAHLPGMVAAL   75 (159)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHCCCCEEEEEECC-CCCHHHHHH-HHHHHHHCCCCEEEEECC----CCCCCCCCCCCCC
T ss_conf             6853672547899999999985599667898606-778088999-999998678997998403----5113340100114


Q ss_pred             HCCCCEEEEEEEE
Q ss_conf             5796133244334
Q gi|254780368|r  135 MRWPQATFVSNIK  147 (249)
Q Consensus       135 Lg~p~vt~v~~i~  147 (249)
                      =.+|-+.-=...+
T Consensus        76 T~~PVIGVPv~~~   88 (159)
T TIGR01162        76 TTLPVIGVPVPSK   88 (159)
T ss_pred             CCCCEEECCCCCC
T ss_conf             7877550347734


No 153
>TIGR01351 adk adenylate kinases; InterPro: IPR006259    Most members of this family are known or believed to be adenylate kinase.   Adenylate kinase (ADK) 2.7.4.3 from EC converts ATP + AMP to ADP + ADP, that is, it uses ATP as a phosphate donor for AMP. Two ADK isozymes have been identified in mammalian cells. These specifically bind AMP and favour binding to ATP over other nucleotide triphosphates (AK1 is cytosolic and AK2 is located in the mitochondria). However, some members accept other nucleotide triphosphates as donors, and may be unable to use ATP, and may fail to complement adenylate kinase mutants. An example of a nucleoside-triphosphate--adenylate kinase (2.7.4.10 from EC) is Q9UIJ7 from SWISSPROT, a GTP:AMP phosphotransferase that has been identified in bovine heart and human cells  and derived from mitrochondrail GTP AMP that is specific for the phosphorylation of AMP, but can only use GTP or ITP as a substrate .This family is designated subfamily rather than equivalog for this reason.   ADK has also been identified in different bacterial species and in yeast . Two further enzymes are known to be related to the ADK family, i.e. yeast uridine monophosphokinase and slime mold UMP-CMP kinase. Within the ADK family there are several conserved regions, including the ATP-binding domains. One of the most conserved areas includes an Arg residue, whose modification inactivates the enzyme, together with an Asp that resides in the catalytic cleft of the enzyme and participates in a salt bridge.  ; GO: 0005524 ATP binding, 0016776 phosphotransferase activity phosphate group as acceptor, 0019201 nucleotide kinase activity, 0006139 nucleobase nucleoside nucleotide and nucleic acid metabolic process.
Probab=32.58  E-value=37  Score=14.81  Aligned_cols=114  Identities=13%  Similarity=0.203  Sum_probs=53.8

Q ss_pred             HHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEEC----CCC---CCHHHHHHHHHHHHHCCC-------C
Q ss_conf             99999855998528999971410158888878507776237633----654---788999999999861268-------6
Q gi|254780368|r   45 ESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIES----NET---LEPLSIAKILREIVKKEN-------P  110 (249)
Q Consensus        45 ~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d----~~~---~D~~~~A~~La~~i~~~~-------~  110 (249)
                      .|-+|+++. |  +.=+     ++-+.||.+++-+-.=+..+..    +.|   .|. -|-.++...+.+..       -
T Consensus        15 Qa~~i~~~~-g--l~HI-----STGDllR~~~~~~T~LG~~~k~y~y~~~G~LVPD~-~v~~lv~~rl~~~~~~~~~~~~   85 (232)
T TIGR01351        15 QAKRIAEKL-G--LPHI-----STGDLLRAAVKAGTPLGKKAKEYNYMDKGELVPDE-IVNQLVKERLQQNPDCVSLKSE   85 (232)
T ss_pred             HHHHHHHHC-C--CCCC-----CCHHHHHHHHHHCCHHHHHHHCCCCCCCCCCCCHH-HHHHHHHHHHHCCCCCEEEEEC
T ss_conf             999999860-8--8502-----02589999987079778987326720037757789-9999999997456000110106


Q ss_pred             -CEEEEEECCCCCCCEEHHH--HHHHHHCCC--CEEEEEEEEECC-CEE----EEEEECCC--CEEEEEECCCEE
Q ss_conf             -4999961135888612899--999985796--133244334328-659----99983589--679999639889
Q gi|254780368|r  111 -IIVIAGKQTTDNESNQTGQ--MLAALMRWP--QATFVSNIKIID-NHA----IVTREVGH--GTMTMETPLPAV  173 (249)
Q Consensus       111 -DLIl~G~~S~D~~~g~v~~--~lA~~Lg~p--~vt~v~~i~~~~-~~~----~v~r~~e~--g~e~v~~~lPav  173 (249)
                       ..||      ||+=.-+.+  .|-++|.-.  .+..|..|++.+ ..+    +-+|-...  .++.+.-.-|=+
T Consensus        86 ~GfIL------DGfPRT~~QAeaL~~~l~~~g~~~d~V~~L~vp~~e~l~~R~~gR~~cp~cG~~Yh~~f~pPk~  154 (232)
T TIGR01351        86 NGFIL------DGFPRTLSQAEALDAMLKELGLPIDAVIELDVPDLEELVERITGRRICPSCGRVYHIKFNPPKV  154 (232)
T ss_pred             CCEEE------CCCCCCHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCEEEECCCCCCC
T ss_conf             86266------3888878999999999986189841788853587999999773273306778556102278867


No 154
>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed
Probab=32.53  E-value=37  Score=14.80  Aligned_cols=79  Identities=11%  Similarity=-0.002  Sum_probs=30.4

Q ss_pred             HHHHHHHHHHHCCC--CCCEEE---EEECCCHHHH--HHHHHHHHCCCCC-EEEEC-CCCCCHHHHHHHHHHH-HHCCC-
Q ss_conf             89999999985599--852899---9971410158--8888785077762-37633-6547889999999998-61268-
Q gi|254780368|r   41 IALEESLQLREKGI--ATEVIV---VSIGSCKVEE--VLKNSLAMGADRG-ILIES-NETLEPLSIAKILREI-VKKEN-  109 (249)
Q Consensus        41 ~AlE~Al~lke~~~--g~~V~~---lsvG~~~~~~--~Lr~alAmGaD~a-i~i~d-~~~~D~~~~A~~La~~-i~~~~-  109 (249)
                      -|+++|.+.-++.+  -.++..   .|.-|.....  +-+=.=.+|+.++ +..-| ..+...+..|-.+|.. ++... 
T Consensus        55 ma~~Aa~~aL~~agi~~~dIdliI~~s~t~d~~~P~~A~~v~~~LGl~~~~~~afDi~~aC~g~~~al~~A~~~i~~g~~  134 (329)
T PRK07204         55 MGAEAAKKAVEDAKLTWDDIDCIICGSGTIQQAIPSTASLIQEQLGLQHSGIPCFDINSTCLSFITALDTISYAIECGRY  134 (329)
T ss_pred             HHHHHHHHHHHHCCCCHHHCCEEEEECCCCCCCCCCHHHHHHHHHCCCCCCCEEEEHHHHCHHHHHHHHHHHHHHHCCCC
T ss_conf             99999999999759898888499992578998898099999999647888835500301144899999999999866986


Q ss_pred             -CCEEEEEECC
Q ss_conf             -6499996113
Q gi|254780368|r  110 -PIIVIAGKQT  119 (249)
Q Consensus       110 -~DLIl~G~~S  119 (249)
                       .-||+++...
T Consensus       135 ~~~Lvv~~e~~  145 (329)
T PRK07204        135 KNVVIISSEIS  145 (329)
T ss_pred             CEEEEEECCCC
T ss_conf             52589603345


No 155
>TIGR01701 Fdhalpha-like oxidoreductase alpha (molybdopterin) subunit; InterPro: IPR010046   This entry represents a well-defined clade of molybdopterin-dependent formate dehydrogenases, bacterial type , , , . It represents the alpha subunit, which contains a molybdopterin cofactor and generally associate with two other subunits which contain iron-sulphur clusters and cytochromes.; GO: 0008863 formate dehydrogenase activity, 0030151 molybdenum ion binding, 0051539 4 iron 4 sulfur cluster binding.
Probab=32.49  E-value=9.6  Score=18.56  Aligned_cols=106  Identities=19%  Similarity=0.213  Sum_probs=74.7

Q ss_pred             HHHHHH-HHHHHHHCCC-CC---EEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEECCCCEEEEEE
Q ss_conf             899999-9999861268-64---999961135888612899999985796133244334328659999835896799996
Q gi|254780368|r   94 PLSIAK-ILREIVKKEN-PI---IVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMET  168 (249)
Q Consensus        94 ~~~~A~-~La~~i~~~~-~D---LIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g~e~v~~  168 (249)
                      +|.-|. .|++.++..+ |+   +=.+|+.++ .++..+-.++|..||=-=+...+++==+..++-.++.+.-|.-++.+
T Consensus       133 SW~~A~~~I~~~l~~~d~P~qv~fYtSGRG~S-NEaay~~qLfaR~~GsNNlpDcS~mCH~pS~vaL~~SiG~G~g~v~l  211 (824)
T TIGR01701       133 SWDDAYDEIAAKLNSLDDPKQVAFYTSGRGTS-NEAAYLYQLFARSLGSNNLPDCSNMCHEPSSVALKKSIGIGKGSVLL  211 (824)
T ss_pred             CHHHHHHHHHHHHCCCCCCHHHHHCCCCCCHH-HHHHHHHHHHHHHHCCCCCHHHHHHCCCCCHHHHHHHCCCCEEEEEE
T ss_conf             77999999999851778700510111446326-89999999999872778713335431686112342202323036773


Q ss_pred             ----CCCEEEEEE--CCCCCCCCCCHHHHHHHHHCCCCEE
Q ss_conf             ----398899984--3556545469888998852166120
Q gi|254780368|r  169 ----PLPAVITVD--LNLNEPRYISLPNIIKARKKRIEKK  202 (249)
Q Consensus       169 ----~lPavisv~--~~~n~PR~psl~~im~A~kk~i~~~  202 (249)
                          ..=|++.+.  .+.|.||.  |+.+.+|++.=.+++
T Consensus       212 ~D~~~~D~~v~iG~n~gtN~PR~--l~~L~~a~~rG~KiI  249 (824)
T TIGR01701       212 EDFEHTDLLVLIGSNAGTNHPRM--LKELIKAKKRGAKII  249 (824)
T ss_pred             EECCCCCEEEEECCCCCCCCCHH--HHHHHHHHHCCCEEE
T ss_conf             00005837999545489888436--889999996398399


No 156
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. 
Probab=32.43  E-value=37  Score=14.79  Aligned_cols=100  Identities=20%  Similarity=0.191  Sum_probs=58.9

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECC--C----CCCHHHHHHHHHHHHHCC
Q ss_conf             2601368999999998559985289999714101588888785077762376336--5----478899999999986126
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESN--E----TLEPLSIAKILREIVKKE  108 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~--~----~~D~~~~A~~La~~i~~~  108 (249)
                      +.....+..+.|-.|.++  |-+|+++|.++........      ..........  .    ....+.....+...+++.
T Consensus        13 ~GG~e~~~~~la~~L~~~--G~~V~vit~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   84 (374)
T cd03801          13 VGGAERHVLELARALAAR--GHEVTVLTPGDGGLPDEEE------VGGIVVVRPPPLLRVRRLLLLLLLALRLRRLLRRE   84 (374)
T ss_pred             CCCHHHHHHHHHHHHHHC--CCEEEEEEECCCCCCHHHH------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             881999999999999977--9989999607988750342------37716995676654200245678999999999855


Q ss_pred             CCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEE
Q ss_conf             86499996113588861289999998579613324433
Q gi|254780368|r  109 NPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNI  146 (249)
Q Consensus       109 ~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i  146 (249)
                      +||+|.+-    +..+...+..++...+.|.+......
T Consensus        85 ~~Dii~~~----~~~~~~~~~~~~~~~~~~~i~~~h~~  118 (374)
T cd03801          85 RFDVVHAH----DWLALLAAALAARLLGIPLVLTVHGL  118 (374)
T ss_pred             CCCEEEEC----CCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             99899978----83178999999986699789996786


No 157
>TIGR02660 nifV_homocitr homocitrate synthase; InterPro: IPR013477    Most NifV-type homocitrate synthases are encoded within operons for nitrogen fixation. They are homologous to enzymes that include 2-isopropylmalate synthase, (R)-citramalate synthase, and homocitrate synthases associated with other processes. The homocitrate made by these enzymes becomes a part of the iron-molybdenum cofactor of nitrogenase.; GO: 0004410 homocitrate synthase activity, 0051188 cofactor biosynthetic process.
Probab=32.42  E-value=37  Score=14.79  Aligned_cols=151  Identities=15%  Similarity=0.195  Sum_probs=95.0

Q ss_pred             HHHHHHHHHHHHCCCCCCEEEEEECCCHHH--------HHHHHHHHHCCCCCEEEECC-CCCCHHHHHHHHHHHHHCCCC
Q ss_conf             689999999985599852899997141015--------88888785077762376336-547889999999998612686
Q gi|254780368|r   40 EIALEESLQLREKGIATEVIVVSIGSCKVE--------EVLKNSLAMGADRGILIESN-ETLEPLSIAKILREIVKKENP  110 (249)
Q Consensus        40 ~~AlE~Al~lke~~~g~~V~~lsvG~~~~~--------~~Lr~alAmGaD~ai~i~d~-~~~D~~~~A~~La~~i~~~~~  110 (249)
                      ..-|+..++...+ .|-  . +|||.+++.        +....|-++||+| +++.|- .-+|||.|-..++..-+...-
T Consensus       113 ~~~~~~~V~~A~~-~Gl--~-VsVG~EDASRAd~~FL~~~~~~A~~aGA~R-fRfADTvG~LDPF~~~~~~~~Lr~~~~l  187 (369)
T TIGR02660       113 LERLARLVSFARD-RGL--E-VSVGGEDASRADPEFLVELAEVAQEAGADR-FRFADTVGILDPFSTYELVRALRQAVDL  187 (369)
T ss_pred             HHHHHHHHHHHHH-CCC--C-EEECCCCCCCCCHHHHHHHHHHHHHCCCCC-CCHHHHCCCCCHHHHHHHHHHHHHCCCC
T ss_conf             9999999999876-442--0-310562554588889999999998706311-0143120225727899999998721799


Q ss_pred             CEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEECCCCEEEEEECCCEEEEEECCCCCCCCCCHHH
Q ss_conf             49999611358886128999999857961332443343286599998358967999963988999843556545469888
Q gi|254780368|r  111 IIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPN  190 (249)
Q Consensus       111 DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g~e~v~~~lPavisv~~~~n~PR~psl~~  190 (249)
                      .|=|=+.  -|.+...==.+-|-.=|..|++    .++.|   .-+|-.=-..|.+-+-|--+..++.++...++|.|..
T Consensus       188 ~lE~HaH--nDlGmATANtLAAv~AGA~~vn----tTV~G---LGERAGNAaLEEV~~AL~~~~G~d~Gid~~~L~~Ls~  258 (369)
T TIGR02660       188 PLEFHAH--NDLGMATANTLAAVRAGATHVN----TTVNG---LGERAGNAALEEVAMALKRLLGRDTGIDTSRLPALSQ  258 (369)
T ss_pred             CEEEEEE--CCHHHHHHHHHHHHHHCCEEEE----EEECC---HHHHHCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHH
T ss_conf             6258504--7634799999998860857763----35433---0110012224899999998579888851055689999


Q ss_pred             HHHH-HHCCCCEECH
Q ss_conf             9988-5216612049
Q gi|254780368|r  191 IIKA-RKKRIEKKKA  204 (249)
Q Consensus       191 im~A-~kk~i~~~~~  204 (249)
                      .-+. .-.+|+.+.+
T Consensus       259 lVa~AsGR~~~~~Ka  273 (369)
T TIGR02660       259 LVARASGRPLPPQKA  273 (369)
T ss_pred             HHHHHHCCCCCCCCC
T ss_conf             999972688888887


No 158
>PRK13946 shikimate kinase; Provisional
Probab=32.17  E-value=38  Score=14.76  Aligned_cols=87  Identities=15%  Similarity=0.159  Sum_probs=44.9

Q ss_pred             HHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEEC-CCEEE--EE-------EECCCC-EEEEEEC
Q ss_conf             9998612686499996113588861289999998579613324433432-86599--99-------835896-7999963
Q gi|254780368|r  101 LREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKII-DNHAI--VT-------REVGHG-TMTMETP  169 (249)
Q Consensus       101 La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~-~~~~~--v~-------r~~e~g-~e~v~~~  169 (249)
                      |...+++.  -++|.|-..+  +=..+|-.||..||||++--=..++-. +.++.  ..       |+.|.- ...+--.
T Consensus        14 ~~~~l~kk--nIvLIG~mGs--GKStvGk~LA~~L~~~fiD~D~~IE~~~g~sI~eIF~~~GE~~FR~~E~~~l~~l~~~   89 (195)
T PRK13946         14 IRAALGKR--TVVLVGLMGA--GKSTVGRRLATMLGLPFLDADTEIERAARMTIPEIFATYGEPEFRDLERRVIARLLKG   89 (195)
T ss_pred             HHHHHCCC--CEEEECCCCC--CHHHHHHHHHHHHCCCEEECHHHHHHHHCCCHHHHHHHHCHHHHHHHHHHHHHHHHCC
T ss_conf             99985899--5899899999--8899999999997979898859999980998999999869799999899999998648


Q ss_pred             CCEEEEEECCCCCCCCCCHHHHHH
Q ss_conf             988999843556545469888998
Q gi|254780368|r  170 LPAVITVDLNLNEPRYISLPNIIK  193 (249)
Q Consensus       170 lPavisv~~~~n~PR~psl~~im~  193 (249)
                      -|+|+|...|...  ++.-...|+
T Consensus        90 ~~~VIstGGG~v~--~~~n~~~L~  111 (195)
T PRK13946         90 GPLVLATGGGAFM--NEETRAAIR  111 (195)
T ss_pred             CCEEEECCCCCCC--CHHHHHHHH
T ss_conf             9879975874236--899999999


No 159
>TIGR00375 TIGR00375 conserved hypothetical protein TIGR00375; InterPro: IPR005287    This family of conserved hypothetical proteins has no known function. .
Probab=32.05  E-value=18  Score=16.75  Aligned_cols=36  Identities=22%  Similarity=0.276  Sum_probs=30.0

Q ss_pred             CC---CEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEE
Q ss_conf             86---49999611358886128999999857961332443343
Q gi|254780368|r  109 NP---IIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKI  148 (249)
Q Consensus       109 ~~---DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~  148 (249)
                      .|   |.|=.|- |.|+|   ++.+++++-++|++||-..=+.
T Consensus       158 ~PsmiDfvELGL-SaDTD---MAd~i~eL~d~PFLtNSDAHS~  196 (384)
T TIGR00375       158 KPSMIDFVELGL-SADTD---MADKIAELADLPFLTNSDAHSL  196 (384)
T ss_pred             CCCEEHHHHHCC-CCCCC---HHHCCHHHCCCCCCCCCCCCCC
T ss_conf             974230402046-77702---3440233267887546511167


No 160
>TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882    N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2.7.7.23 from EC) is a trimeric bifunctional enzyme that catalyzes the last two sequential reactions in the de novo biosynthetic pathway for UDP-GlcNAc.    The X-ray crystal structure of Escherichia coli GlmU in complex with UDP-GlcNAc and CoA has been determined to 2.1 A resolution and reveals a two-domain architecture that is responsible for these two reactions . The C-terminal domain is responsible for the CoA-dependent acetylation of Glc-1-PO(4) to GlcNAc-1-PO(4) and displays the longest left-handed parallel beta-helix observed to date. The acetyltransferase active site defined by the binding site for CoA makes use of residues from all three subunits and is positioned beneath an open cavity large enough to accommodate the Glc-1-PO(4) acetyl acceptor. The N-terminal domain catalyzes uridyl transfer from UTP to GlcNAc-1-PO(4) to form the final products UDP-GlcNAc and pyrophosphate. This domain is composed of a central seven-stranded beta-sheet surrounded by six alpha-helices in a Rossmann fold-like topology. ; GO: 0003977 UDP-N-acetylglucosamine diphosphorylase activity, 0009103 lipopolysaccharide biosynthetic process.
Probab=31.85  E-value=38  Score=14.73  Aligned_cols=118  Identities=16%  Similarity=0.175  Sum_probs=61.8

Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHH-HHHHHHHHHHCCC--CC---E
Q ss_conf             3689999999985599852899997141015888887850777623763365478899-9999999861268--64---9
Q gi|254780368|r   39 DEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLS-IAKILREIVKKEN--PI---I  112 (249)
Q Consensus        39 D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~-~A~~La~~i~~~~--~D---L  112 (249)
                      =+|.|+.|..|..+.   -+++++-|.++    +|++|+-=.|..+. |- ....++. |++++.++.....  ++   |
T Consensus        31 l~hVi~~A~~L~~~~---i~vV~GH~~~~----V~~~l~~~~d~t~~-~v-~Q~~qlGGTGHAv~~a~~~l~~~~~~~vL  101 (461)
T TIGR01173        31 LEHVIDAARKLSPEK---IHVVLGHGAEQ----VRKALAEENDKTVN-WV-LQAEQLGGTGHAVLQALPFLSEDDDGRVL  101 (461)
T ss_pred             HHHHHHHHHCCCCCC---EEEEECCCHHH----HHHHHHCCCCCEEE-EE-EECCCCCCHHHHHHHHCCCCCCCCCCEEE
T ss_conf             899999985378341---59998168699----99985037996799-99-96889787289998711678886686089


Q ss_pred             EEEEECC-CCCCCEEHHHHHHHHHCCC--CEEEEEEEEECC--CEEEEEEECCCCEE-EEE
Q ss_conf             9996113-5888612899999985796--133244334328--65999983589679-999
Q gi|254780368|r  113 VIAGKQT-TDNESNQTGQMLAALMRWP--QATFVSNIKIID--NHAIVTREVGHGTM-TME  167 (249)
Q Consensus       113 Il~G~~S-~D~~~g~v~~~lA~~Lg~p--~vt~v~~i~~~~--~~~~v~r~~e~g~e-~v~  167 (249)
                      ||||.-= ++.+|=++ .++++.-.+-  .+| +--.++++  |--++-|+-+|..+ -||
T Consensus       102 vLyGDvPLi~~eTL~m-~Ll~~~~~~~~~~~t-lLt~~l~DP~GYGRI~r~~~g~V~~IVE  160 (461)
T TIGR01173       102 VLYGDVPLISAETLEM-RLLESHRQLNGAKVT-LLTAKLEDPTGYGRIIRENDGAVQAIVE  160 (461)
T ss_pred             EEECCCCCCCHHHHHH-HHHHHHHCCCCCCEE-EEEEEECCCCCCCEEEECCCCCEEEEEC
T ss_conf             9958878775677877-988863000104517-9998718889543589848995899973


No 161
>pfam04748 Polysacc_deac_2 Divergent polysaccharide deacetylase. This family is divergently related to pfam01522 (personal obs:Yeats C).
Probab=31.82  E-value=38  Score=14.73  Aligned_cols=150  Identities=15%  Similarity=0.220  Sum_probs=83.9

Q ss_pred             CCCEECCCHHHHHHHHHHHHHHCCCCCCEEE-E-----------------EECCCHHHHHHHHHHHHCCCCCEEEECCC-
Q ss_conf             8773326013689999999985599852899-9-----------------97141015888887850777623763365-
Q gi|254780368|r   30 NTKISMNPFDEIALEESLQLREKGIATEVIV-V-----------------SIGSCKVEEVLKNSLAMGADRGILIESNE-   90 (249)
Q Consensus        30 ~~~~~in~~D~~AlE~Al~lke~~~g~~V~~-l-----------------svG~~~~~~~Lr~alAmGaD~ai~i~d~~-   90 (249)
                      .+.+.+.||..++-+.|.+.+++  |-||.. +                 ++.+.+....|+.+|+.-. .++=+...- 
T Consensus        22 piT~Ai~P~~~~~~~~a~~a~~~--g~EvllhlPMe~~~~~~~gp~~L~~~~~~~~i~~~l~~~l~~~p-~avGvnNhmG   98 (213)
T pfam04748        22 PVTLAILPYAPHAAELAEAARAA--GHEVLLHLPMEPLGYKDPGPGTLTVGMSAEEIEKRLEAALSRVP-YAVGVNNHMG   98 (213)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHC--CCEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCC-CCEEEECCCC
T ss_conf             75899879998669999999987--99499974566346899997758889999999999999998788-8489954667


Q ss_pred             ---CCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEECCCCEEEEE
Q ss_conf             ---47889999999998612686499996113588861289999998579613324433432865999983589679999
Q gi|254780368|r   91 ---TLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTME  167 (249)
Q Consensus        91 ---~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g~e~v~  167 (249)
                         ..|.-.. +.+-..+++.|  |.|.-..++   ...+.+.+|..+|+|+...=.-++-+.+.-.+++.+..-.+.-+
T Consensus        99 S~~t~~~~~m-~~vl~~l~~~g--l~fvDS~Tt---~~S~a~~~A~~~gvp~~~rdvfLD~~~~~~~I~~ql~~~~~~A~  172 (213)
T pfam04748        99 SRFTADRAAM-RWVMEELKKRG--LFFVDSRTS---GRSVAPKLAKELGVPAAKRDVFLDNEQTEAAIRRQLDQAAALAR  172 (213)
T ss_pred             CCCCCCHHHH-HHHHHHHHHCC--CEEEECCCC---CCCHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHH
T ss_conf             5541699999-99999998779--889914777---66589999998399867610314799999999999999999998


Q ss_pred             ECCCEEEEEECCCCCCCCCCHHHHHH
Q ss_conf             63988999843556545469888998
Q gi|254780368|r  168 TPLPAVITVDLNLNEPRYISLPNIIK  193 (249)
Q Consensus       168 ~~lPavisv~~~~n~PR~psl~~im~  193 (249)
                      -..-|+. +.    .|+--++..+.+
T Consensus       173 ~~G~aI~-Ig----h~~p~Tl~~L~~  193 (213)
T pfam04748       173 KEGSAIA-IG----HPHPETIAALKE  193 (213)
T ss_pred             HCCCEEE-EE----CCCHHHHHHHHH
T ss_conf             6395799-97----799899999999


No 162
>PRK09191 two-component response regulator; Provisional
Probab=31.77  E-value=38  Score=14.72  Aligned_cols=86  Identities=21%  Similarity=0.306  Sum_probs=47.2

Q ss_pred             EEEECCCHHHHHHHHHH---HHC-CCCCEEEECCC-------------CCCHHHHHHHHHHH---HHCCCCCEEEEEECC
Q ss_conf             99971410158888878---507-77623763365-------------47889999999998---612686499996113
Q gi|254780368|r   60 VVSIGSCKVEEVLKNSL---AMG-ADRGILIESNE-------------TLEPLSIAKILREI---VKKENPIIVIAGKQT  119 (249)
Q Consensus        60 ~lsvG~~~~~~~Lr~al---AmG-aD~ai~i~d~~-------------~~D~~~~A~~La~~---i~~~~~DLIl~G~~S  119 (249)
                      ++.+.+.++..-+..|.   +-- +-+...|+|+.             |.+...+|..-.++   +++..|||||+--+-
T Consensus       113 Il~v~~~e~~~l~~~A~~ei~~~~~~rILIVEDE~lIAmdLe~~l~~lG~~V~GiA~t~~eAl~la~~~~PDlvL~DI~L  192 (261)
T PRK09191        113 ILGVDPAEVAALLDDASREIARQVATSVLIIEDEPIIAMDLEQLVESLGHRVVGIARTRAEAVALAKKTRPGLILADIQL  192 (261)
T ss_pred             HHCCCHHHHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCCEEEEEEEC
T ss_conf             97899999999999999999737478879985859999999999998799678762789999999742598989995347


Q ss_pred             CCCCCEE-HHHHHHHHHCCCCEEEEEEE
Q ss_conf             5888612-89999998579613324433
Q gi|254780368|r  120 TDNESNQ-TGQMLAALMRWPQATFVSNI  146 (249)
Q Consensus       120 ~D~~~g~-v~~~lA~~Lg~p~vt~v~~i  146 (249)
                      .|+.+|- ....+-+.+++|.+ +++..
T Consensus       193 ~d~~sGIdaa~~I~~~~~iPvI-FiTAy  219 (261)
T PRK09191        193 ADGSSGIDAVNDILKTFDVPVI-FITAF  219 (261)
T ss_pred             CCCCCHHHHHHHHHHHCCCCEE-EECCC
T ss_conf             9998799999999982899989-97778


No 163
>PRK07282 acetolactate synthase catalytic subunit; Reviewed
Probab=31.16  E-value=39  Score=14.66  Aligned_cols=99  Identities=17%  Similarity=0.228  Sum_probs=51.0

Q ss_pred             HHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECC---CCCCHHHHHHHHHHHHHCCCCCEEEEEE
Q ss_conf             8999999998559985289999714101588888785077762376336---5478899999999986126864999961
Q gi|254780368|r   41 IALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESN---ETLEPLSIAKILREIVKKENPIIVIAGK  117 (249)
Q Consensus        41 ~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~---~~~D~~~~A~~La~~i~~~~~DLIl~G~  117 (249)
                      ..++.|+++.-.+.-| -+.|.+ |.+....   -.....+....+...   ...+...+.+++.. +++-.-=+|++|.
T Consensus       146 ~~l~~A~~~a~~~~~G-PV~l~i-P~Dv~~~---~~~~~~~p~~~~~~~~~~~~p~~~~i~~a~~~-L~~AkrPvii~G~  219 (566)
T PRK07282        146 RIITEAVHIATTGRPG-PVVIDL-PKDVSAL---ETDFINDPEVNLPSYQPTLEPNDMQIKKILKQ-LSKAKKPVILAGG  219 (566)
T ss_pred             HHHHHHHHHHHCCCCC-EEEEEC-CHHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH-HHCCCCCEEEECC
T ss_conf             9999999998618983-199980-6547535---04555675556788888889999999999999-8647995899888


Q ss_pred             CCCCCCCEEHHHHHHHHHCCCCEEEEEE
Q ss_conf             1358886128999999857961332443
Q gi|254780368|r  118 QTTDNESNQTGQMLAALMRWPQATFVSN  145 (249)
Q Consensus       118 ~S~D~~~g~v~~~lA~~Lg~p~vt~v~~  145 (249)
                      ...-.+...---.+|+.||+|.++....
T Consensus       220 g~~~~~a~~~l~~lae~l~iPv~tt~~g  247 (566)
T PRK07282        220 GINYAEAAKELVEFAERYQIPVVTSLLG  247 (566)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCEEEECCC
T ss_conf             8372459999999999869989950466


No 164
>PRK00553 ribose-phosphate pyrophosphokinase; Provisional
Probab=30.93  E-value=39  Score=14.63  Aligned_cols=133  Identities=14%  Similarity=0.231  Sum_probs=77.3

Q ss_pred             EEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHH---HHHCCCCCCEEEEE--ECCCHH-----------
Q ss_conf             98603038876059807888163248773326013689999999---98559985289999--714101-----------
Q gi|254780368|r    5 VPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQ---LREKGIATEVIVVS--IGSCKV-----------   68 (249)
Q Consensus         5 V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~---lke~~~g~~V~~ls--vG~~~~-----------   68 (249)
                      +-+++-||-+..+++...-.+=|-==+...-.|-+++=+|.-+-   +|+. ....||++.  +|..+.           
T Consensus        44 ~~~~~F~DGE~~v~i~e~VRg~dV~Iiqs~~~pvnd~lmELll~idA~rra-sA~~It~ViPY~~YaRQDrk~~~repIs  122 (340)
T PRK00553         44 IVIQKFADGETYIRFDESVRNKDVVIFQSTCSPVNDSLMELLIAIDALKRG-SAKSITAILPYYGYARQDRKTAGREPIT  122 (340)
T ss_pred             EEEEECCCCCEEEEECCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHC-CCCCEEEEECCCCCCCCCCCCCCCCCCC
T ss_conf             178987999789852787689988998789999526899999999999870-7882699966666554787678999843


Q ss_pred             HHHHHHHH-HHCCCCCEEEECC----CC-----CCHHHHHHHHHHHHHC-CC-CCEEEEEECCCCCCCEEHHHHHHHHHC
Q ss_conf             58888878-5077762376336----54-----7889999999998612-68-649999611358886128999999857
Q gi|254780368|r   69 EEVLKNSL-AMGADRGILIESN----ET-----LEPLSIAKILREIVKK-EN-PIIVIAGKQTTDNESNQTGQMLAALMR  136 (249)
Q Consensus        69 ~~~Lr~al-AmGaD~ai~i~d~----~~-----~D~~~~A~~La~~i~~-~~-~DLIl~G~~S~D~~~g~v~~~lA~~Lg  136 (249)
                      ...+=+.| ++|+|+.+.++-.    .+     .|.+.....+...+.+ .+ .++|+.   |.|.++..-.-.+|..||
T Consensus       123 ak~vA~lL~~~G~drvitvDlH~~qiqgfF~iPvd~l~a~~~~~~~~~~~~~~~~~vVV---sPD~G~~krA~~~A~~L~  199 (340)
T PRK00553        123 SKLVADLLTKAGVTRVTLTDIHSDQTQGFFDIPVDILRTYHVFLSRVLELLGKKDLVVV---SPDYGGVKRARLIAESLE  199 (340)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCHHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEE---CCCCCHHHHHHHHHHHCC
T ss_conf             99998567635885699843565888521699865210628899999986497664898---899638999999999829


Q ss_pred             CCCEE
Q ss_conf             96133
Q gi|254780368|r  137 WPQAT  141 (249)
Q Consensus       137 ~p~vt  141 (249)
                      .|+..
T Consensus       200 ~~~a~  204 (340)
T PRK00553        200 LPLAI  204 (340)
T ss_pred             CCEEE
T ss_conf             96799


No 165
>PRK13463 phosphatase PhoE; Provisional
Probab=30.87  E-value=39  Score=14.62  Aligned_cols=36  Identities=11%  Similarity=0.059  Sum_probs=20.6

Q ss_pred             CEEHHHHHHHHHCCCCE----------EEEEEEEECCCEEEEEEEC
Q ss_conf             61289999998579613----------3244334328659999835
Q gi|254780368|r  124 SNQTGQMLAALMRWPQA----------TFVSNIKIIDNHAIVTREV  159 (249)
Q Consensus       124 ~g~v~~~lA~~Lg~p~v----------t~v~~i~~~~~~~~v~r~~  159 (249)
                      .|..-.+++.+||+|.-          +.++-++++++..++.+-.
T Consensus       152 g~~ir~ll~~~lg~~~~~~~~~~~~~n~sisvi~~~~g~~~l~~~n  197 (203)
T PRK13463        152 AAAAKLLVGHFAGIEIENVWDDPFMHSASLSIIEFEDGKGEVKQFA  197 (203)
T ss_pred             HHHHHHHHHHHHCCCHHHHHCCCCCCCCEEEEEEEECCEEEEEEEC
T ss_conf             7999999999819897897256887676799999989969999981


No 166
>PRK03731 aroL shikimate kinase II; Reviewed
Probab=30.68  E-value=40  Score=14.61  Aligned_cols=77  Identities=9%  Similarity=0.022  Sum_probs=39.2

Q ss_pred             EEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCC-EE---------EEEEECCCC-EEEEEECCCEEEEEECCC
Q ss_conf             9999611358886128999999857961332443343286-59---------999835896-799996398899984355
Q gi|254780368|r  112 IVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDN-HA---------IVTREVGHG-TMTMETPLPAVITVDLNL  180 (249)
Q Consensus       112 LIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~-~~---------~v~r~~e~g-~e~v~~~lPavisv~~~~  180 (249)
                      ++|.|-..  .+-..+|-.||..||||++-.=..++-..+ ++         ..=|+.|.- .+.+ ..-++|+|+..|.
T Consensus         5 I~LiG~mG--sGKstiGk~LA~~L~~~fiD~D~~Ie~~~g~sI~eif~~~Ge~~FR~~E~~~l~~l-~~~~~VIstGGG~   81 (172)
T PRK03731          5 LFLVGPRG--CGKTTVGMALAQALGYRFVDTDLWLQSTLQMTVAEIVEREGWAGFRARESAALEAV-TAPSTVVATGGGI   81 (172)
T ss_pred             EEEECCCC--CCHHHHHHHHHHHHCCCEEECCHHHHHHHCCCHHHHHHHHCHHHHHHHHHHHHHHH-CCCCEEEEECCCC
T ss_conf             89988999--98899999999985999797869999883989999999839899999999999984-2788289807864


Q ss_pred             CCCCCCCHHHHHH
Q ss_conf             6545469888998
Q gi|254780368|r  181 NEPRYISLPNIIK  193 (249)
Q Consensus       181 n~PR~psl~~im~  193 (249)
                      ..  ++.-...|+
T Consensus        82 v~--~~~n~~~L~   92 (172)
T PRK03731         82 IL--TEENRAFMR   92 (172)
T ss_pred             CC--CHHHHHHHH
T ss_conf             26--899999999


No 167
>PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed
Probab=30.64  E-value=40  Score=14.60  Aligned_cols=77  Identities=13%  Similarity=0.229  Sum_probs=36.5

Q ss_pred             HHHHHHHHHHHHCCCC--CC---EEEEEECCC----HHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHH-HHHHCCC
Q ss_conf             6899999999855998--52---899997141----015888887850777623763365478899999999-9861268
Q gi|254780368|r   40 EIALEESLQLREKGIA--TE---VIVVSIGSC----KVEEVLKNSLAMGADRGILIESNETLEPLSIAKILR-EIVKKEN  109 (249)
Q Consensus        40 ~~AlE~Al~lke~~~g--~~---V~~lsvG~~----~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La-~~i~~~~  109 (249)
                      +-|+++|.+.-|+.+-  .+   +++-|.-|.    ...-.+...  +|+. +.-..-..+...+..+-.+| .+|+...
T Consensus        97 dma~~AA~~AL~~Agi~~~dIDlIIvaT~tpd~~~PstA~~vq~~--LG~~-~~afDi~aaCsGfvyaL~~A~~~I~sg~  173 (372)
T PRK07515         97 EMGVAAARQALERAGKTAADIDGVIVACSNMQRAYPAMAIEIQEA--LGIE-GFAFDMNVACSSATFGIQTAANAIRSGS  173 (372)
T ss_pred             HHHHHHHHHHHHHCCCCHHHCCEEEEECCCCCCCCCCHHHHHHHH--HCCC-CEEHHHHCCCHHHHHHHHHHHHHHHCCC
T ss_conf             999999999999849998999999997688888897299999998--4898-4204361408689999999999997189


Q ss_pred             --CCEEEEEECC
Q ss_conf             --6499996113
Q gi|254780368|r  110 --PIIVIAGKQT  119 (249)
Q Consensus       110 --~DLIl~G~~S  119 (249)
                        .-||+++...
T Consensus       174 ~k~vLVVgaE~~  185 (372)
T PRK07515        174 ARRVLVVNPEIC  185 (372)
T ss_pred             CCEEEEECCHHH
T ss_conf             874799534230


No 168
>TIGR00095 TIGR00095 putative methyltransferase; InterPro: IPR004398 This is a family of conserved hypothetical proteins, which includes a putative methylase..
Probab=30.58  E-value=26  Score=15.79  Aligned_cols=77  Identities=18%  Similarity=0.236  Sum_probs=40.8

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCC--------CCCHHH---------------HHHHHHHHHHCCC-
Q ss_conf             9852899997141015888887850777623763365--------478899---------------9999999861268-
Q gi|254780368|r   54 IATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNE--------TLEPLS---------------IAKILREIVKKEN-  109 (249)
Q Consensus        54 ~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~--------~~D~~~---------------~A~~La~~i~~~~-  109 (249)
                      .|++..=+-.|.-   ..=-+||++||+.+++|+.+.        ++.++.               -.+.+....++.. 
T Consensus        55 ~~~~~LD~FAGsG---~LG~EALSRgA~~~~f~E~d~~~~~~l~~N~~~L~nrlk~~~~~~~~~~~~~~~~~~~~~~~ts  131 (210)
T TIGR00095        55 VGAHFLDLFAGSG---SLGLEALSRGAKSAVFVEQDKKVAQTLKENLSTLKNRLKLSGEQATVLNDAERALLFLAKKQTS  131 (210)
T ss_pred             CCCEEEEEECCCH---HHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHCCCCCEEEEHHHHHHHHHHHHCCCCC
T ss_conf             6872788540644---6537664014162378736867999999999998887158530000000256665776517996


Q ss_pred             -CCEEEEEECCCCCCCEE--HHHHHHHHHC
Q ss_conf             -64999961135888612--8999999857
Q gi|254780368|r  110 -PIIVIAGKQTTDNESNQ--TGQMLAALMR  136 (249)
Q Consensus       110 -~DLIl~G~~S~D~~~g~--v~~~lA~~Lg  136 (249)
                       ||+|+.   -.=+..+.  +-+.+.-...
T Consensus       132 ~~d~iyl---DPPf~~~~ad~~~~l~l~~~  158 (210)
T TIGR00095       132 PFDIIYL---DPPFNTGLADLEAILELLGE  158 (210)
T ss_pred             CEEEEEE---CCCCCCCCCCHHHHHHHHHH
T ss_conf             1147871---48888761037999999999


No 169
>cd00738 HGTP_anticodon HGTP anticodon binding domain, as found at the C-terminus of histidyl, glycyl, threonyl and prolyl tRNA synthetases, which are classified as a group of class II aminoacyl-tRNA synthetases (aaRS). In aaRSs, the anticodon binding domain is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only. This domain is also found in the accessory subunit of mitochondrial polymerase gamma (Pol gamma b).
Probab=30.43  E-value=40  Score=14.58  Aligned_cols=70  Identities=16%  Similarity=0.136  Sum_probs=50.6

Q ss_pred             CHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHH--HHHHHCCCCEEEEEEEEECCCEEEEEEECCCCEEEEEE
Q ss_conf             88999999999861268649999611358886128999--99985796133244334328659999835896799996
Q gi|254780368|r   93 EPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQM--LAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMET  168 (249)
Q Consensus        93 D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~--lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g~e~v~~  168 (249)
                      +....|.-|+..+++.|+...+-      ......|..  =|++.|+|+.--+-.=+++++++++++...+-.+.+.+
T Consensus        15 e~~~~a~~l~~~L~~~gi~v~~D------dr~~~~g~k~~~a~~~giP~~iiiG~~e~e~~~v~vr~r~~~eq~~v~~   86 (94)
T cd00738          15 EAREYAQKLLNALLANGIRVLYD------DRERKIGKKFREADLRGVPFAVVVGEDELENGKVTVKSRDTGESETLHV   86 (94)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEE------CCCCCHHHHHHHHHHCCCCEEEEECCHHHHCCEEEEEECCCCCEEEEEH
T ss_conf             89999999999999889989998------7999975999999974998999988003437989999989997789899


No 170
>cd04121 Rab40 Rab40 subfamily.  This subfamily contains Rab40a, Rab40b, and Rab40c, which are all highly homologous.  In rat, Rab40c is localized to the perinuclear recycling compartment (PRC), and is distributed in a tissue-specific manor, with high expression in brain, heart, kidney, and testis, low expression in lung and liver, and no expression in spleen and skeletal muscle.  Rab40c is highly expressed in differentiated oligodendrocytes but minimally expressed in oligodendrocyte progenitors, suggesting a role in the vesicular transport of myelin components.  Unlike most other Ras-superfamily proteins, Rab40c was shown to have a much lower affinity for GTP, and an affinity for GDP that is lower than for GTP. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide d
Probab=30.35  E-value=40  Score=14.57  Aligned_cols=71  Identities=14%  Similarity=0.019  Sum_probs=45.4

Q ss_pred             HHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCC--CEEEEEECCCCCCCEEH----HHHHHHHHCCCCE
Q ss_conf             88888785077762376336547889999999998612686--49999611358886128----9999998579613
Q gi|254780368|r   70 EVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENP--IIVIAGKQTTDNESNQT----GQMLAALMRWPQA  140 (249)
Q Consensus        70 ~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~~~~--DLIl~G~~S~D~~~g~v----~~~lA~~Lg~p~v  140 (249)
                      ..|+..+-.|||-++++.|-...+++.-..-.-.-+++..+  -.||.|..+--....+|    +-..|..+|++++
T Consensus        69 ~~l~~~y~r~a~~~ilvyDvt~~~Sf~~l~~w~~~i~~~~~~~p~iLVGNK~DL~~~r~V~~ee~~~~A~~~~~~f~  145 (189)
T cd04121          69 CTIFRSYSRGAQGIILVYDITNRWSFDGIDRWIKEIDEHAPGVPKILVGNRLHLAFKRQVATEQAQAYAERNGMTFF  145 (189)
T ss_pred             HHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHCCCCCHHHHHHHHHHCCCEEE
T ss_conf             16789886633704898227988999999999999999768987899613255033088999999999998899999


No 171
>PRK08155 acetolactate synthase catalytic subunit; Validated
Probab=30.09  E-value=41  Score=14.54  Aligned_cols=97  Identities=10%  Similarity=0.144  Sum_probs=49.2

Q ss_pred             HHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECC---CCCCHHHHHHHHHHHHHCCCCCEEEEEE
Q ss_conf             8999999998559985289999714101588888785077762376336---5478899999999986126864999961
Q gi|254780368|r   41 IALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESN---ETLEPLSIAKILREIVKKENPIIVIAGK  117 (249)
Q Consensus        41 ~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~---~~~D~~~~A~~La~~i~~~~~DLIl~G~  117 (249)
                      ..++.|++..-...-|-| .|.+ |.+....   ...  .+........   ...++..+.++. +.+++-.-=+|++|.
T Consensus       149 ~~~~~A~~~A~~~~~GPV-~l~i-P~dv~~~---~~~--~~~~~~~~~~~~~~~~~~~~i~~a~-~~L~~A~rPviv~G~  220 (564)
T PRK08155        149 QVISDAFRIAQSGRPGPV-WIDI-PKDVQTA---VIE--IEALPAPAEKDAAPAFSEESIRDAA-AMINAAKRPVLYLGG  220 (564)
T ss_pred             HHHHHHHHHHHHCCCCCE-EEEC-CHHHHHC---CCC--CCCCCCCCCCCCCCCCCHHHHHHHH-HHHHHCCCCEEEECC
T ss_conf             999999999862899875-8746-8036427---246--4447776667889999999999999-999854498897068


Q ss_pred             CCCCCCCEEHHHHHHHHHCCCCEEEEEE
Q ss_conf             1358886128999999857961332443
Q gi|254780368|r  118 QTTDNESNQTGQMLAALMRWPQATFVSN  145 (249)
Q Consensus       118 ~S~D~~~g~v~~~lA~~Lg~p~vt~v~~  145 (249)
                      .....+....-..+|+.||||.++....
T Consensus       221 g~~~~~a~~~~~~lae~l~~Pv~tt~~~  248 (564)
T PRK08155        221 GVINAPARVRAIELAEKAQLPTTMTLMA  248 (564)
T ss_pred             CCCCCHHHHHHHHHHHHHCCCEEECCCC
T ss_conf             7455019999999999869897733245


No 172
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.
Probab=29.99  E-value=41  Score=14.53  Aligned_cols=96  Identities=27%  Similarity=0.234  Sum_probs=57.0

Q ss_pred             HHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCC--CCCHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             13689999999985599852899997141015888887850777623763365--4788999999999861268649999
Q gi|254780368|r   38 FDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNE--TLEPLSIAKILREIVKKENPIIVIA  115 (249)
Q Consensus        38 ~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~--~~D~~~~A~~La~~i~~~~~DLIl~  115 (249)
                      ...++++.|-.|+++  |-+|+++|-+.+.....    ...|. +-+.+....  ....+.....|...+++..||+|.+
T Consensus        12 aE~~~~~La~~L~~~--Gh~V~vi~~~~~~~~~~----~~~g~-~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~Divh~   84 (355)
T cd03819          12 VERGTLELARALVER--GHRSLVASAGGRLVAEL----EAEGS-RHIKLPFISKNPLRILLNVARLRRLIREEKVDIVHA   84 (355)
T ss_pred             HHHHHHHHHHHHHHC--CCEEEEEECCCCCCHHH----HHCCC-EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             799999999999987--99899996899871556----63496-699917877882899999999999999969989997


Q ss_pred             EECCCCCCCEEHHHHHHHHHCCCCEEEEE
Q ss_conf             61135888612899999985796133244
Q gi|254780368|r  116 GKQTTDNESNQTGQMLAALMRWPQATFVS  144 (249)
Q Consensus       116 G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~  144 (249)
                      -.    ...+-.....+..++.|.+....
T Consensus        85 h~----~~~~~~~~~a~~~~~~~~i~t~H  109 (355)
T cd03819          85 RS----RAPAWSAYLAARRTRPPFVTTVH  109 (355)
T ss_pred             CC----CCHHHHHHHHHHHCCCCEEEEEC
T ss_conf             78----64499999999853997899967


No 173
>PRK00509 argininosuccinate synthase; Provisional
Probab=29.65  E-value=41  Score=14.49  Aligned_cols=92  Identities=29%  Similarity=0.278  Sum_probs=62.2

Q ss_pred             HHHHHHCCCCCCEEEEEE--CC-CHHHHHHHHHHHHCCCCCEEEECCC------------------C-------CCHHHH
Q ss_conf             999985599852899997--14-1015888887850777623763365------------------4-------788999
Q gi|254780368|r   46 SLQLREKGIATEVIVVSI--GS-CKVEEVLKNSLAMGADRGILIESNE------------------T-------LEPLSI   97 (249)
Q Consensus        46 Al~lke~~~g~~V~~lsv--G~-~~~~~~Lr~alAmGaD~ai~i~d~~------------------~-------~D~~~~   97 (249)
                      -..|+|+ .|.+|+++++  |. .+.+..-++|+..||.+.+.+.-++                  +       ..--.+
T Consensus        19 l~wL~e~-yg~eVia~~~d~Gq~~d~~~i~~kA~~~GA~~~~v~D~r~ef~~~~i~p~I~ana~Yeg~YpL~tslaRpli   97 (398)
T PRK00509         19 IKWLKEE-YGCEVVAFTADVGQGEELEPIREKALASGASEIYVEDLREEFVRDYVFPAIRANALYEGKYPLGTALARPLI   97 (398)
T ss_pred             HHHHHHH-CCCEEEEEEEECCCHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHHHH
T ss_conf             9999875-398899999979887788999999998299789996309999999999999608545585455220318899


Q ss_pred             HHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCE
Q ss_conf             9999998612686499996113588861289999998579613
Q gi|254780368|r   98 AKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQA  140 (249)
Q Consensus        98 A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~v  140 (249)
                      |+.+.++.++.+.|.|--|.  +--++-||=..++-.-=-|.+
T Consensus        98 a~~~ve~A~~~ga~aiaHG~--TGkGNDQvRFe~~~~aL~P~l  138 (398)
T PRK00509         98 AKKLVEIARKEGADAVAHGC--TGKGNDQVRFELAIAALAPDL  138 (398)
T ss_pred             HHHHHHHHHHCCCEEEEECC--CCCCCCHHHHHHHHHHHCCCC
T ss_conf             99999999971985998545--567860899999999859997


No 174
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms]
Probab=29.63  E-value=41  Score=14.49  Aligned_cols=48  Identities=27%  Similarity=0.312  Sum_probs=36.9

Q ss_pred             CHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             013689999999985599852899997141015888887850777623763
Q gi|254780368|r   37 PFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIE   87 (249)
Q Consensus        37 ~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~   87 (249)
                      -.|.+.+|.--.++.++..+.|.++|.  ++-.++++++|-.|+=. |+|.
T Consensus        56 mPd~~Gi~lL~~ir~~~~~~DVI~iTA--A~d~~tI~~alr~Gv~D-YLiK  103 (224)
T COG4565          56 MPDGNGIELLPELRSQHYPVDVIVITA--ASDMETIKEALRYGVVD-YLIK  103 (224)
T ss_pred             CCCCCCHHHHHHHHHCCCCCCEEEEEC--CCHHHHHHHHHHCCCHH-HEEC
T ss_conf             679850779999984689978899953--44378999999658232-2056


No 175
>COG2120 Uncharacterized proteins, LmbE homologs [Function unknown]
Probab=29.18  E-value=42  Score=14.44  Aligned_cols=66  Identities=23%  Similarity=0.402  Sum_probs=43.3

Q ss_pred             HHHHCCCCCCEEEE--EECCC------------HHHHHHHHHHHHCCCCCEEEECC---CCCCHHHHHHHHHHHHHCCCC
Q ss_conf             99855998528999--97141------------01588888785077762376336---547889999999998612686
Q gi|254780368|r   48 QLREKGIATEVIVV--SIGSC------------KVEEVLKNSLAMGADRGILIESN---ETLEPLSIAKILREIVKKENP  110 (249)
Q Consensus        48 ~lke~~~g~~V~~l--svG~~------------~~~~~Lr~alAmGaD~ai~i~d~---~~~D~~~~A~~La~~i~~~~~  110 (249)
                      ++.++  |.+|+++  |-|..            +-.+...-+-.+|.+.-+.+...   ...++......|...+.+..|
T Consensus        33 ~~~~~--G~~V~v~~lT~Ge~g~~~~~~~l~~~R~~E~~~a~~~LGv~~~~~l~~~~~~~~~~~~~~~~~L~~ii~~~~P  110 (237)
T COG2120          33 KLAAR--GVEVTVVCLTLGEAGENGGELELGAVRRAEARAAARVLGVRETIFLGFPDTGADADPEEITGALVAIIRRLRP  110 (237)
T ss_pred             HHHHC--CCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             99977--9879999943776777677531189999999999997499863877788744536979999999999985399


Q ss_pred             CEEEE
Q ss_conf             49999
Q gi|254780368|r  111 IIVIA  115 (249)
Q Consensus       111 DLIl~  115 (249)
                      +.||+
T Consensus       111 ~~V~t  115 (237)
T COG2120         111 DVVFT  115 (237)
T ss_pred             CEEEE
T ss_conf             77998


No 176
>PRK05057 aroK shikimate kinase I; Reviewed
Probab=28.95  E-value=42  Score=14.42  Aligned_cols=79  Identities=11%  Similarity=0.053  Sum_probs=40.6

Q ss_pred             CEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCC-EE--EEE-------EECCCC-EEEEEECCCEEEEEECC
Q ss_conf             49999611358886128999999857961332443343286-59--999-------835896-79999639889998435
Q gi|254780368|r  111 IIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDN-HA--IVT-------REVGHG-TMTMETPLPAVITVDLN  179 (249)
Q Consensus       111 DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~-~~--~v~-------r~~e~g-~e~v~~~lPavisv~~~  179 (249)
                      -++|.|-..  .+=..+|-.||..||||++--=.-++-..+ ++  ...       |+.|.- ...+...-++|+|+..|
T Consensus         6 nI~LiG~mG--sGKstvgk~LA~~l~~~fiD~D~~Ie~~~g~si~~If~~~Ge~~FR~~E~~~l~~l~~~~~~VIstGGG   83 (172)
T PRK05057          6 NIFLVGPMG--AGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADIGWVFDVEGEEGFRDREEKVINELTEKQGIVLATGGG   83 (172)
T ss_pred             CEEEECCCC--CCHHHHHHHHHHHHCCCEEECHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             289889999--988999999999969996878099999979899999999749999999999999885479979978985


Q ss_pred             CCCCCCCCHHHHHH
Q ss_conf             56545469888998
Q gi|254780368|r  180 LNEPRYISLPNIIK  193 (249)
Q Consensus       180 ~n~PR~psl~~im~  193 (249)
                      ...  ++.-+..|+
T Consensus        84 ~v~--~~~~~~~L~   95 (172)
T PRK05057         84 SVK--SRETRNRLS   95 (172)
T ss_pred             CCC--CHHHHHHHH
T ss_conf             358--899999999


No 177
>cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems. It is found in bacteria and plants. Elongation of fatty acids in the type II systems occurs by Claisen condensation of malonyl-acyl carrier protein (ACP) with acyl-ACP. KASIII initiates this process by specifically using acetyl-CoA over acyl-CoA.
Probab=28.88  E-value=43  Score=14.41  Aligned_cols=79  Identities=13%  Similarity=0.213  Sum_probs=37.0

Q ss_pred             HHHHHHHHHHHHCCC--CCC---EEEEEECCCHHH----HHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHH-HHHCCC
Q ss_conf             689999999985599--852---899997141015----8888878507776237633654788999999999-861268
Q gi|254780368|r   40 EIALEESLQLREKGI--ATE---VIVVSIGSCKVE----EVLKNSLAMGADRGILIESNETLEPLSIAKILRE-IVKKEN  109 (249)
Q Consensus        40 ~~AlE~Al~lke~~~--g~~---V~~lsvG~~~~~----~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~-~i~~~~  109 (249)
                      +-|+++|-+.-++.+  -.+   ++..|..|....    ..+...  +|+..+.-.+-..+.-.+..|--+|. .++...
T Consensus        52 ~ma~~Aa~~aL~~ag~~~~dIdlli~~s~~~~~~~P~~a~~v~~~--LGl~~~~~fdi~~~C~g~~~aL~~A~~~i~~g~  129 (320)
T cd00830          52 DLAVEAAKKALEDAGIDADDIDLIIVATSTPDYLFPATACLVQAR--LGAKNAAAFDINAACSGFLYGLSTAAGLIRSGG  129 (320)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCCCHHHHHHHH--HCCCCCCEECCCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             999999999998669895678889994156898688399999999--688997225104551158999999999985598


Q ss_pred             --CCEEEEEECCC
Q ss_conf             --64999961135
Q gi|254780368|r  110 --PIIVIAGKQTT  120 (249)
Q Consensus       110 --~DLIl~G~~S~  120 (249)
                        .-||+++...+
T Consensus       130 ~~~~Lvv~~e~~s  142 (320)
T cd00830         130 AKNVLVVGAETLS  142 (320)
T ss_pred             CCEEEEEECHHHC
T ss_conf             7616998413422


No 178
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.
Probab=28.43  E-value=43  Score=14.36  Aligned_cols=68  Identities=21%  Similarity=0.186  Sum_probs=33.9

Q ss_pred             EEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEEC-CCEEE--EE-------EECCCC-EEEEEECCCEEEEEECCC
Q ss_conf             99996113588861289999998579613324433432-86599--99-------835896-799996398899984355
Q gi|254780368|r  112 IVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKII-DNHAI--VT-------REVGHG-TMTMETPLPAVITVDLNL  180 (249)
Q Consensus       112 LIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~-~~~~~--v~-------r~~e~g-~e~v~~~lPavisv~~~~  180 (249)
                      ++|+|...+  +-..+|-.||..|+||++--=..++-. +.++.  ..       |..|.- ...+.-.-++|+++..+.
T Consensus         2 I~LiG~~G~--GKstigk~la~~l~~~fiD~D~~Ie~~~g~si~eif~~~Ge~~FR~~E~~~l~~~~~~~~~VIs~GGG~   79 (154)
T cd00464           2 IVLIGMMGA--GKTTVGRLLAKALGLPFVDLDELIEQRAGMSIPEIFAEEGEEGFRELEREVLLLLLTKENAVIATGGGA   79 (154)
T ss_pred             EEEECCCCC--CHHHHHHHHHHHHCCCEEECCHHHHHHHCCCHHHHHHHCCHHHHHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             899889999--889999999999798979685999999499999999874938789999999999856898599738973


Q ss_pred             C
Q ss_conf             6
Q gi|254780368|r  181 N  181 (249)
Q Consensus       181 n  181 (249)
                      .
T Consensus        80 v   80 (154)
T cd00464          80 V   80 (154)
T ss_pred             C
T ss_conf             3


No 179
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homolog
Probab=28.42  E-value=43  Score=14.36  Aligned_cols=97  Identities=13%  Similarity=0.060  Sum_probs=51.9

Q ss_pred             HHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEE---ECC------CCCCHHHHHHHHHHHHHCC
Q ss_conf             1368999999998559985289999714101588888785077762376---336------5478899999999986126
Q gi|254780368|r   38 FDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILI---ESN------ETLEPLSIAKILREIVKKE  108 (249)
Q Consensus        38 ~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i---~d~------~~~D~~~~A~~La~~i~~~  108 (249)
                      -..++.+.|-.|.++  |-+|+++|.+.+...+.        ....+.+   .-.      .+.-.+..+.-+.+.+++.
T Consensus        14 ~e~~v~~La~~L~~~--GHeV~vit~~~~~~~~~--------~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~l~~~~~~~   83 (371)
T cd04962          14 SGVVATELGKALARR--GHEVHFITSSRPFRLDE--------YSPNIFFHEVEVPQYPLFQYPPYDLALASKIAEVAKRY   83 (371)
T ss_pred             HHHHHHHHHHHHHHC--CCEEEEEECCCCCCCCC--------CCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             999999999999975--99999995689876555--------68973799846877653446721378999999999973


Q ss_pred             CCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEE
Q ss_conf             864999961135888612899999985796133244
Q gi|254780368|r  109 NPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVS  144 (249)
Q Consensus       109 ~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~  144 (249)
                      +||+|-+-........+..+..++...++|.++...
T Consensus        84 ~~DvvH~h~~~p~~~~~~l~~~~~~~~~~~~v~t~H  119 (371)
T cd04962          84 KLDLLHVHYAVPHAVAAYLAREILGKKDLPVVTTLH  119 (371)
T ss_pred             CCCEEEECCCCCHHHHHHHHHHHHHCCCCCEEEEEC
T ss_conf             998899725542679999999986447997899937


No 180
>PRK13582 thrH phosphoserine phosphatase; Provisional
Probab=28.33  E-value=36  Score=14.85  Aligned_cols=91  Identities=15%  Similarity=0.220  Sum_probs=56.0

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCCCEEEEC----CCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHH
Q ss_conf             8999971410158888878507776237633----654788999999999861268649999611358886128999999
Q gi|254780368|r   58 VIVVSIGSCKVEEVLKNSLAMGADRGILIES----NETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAA  133 (249)
Q Consensus        58 V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d----~~~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~  133 (249)
                      +.+.+=|-.+.++.||.=+++=.+.++-+++    .+...+..-|+-+-..++.. |..++.   |  ++=......+++
T Consensus        29 ~~~ttrgElDF~~sl~~RValLk~~Gl~~~~i~~v~~~l~~~pGA~ell~~Lr~~-~~v~Iv---S--GGF~~fa~~l~~  102 (205)
T PRK13582         29 LRATTRDIPDYDVLMKQRLDILDEHGLGLADIQEVIATLGPLPGAVEFLDWLRER-FQVVIL---S--DTFYEFAGPLMR  102 (205)
T ss_pred             HHHHHCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHC-CEEEEE---C--CCHHHHHHHHHH
T ss_conf             9999859988899999999999777999899999999678981399999999970-739998---6--868999999999


Q ss_pred             HHCCCCEEEEEEEEEC-CCEEEE
Q ss_conf             8579613324433432-865999
Q gi|254780368|r  134 LMRWPQATFVSNIKII-DNHAIV  155 (249)
Q Consensus       134 ~Lg~p~vt~v~~i~~~-~~~~~v  155 (249)
                      .||+|++ +...++++ +|.++-
T Consensus       103 ~LG~d~~-~aN~LeI~~~G~ltG  124 (205)
T PRK13582        103 QLGWPTL-FCHSLETDENGRITG  124 (205)
T ss_pred             HHCCCHH-CCCCCEECCCCEEEC
T ss_conf             9499753-024037668994968


No 181
>pfam10678 DUF2492 Protein of unknown function (DUF2492). This is a bacterial family of uncharacterized proteins.
Probab=28.21  E-value=33  Score=15.08  Aligned_cols=14  Identities=36%  Similarity=0.494  Sum_probs=5.2

Q ss_pred             HHHHHHHHHHHHCC
Q ss_conf             99999999986176
Q gi|254780368|r  235 TTKLIEILKSKHDL  248 (249)
Q Consensus       235 ~~eLv~~L~~e~~v  248 (249)
                      +++|+++|..+.|+
T Consensus        49 a~eLi~FL~~kgKf   62 (78)
T pfam10678        49 ADELIEFLLKKGKF   62 (78)
T ss_pred             HHHHHHHHHHCCCE
T ss_conf             99999999976987


No 182
>PRK07764 DNA polymerase III subunits gamma and tau; Validated
Probab=28.17  E-value=44  Score=14.33  Aligned_cols=59  Identities=22%  Similarity=0.266  Sum_probs=44.3

Q ss_pred             EECCCHHHHHHHHHHHHCC-CCCEEEECCCCCCHHHHHHHHHHHHHCC-CCCEEEEEECCC
Q ss_conf             9714101588888785077-7623763365478899999999986126-864999961135
Q gi|254780368|r   62 SIGSCKVEEVLKNSLAMGA-DRGILIESNETLEPLSIAKILREIVKKE-NPIIVIAGKQTT  120 (249)
Q Consensus        62 svG~~~~~~~Lr~alAmGa-D~ai~i~d~~~~D~~~~A~~La~~i~~~-~~DLIl~G~~S~  120 (249)
                      -+|.......|++++.-|- ..+|+.+...|.--..+|++||+++.-. +++---||...+
T Consensus        17 viGQe~v~~~L~~Ai~~gri~HAYLFsGprG~GKTt~ARilAkaLNC~~~~~~~PCg~C~s   77 (775)
T PRK07764         17 VVGQEHVTEPLSTALDSGRINHAYLFSGPRGCGKTSSARILARSLNCAQGPTSTPCGVCDS   77 (775)
T ss_pred             HCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHH
T ss_conf             2285999999999998199763376237888788899999999966899999898888763


No 183
>COG2237 Predicted membrane protein [Function unknown]
Probab=27.97  E-value=44  Score=14.31  Aligned_cols=55  Identities=24%  Similarity=0.280  Sum_probs=31.3

Q ss_pred             CCCHHHHHHHHHHHHHH----CCCCCCEEEEEECCC---HHHHH----HHHHH-HHCCCCCEEEECC
Q ss_conf             26013689999999985----599852899997141---01588----88878-5077762376336
Q gi|254780368|r   35 MNPFDEIALEESLQLRE----KGIATEVIVVSIGSC---KVEEV----LKNSL-AMGADRGILIESN   89 (249)
Q Consensus        35 in~~D~~AlE~Al~lke----~~~g~~V~~lsvG~~---~~~~~----Lr~al-AmGaD~ai~i~d~   89 (249)
                      ...-|-||+-+|+++-+    ++.+.||.++|-.+.   .++..    |-+-+ .+.+|.++.|+|-
T Consensus        42 PeDSD~Nalf~alkiydeLk~~geDveIA~vsG~~~vgv~sd~~l~~qld~vl~~~~pd~av~VsDG  108 (364)
T COG2237          42 PEDSDVNALFAALKIYDELKAKGEDVEIAVVSGDKDVGVESDLKLSEQLDEVLSELDPDDAVVVSDG  108 (364)
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             7644288999999999998605786599999658984566679999999999970799679995467


No 184
>PRK09468 ompR osmolarity response regulator; Provisional
Probab=27.90  E-value=44  Score=14.30  Aligned_cols=49  Identities=27%  Similarity=0.194  Sum_probs=29.6

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEE
Q ss_conf             2601368999999998559985289999714101588888785077762376
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILI   86 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i   86 (249)
                      ++..|...+|..-+|++.+...-|..+|.-  ..++..-.+|..|||. |+.
T Consensus        57 i~lp~~dG~~l~~~iR~~~~~~pII~LTa~--~~~~d~i~~l~~GADD-Yi~  105 (239)
T PRK09468         57 LMLPGEDGLSICRRLRSQNNPTPIIMLTAK--GEEVDRIVGLEMGADD-YLP  105 (239)
T ss_pred             CCCCCCCCCHHHHHHHHHCCCCCEEEEECC--CCHHHHHHHHHCCCCE-EEE
T ss_conf             899888873467778750578778999466--7878999999769868-855


No 185
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase. Members of this protein family are mycothiol-dependent formaldehyde dehydrogenase (EC 1.2.1.66). This protein is found, so far, only in the Actinobacteria (Mycobacterium sp., Streptomyces sp., Corynebacterium sp., and related species), where mycothione replaces glutathione.
Probab=27.71  E-value=45  Score=14.28  Aligned_cols=30  Identities=20%  Similarity=0.325  Sum_probs=12.0

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCCCEE
Q ss_conf             8528999971410158888878507776237
Q gi|254780368|r   55 ATEVIVVSIGSCKVEEVLKNSLAMGADRGIL   85 (249)
Q Consensus        55 g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~   85 (249)
                      |..|.++-.||-. --++.-+.++||.+.+.
T Consensus       177 g~~VlV~GaG~iG-l~a~~~ak~~Ga~~Vi~  206 (358)
T TIGR03451       177 GDSVAVIGCGGVG-DAAIAGAALAGASKIIA  206 (358)
T ss_pred             CCEEEEECCCHHH-HHHHHHHHHCCCCEEEE
T ss_conf             9889996737699-99999999839918999


No 186
>PRK00131 aroK shikimate kinase; Reviewed
Probab=27.63  E-value=45  Score=14.27  Aligned_cols=31  Identities=23%  Similarity=0.373  Sum_probs=22.0

Q ss_pred             CCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEE
Q ss_conf             864999961135888612899999985796133
Q gi|254780368|r  109 NPIIVIAGKQTTDNESNQTGQMLAALMRWPQAT  141 (249)
Q Consensus       109 ~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt  141 (249)
                      +..++|.|-..+  +-..+|-.||..||||++-
T Consensus         4 ~~nI~liG~~Gs--GKTtvgk~LA~~L~~~fiD   34 (175)
T PRK00131          4 GPNIVLIGMMGA--GKSTIGRLLAKRLGYEFID   34 (175)
T ss_pred             CCEEEEECCCCC--CHHHHHHHHHHHHCCCCCC
T ss_conf             980898889999--9899999999995969023


No 187
>pfam04123 DUF373 Domain of unknown function (DUF373). Archaeal domain of unknown function. Predicted to be an integral membrane protein with six transmembrane regions.
Probab=27.33  E-value=45  Score=14.24  Aligned_cols=54  Identities=26%  Similarity=0.291  Sum_probs=29.0

Q ss_pred             CCHHHHHHHHHHHHHHC----CCCCCEEEEEECCCH---HH----HHHHHHH-HHCCCCCEEEECC
Q ss_conf             60136899999999855----998528999971410---15----8888878-5077762376336
Q gi|254780368|r   36 NPFDEIALEESLQLREK----GIATEVIVVSIGSCK---VE----EVLKNSL-AMGADRGILIESN   89 (249)
Q Consensus        36 n~~D~~AlE~Al~lke~----~~g~~V~~lsvG~~~---~~----~~Lr~al-AmGaD~ai~i~d~   89 (249)
                      ..-|.||+-+|+++-++    +.+.||.++|-.+..   ++    +.|.+.+ ...+|.+++|+|-
T Consensus        43 eDSD~N~if~av~~yd~L~~~g~~veva~vtG~~~~gv~sd~~i~~qld~vl~~~~~d~~i~VsDG  108 (344)
T pfam04123        43 EDSDVNAIFAAVKIYDELKAEGEDVEVAVVSGSPDVGVEADRKIAEQLDEVLSLYDPDGAILVSDG  108 (344)
T ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             422478999999999999847986699999788986667689999999999982499869996048


No 188
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase; InterPro: IPR010107   This entry represents Glutamate decarboxylase (gad;) it is a pyridoxal 5'-phosphate (PLP)-dependent enzyme, which catalyses the irreversible alpha-decarboxylation of L-glutamate to gamma-aminobutyrate (GABA). This enzyme is widely distributed amongst eukaryotes and prokaryotes, but its function varies in different organisms .   Gad has a crucial role in the vertebrate central nervous system where it is responsible for the synthesis of GABA, the major inhibitory neurotransmitter. In the majority of vertebrates Gad occurs in two isoforms, GAD65 and GAD67, both active at neutral pH . Gad isoforms (GadA and GadB) have also been reported in some bacterial species, including the Gram-negative bacterium  and Gram-positive bacterium .   A unique feature of plant and yeast Gad is the presence of a calmodulin (CaM)-binding domain in the C-terminal region. In Saccharomyces cerevisiae, Gad expression is required for normal oxidative stress tolerance . In plants, Gad is thought to be a stress-adapter chaperonin sensing Ca2+ signals.; GO: 0004351 glutamate decarboxylase activity, 0030170 pyridoxal phosphate binding, 0006536 glutamate metabolic process.
Probab=27.19  E-value=46  Score=14.22  Aligned_cols=114  Identities=20%  Similarity=0.166  Sum_probs=74.9

Q ss_pred             EEEECCCCCC------EEECCCCC--EEEECCCCEECCCHHHHHHHHHHHHHHCCCCCCEEEEEE----CCCHHHHHHHH
Q ss_conf             6030388760------59807888--163248773326013689999999985599852899997----14101588888
Q gi|254780368|r    7 IKGVINYNTK------VRIKNDYS--GIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSI----GSCKVEEVLKN   74 (249)
Q Consensus         7 vK~VpD~~~~------i~i~~~~~--~i~~~~~~~~in~~D~~AlE~Al~lke~~~g~~V~~lsv----G~~~~~~~Lr~   74 (249)
                      +|-.||..=+      +.|+.+|+  +|.--|+.|||= =|+.+|=+=|..+=.+-|+..--+++    |..+.-.+=-+
T Consensus       265 mk~~PDl~WDFRLprV~SINvSGHKYGLvYPGvGWViW-Rd~e~LPeELiF~vnYLGg~~~tFtLNFSrp~~qViaQYYn  343 (493)
T TIGR01788       265 MKVEPDLEWDFRLPRVKSINVSGHKYGLVYPGVGWVIW-RDEEALPEELIFHVNYLGGDEPTFTLNFSRPANQVIAQYYN  343 (493)
T ss_pred             EEECCCEEECCCCCCEEEECCCCCCCCCCCCCCCEEEE-CCCCCCHHHCEEECCCCCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             15457126566178246870465512464766126887-58113701311101102665654301355762311364466


Q ss_pred             HHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCC----C-CCEEEEEECCCCCCCE
Q ss_conf             7850777623763365478899999999986126----8-6499996113588861
Q gi|254780368|r   75 SLAMGADRGILIESNETLEPLSIAKILREIVKKE----N-PIIVIAGKQTTDNESN  125 (249)
Q Consensus        75 alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~~----~-~DLIl~G~~S~D~~~g  125 (249)
                      -|..|- ++|+=   ---....||+.||..|.+.    | |++|=.|..|+..++.
T Consensus       344 FlRLG~-~GYr~---i~q~~~~vA~~La~~~~~~sklPG~Fe~~s~g~~sienDsa  395 (493)
T TIGR01788       344 FLRLGR-EGYRK---IMQNLLDVAQYLAEEIAKLSKLPGPFEILSDGRESIENDSA  395 (493)
T ss_pred             HHHCCH-HHHHH---HHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCC
T ss_conf             885040-13489---99989999999999999860699845887178754334567


No 189
>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only]
Probab=27.12  E-value=46  Score=14.21  Aligned_cols=142  Identities=14%  Similarity=0.121  Sum_probs=70.6

Q ss_pred             HHCCCCCCEEEEEECCCH-----HHHHHHHHHHHCCCCCEEEECC-C------CCC-----HHHHHHHHHHHHHCCCCCE
Q ss_conf             855998528999971410-----1588888785077762376336-5------478-----8999999999861268649
Q gi|254780368|r   50 REKGIATEVIVVSIGSCK-----VEEVLKNSLAMGADRGILIESN-E------TLE-----PLSIAKILREIVKKENPII  112 (249)
Q Consensus        50 ke~~~g~~V~~lsvG~~~-----~~~~Lr~alAmGaD~ai~i~d~-~------~~D-----~~~~A~~La~~i~~~~~DL  112 (249)
                      ++. .|-.|.++|+-.+-     -+++-..|--.|...-+.=.+. .      ..+     ...+-.+|-..+++.|||+
T Consensus        38 ~~~-lG~~v~AvTv~sP~~p~~e~e~A~~~A~~iGi~H~~i~~~~~~~~~~~n~~~rCY~CK~~v~~~l~~~a~~~Gyd~  116 (269)
T COG1606          38 KEA-LGDNVVAVTVDSPYIPRREIEEAKNIAKEIGIRHEFIKMNRMDPEFKENPENRCYLCKRAVYSTLVEEAEKRGYDV  116 (269)
T ss_pred             HHH-HCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEHHHCCHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCE
T ss_conf             997-3564699997168777666067899999948762465500025233049987355778999999999999739988


Q ss_pred             EEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEECCCCEEEE-EECCCEEEEEECCCCCCCCCCHHHH
Q ss_conf             999611358886128999999857961332443343286599998358967999-9639889998435565454698889
Q gi|254780368|r  113 VIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTM-ETPLPAVITVDLNLNEPRYISLPNI  191 (249)
Q Consensus       113 Il~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g~e~v-~~~lPavisv~~~~n~PR~psl~~i  191 (249)
                      |+-|...+|.-..-=|.+....+|+-+  .-.++.+....+..--. .-|.-.. .-+++|+.|--.-..+--.-.++.+
T Consensus       117 V~dGtNasDl~~~RPG~rA~kE~gi~s--Pl~e~gitk~eIre~a~-~lgl~~~~kp~~aCl~sr~p~g~ei~~e~l~kv  193 (269)
T COG1606         117 VADGTNASDLFDYRPGLRALKELGIRS--PLAEFGITKKEIREIAK-SLGLPTWDKPSMACLASRIPYGEEITVEDLKKV  193 (269)
T ss_pred             EEECCCHHHHCCCCCCHHHHHHCCCCC--HHHHHCCCHHHHHHHHH-HCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             974775787337883023577607777--18883975999999999-759984558654332000677765668889988


Q ss_pred             HHHH
Q ss_conf             9885
Q gi|254780368|r  192 IKAR  195 (249)
Q Consensus       192 m~A~  195 (249)
                      -.|.
T Consensus       194 ~~ae  197 (269)
T COG1606         194 EEAE  197 (269)
T ss_pred             HHHH
T ss_conf             9999


No 190
>TIGR02885 spore_sigF RNA polymerase sigma-F factor; InterPro: IPR014236   The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme . RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes.   With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognized by the major sigma factors , .    Members of this entry represent RNA polymerase sigma factor F. Within the Firmicutes, Sigma-F is specifically, and universally, a component of the endospore formation program, and is expressed in the forespore to turn on the expression of dozens of genes. It is closely related to sigma-G, which is also expressed in the forespore.; GO: 0003677 DNA binding, 0003700 transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, 0006355 regulation of transcription DNA-dependent.
Probab=26.99  E-value=19  Score=16.73  Aligned_cols=49  Identities=20%  Similarity=0.175  Sum_probs=35.3

Q ss_pred             HHHHHHHHHHHHHCCCC--CEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEE
Q ss_conf             89999999998612686--4999961135888612899999985796133244334
Q gi|254780368|r   94 PLSIAKILREIVKKENP--IIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIK  147 (249)
Q Consensus        94 ~~~~A~~La~~i~~~~~--DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~  147 (249)
                      .|.---+|..+|.+...  -.|++=+    +.--+|=..+|.+||+.|| .|++||
T Consensus       170 ~~~~ki~Lke~i~~Ld~rer~ii~LR----YFKDkTQ~eVA~~LGISQV-QVSRlE  220 (231)
T TIGR02885       170 DLLEKIALKEAISKLDERERQIIMLR----YFKDKTQTEVAKMLGISQV-QVSRLE  220 (231)
T ss_pred             HHHHHHHHHHHHHHCCCCCCEEEEEE----CCCCCHHHHHHHHCCCCCC-HHHHHH
T ss_conf             89998999999861252267897741----0140017999977185700-122789


No 191
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light.
Probab=26.86  E-value=46  Score=14.18  Aligned_cols=100  Identities=20%  Similarity=0.173  Sum_probs=52.7

Q ss_pred             HHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECC--CCCC-----HH--HHHHHHHHHHH--
Q ss_conf             1368999999998559985289999714101588888785077762376336--5478-----89--99999999861--
Q gi|254780368|r   38 FDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESN--ETLE-----PL--SIAKILREIVK--  106 (249)
Q Consensus        38 ~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~--~~~D-----~~--~~A~~La~~i~--  106 (249)
                      .-.|..+.|-.|.+.  |-+|+++|-........... ..-|. +.+++...  ....     ++  ..+..+...++  
T Consensus        23 ~e~~v~~La~~L~~~--GH~V~V~t~~~~~~~~~~~~-~~~gv-~v~rl~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~   98 (398)
T cd03800          23 QNVYVLELARALARL--GHEVDIFTRRIDDALPPIVE-LAPGV-RVVRVPAGPAEYLPKEELWPYLDEFADDLLRFLRRE   98 (398)
T ss_pred             HHHHHHHHHHHHHHC--CCEEEEEECCCCCCCCCEEE-ECCCE-EEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             799999999999986--99699997247778888068-24986-999955788543327777878999999999999983


Q ss_pred             CCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEE
Q ss_conf             268649999611358886128999999857961332443
Q gi|254780368|r  107 KENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSN  145 (249)
Q Consensus       107 ~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~  145 (249)
                      ...||+|-|=    +..++.++.+++..+|+|.+.....
T Consensus        99 ~~~pDvIH~h----~~~~~~~~~~~~~~~~ip~V~t~H~  133 (398)
T cd03800          99 GGRPDLIHAH----YWDSGLVALLLARRLGIPLVHTFHS  133 (398)
T ss_pred             CCCCCEEEEC----CCCHHHHHHHHHHHHCCCEEEECCC
T ss_conf             8998889988----8407899999999719999996375


No 192
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional
Probab=26.82  E-value=46  Score=14.18  Aligned_cols=54  Identities=20%  Similarity=0.130  Sum_probs=40.4

Q ss_pred             EECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEEC
Q ss_conf             33260136899999999855998528999971410158888878507776237633
Q gi|254780368|r   33 ISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIES   88 (249)
Q Consensus        33 ~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d   88 (249)
                      +.++-.+...|+..-+|+.++.+.++.++||-.  .+..+..+|.-|+-.+|+...
T Consensus        46 mDi~mP~~dGL~~~~~L~r~~P~vriLVLTm~d--~e~~v~~aL~~aga~Gyl~K~   99 (205)
T PRK11475         46 SAMRSERREGLSCLTELAIKFPRMRRLVIADDD--IEARLIGSLSPSPLDGVLSKA   99 (205)
T ss_pred             ECCCCCCCCHHHHHHHHHHHCCCCEEEEEECCC--CHHHHHHHHHHHHCCEEEECC
T ss_conf             538999976699999999978997189997476--879999999984166888567


No 193
>PRK08199 acetolactate synthase 2 catalytic subunit; Validated
Probab=26.75  E-value=46  Score=14.17  Aligned_cols=52  Identities=17%  Similarity=0.128  Sum_probs=32.0

Q ss_pred             CHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEE
Q ss_conf             88999999999861268649999611358886128999999857961332443
Q gi|254780368|r   93 EPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSN  145 (249)
Q Consensus        93 D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~  145 (249)
                      +.-.+ ..+++.+++-.--+|++|......+...---.+|+.||+|.++....
T Consensus       184 ~~~~i-~~~~~~L~~AkrPvii~G~g~~~~~a~~~l~~lae~lg~Pv~tt~~g  235 (553)
T PRK08199        184 GAADL-ARLAELLAAAERPLVILGGSGWTPAAVADLRAFAERWGLPVATAFRR  235 (553)
T ss_pred             CHHHH-HHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEECCCC
T ss_conf             99999-99999998478988993787355479999999999859888951456


No 194
>pfam00289 CPSase_L_chain Carbamoyl-phosphate synthase L chain, N-terminal domain. Carbamoyl-phosphate synthase catalyses the ATP-dependent synthesis of carbamyl-phosphate from glutamine or ammonia and bicarbonate. This important enzyme initiates both the urea cycle and the biosynthesis of arginine and/or pyrimidines. The carbamoyl-phosphate synthase (CPS) enzyme in prokaryotes is a heterodimer of a small and large chain. The small chain promotes the hydrolysis of glutamine to ammonia, which is used by the large chain to synthesize carbamoyl phosphate. See pfam00988. The small chain has a GATase domain in the carboxyl terminus. See pfam00117.
Probab=26.58  E-value=47  Score=14.15  Aligned_cols=93  Identities=17%  Similarity=0.138  Sum_probs=55.7

Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEEC
Q ss_conf             36899999999855998528999971410158888878507776237633654788999999999861268649999611
Q gi|254780368|r   39 DEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQ  118 (249)
Q Consensus        39 D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~~~~DLIl~G~~  118 (249)
                      -+.|+....-++|-  |-+.+++---+.......+.     +|+++++.......++.+...|-+++++.+.|.|.-|-.
T Consensus        10 GeiA~ri~rt~re~--gi~~v~i~s~~d~~s~~~~~-----ad~~~~~~~~~~~~~Yl~~~~Ii~ia~~~~~~aihpGyG   82 (109)
T pfam00289        10 GEIAVRIIRALREL--GIETVAVNSNPDTVSTHVRL-----ADEAYFLGPGPASESYLNIERILDIAEKEGADAIHPGYG   82 (109)
T ss_pred             CHHHHHHHHHHHHC--CCCEEEEECHHHCCCHHHHH-----HHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCEEECCCC
T ss_conf             79999999999986--99799996334415225665-----057653479983211137999999999818896877976


Q ss_pred             CCCCCCEEHHHHHHHHHCCCCE
Q ss_conf             3588861289999998579613
Q gi|254780368|r  119 TTDNESNQTGQMLAALMRWPQA  140 (249)
Q Consensus       119 S~D~~~g~v~~~lA~~Lg~p~v  140 (249)
                      -...+ ......+. ..|+.++
T Consensus        83 flsEn-~~fa~~~~-~~Gi~fi  102 (109)
T pfam00289        83 FLSEN-AEFAEACE-KAGITFI  102 (109)
T ss_pred             CCCCC-HHHHHHHH-HCCCEEE
T ss_conf             23359-99999999-8889899


No 195
>TIGR00496 frr ribosome recycling factor; InterPro: IPR002661   The ribosome recycling factor or ribosome release factor (RRF) dissociates ribosomes from mRNA after termination of translation, and is essential for bacterial growth . Thus ribosomes are 'recycled' and ready for another round of protein synthesis.; GO: 0006412 translation.
Probab=26.41  E-value=33  Score=15.10  Aligned_cols=24  Identities=13%  Similarity=0.109  Sum_probs=17.2

Q ss_pred             ECHHHHCCCCCCCEEEEEEECCCC
Q ss_conf             049890766668457999517885
Q gi|254780368|r  202 KKATDFAIDLTPRLKVLRFEENRA  225 (249)
Q Consensus       202 ~~~~dlg~d~~~~~~v~~~~~p~~  225 (249)
                      +..+|||+.+.+-=..++++.||-
T Consensus        74 I~~adLGl~P~~DG~~IR~~~Ppl   97 (177)
T TIGR00496        74 ILRADLGLNPNNDGEVIRINFPPL   97 (177)
T ss_pred             HHHCCCCCCCCCCCCEEEECCCCC
T ss_conf             986068877778876210258898


No 196
>PRK11083 DNA-binding response regulator CreB; Provisional
Probab=26.37  E-value=47  Score=14.13  Aligned_cols=66  Identities=27%  Similarity=0.254  Sum_probs=36.2

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             260136899999999855998528999971410158888878507776237633654788999999999861
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVK  106 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~  106 (249)
                      ++..|.+.+|.+-+|++.....-|..+|.-.  .++-.-.+|..|||. |+.   ...++.....-+.+.++
T Consensus        55 i~LP~~~G~~l~~~iR~~~~~~pII~lta~~--~~~d~i~~l~~GADD-Yl~---KPf~~~EL~aRi~a~lr  120 (229)
T PRK11083         55 VGLPDISGFELCRQLRAFHPALPVIFLTARS--DEVDRLVGLEIGADD-YVA---KPFSPREVAARVRTILR  120 (229)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCEEEEEECCC--CHHHHHHHHHCCCCE-EEE---CCCCHHHHHHHHHHHHH
T ss_conf             8899987688999999708997299983678--989999999759987-730---87428999999999997


No 197
>TIGR01135 glmS glucosamine--fructose-6-phosphate aminotransferase, isomerizing; InterPro: IPR005855    Glucosamine:fructose-6-phosphate aminotransferase (2.6.1.16 from EC) catalyses the formation of glucosamine 6-phosphate and is the first and rate-limiting enzyme of the hexosamine biosynthetic pathway. The final product of the hexosamine pathway, UDP-N-acetyl glucosamine, is an active precursor of numerous macromolecules containing amino sugars.   This family of sequences belong to the MEROPS peptidase family C44 (clan PB(C)), and are classified as non-peptidase homologs.; GO: 0004360 glutamine-fructose-6-phosphate transaminase (isomerizing) activity, 0016051 carbohydrate biosynthetic process, 0005737 cytoplasm.
Probab=26.07  E-value=28  Score=15.55  Aligned_cols=13  Identities=23%  Similarity=0.394  Sum_probs=4.8

Q ss_pred             EEEEECCCEEEEE
Q ss_conf             9999639889998
Q gi|254780368|r  164 MTMETPLPAVITV  176 (249)
Q Consensus       164 e~v~~~lPavisv  176 (249)
                      --++-.+|.|+-.
T Consensus       525 ALid~~~PVva~a  537 (628)
T TIGR01135       525 ALIDEGLPVVAIA  537 (628)
T ss_pred             EEECCCCEEEEEE
T ss_conf             0331887089982


No 198
>TIGR02352 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727   This family consists of the homotetrameric, FAD-dependent glycine oxidase ThiO, from species such as Bacillus subtilis that use glycine in thiamine biosynthesis. In general, members of this family will not be found in species such as Escherichia coli that instead use tyrosine and the ThiH protein .; GO: 0016491 oxidoreductase activity, 0050660 FAD binding.
Probab=26.03  E-value=48  Score=14.09  Aligned_cols=167  Identities=14%  Similarity=0.108  Sum_probs=94.4

Q ss_pred             CEECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             73326013689999999985599852899997141015888887850777623763365478899999999986126864
Q gi|254780368|r   32 KISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPI  111 (249)
Q Consensus        32 ~~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~~~~D  111 (249)
                      .-..+.-|..-+..--++..+. |-++.-+|-...   -.+.=.|+=+...|+++.++..-|+....++|.+.+++.|..
T Consensus        93 ~vA~~~~d~~~l~~~~~~~~~~-G~~~~~l~~~~~---r~~EP~L~~~~~~a~~~p~d~~v~~r~l~~AL~~~~~~lGv~  168 (357)
T TIGR02352        93 VVAFDEDDVEKLRQLADLQSAT-GMELEWLSGRAL---RRLEPYLSPGIRGAVYYPDDAHVDPRELLKALVKALEKLGVE  168 (357)
T ss_pred             EEECCCCHHHHHHHHHHHHHHH-CCEEEECCHHHH---HHHCCCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHCCCE
T ss_conf             9407871168889999998752-860465077999---984425242203345748652337189999999999856947


Q ss_pred             EEE-EEECCCCCCCE-------------------EHHHHHHHHHC------CCCEEEEEEEEECC---CE-EEEEEECCC
Q ss_conf             999-96113588861-------------------28999999857------96133244334328---65-999983589
Q gi|254780368|r  112 IVI-AGKQTTDNESN-------------------QTGQMLAALMR------WPQATFVSNIKIID---NH-AIVTREVGH  161 (249)
Q Consensus       112 LIl-~G~~S~D~~~g-------------------~v~~~lA~~Lg------~p~vt~v~~i~~~~---~~-~~v~r~~e~  161 (249)
                      ++- |..++.+....                   .-|..-.++++      .|--.++.++++-.   .. -...|..=.
T Consensus       169 i~~~~~v~~~~~~~~~~~~~~~~~~~~~ad~vV~A~G~wa~~l~~p~~~~~rpV~G~~l~~~~~~~~~~~~~~~~r~~v~  248 (357)
T TIGR02352       169 IIEEVEVQEIEARGEKVTAVVTSSGDVQADQVVLAAGAWAGELLGPGNLPLRPVKGQMLRLEVPATLVPLLNRPVRAVVY  248 (357)
T ss_pred             EEECCCEEEEECCCCEEEEECCCCCCEECCEEEEECCCCHHHHHCCCCCCCCCCCEEEEEEEEECCCCCCCCCCEEEEEC
T ss_conf             98625335643267669885288542655747993573334430101025565340589986407665557744256413


Q ss_pred             CEEEE---EECCCEEEEEECCC-CCCCCCCHHHHHHHHHCCCCEE
Q ss_conf             67999---96398899984355-6545469888998852166120
Q gi|254780368|r  162 GTMTM---ETPLPAVITVDLNL-NEPRYISLPNIIKARKKRIEKK  202 (249)
Q Consensus       162 g~e~v---~~~lPavisv~~~~-n~PR~psl~~im~A~kk~i~~~  202 (249)
                      +.+.+   +-+-=.||..+... +-..-|++.+|+.--++.+..+
T Consensus       249 ~~~~YivPR~~G~l~vGAT~~~~~~~~~~~~~g~~~Ll~~A~~~~  293 (357)
T TIGR02352       249 GRRVYIVPRRDGRLVVGATSEEAGFDTTVTLEGIKELLRDAYTIL  293 (357)
T ss_pred             CCCEEEEECCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             883458775897589986323478899877789999998787443


No 199
>PRK13949 shikimate kinase; Provisional
Probab=25.95  E-value=48  Score=14.08  Aligned_cols=67  Identities=15%  Similarity=0.068  Sum_probs=35.4

Q ss_pred             EEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEEC-CCEEE--EE-------EECCCC-EEEEEECCCEEEEEECCC
Q ss_conf             99996113588861289999998579613324433432-86599--99-------835896-799996398899984355
Q gi|254780368|r  112 IVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKII-DNHAI--VT-------REVGHG-TMTMETPLPAVITVDLNL  180 (249)
Q Consensus       112 LIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~-~~~~~--v~-------r~~e~g-~e~v~~~lPavisv~~~~  180 (249)
                      ++|.|-..+  +-..+|-.||..||||++--=..++-. +.++.  ..       |+.|.- ...+.-.-++|+|...|.
T Consensus         4 I~LiG~mGs--GKstiGk~La~~l~~~fiD~D~~Ie~~~g~sI~eif~~~Ge~~FR~~E~~~l~~l~~~~~~VistGGG~   81 (169)
T PRK13949          4 IFLVGYMGA--GKTTLGKALARELGLSFIDLDFFIENRFHKTVGDIFAERGEAVFRELERNMLHEVAEFEDVVISTGGGA   81 (169)
T ss_pred             EEEECCCCC--CHHHHHHHHHHHHCCCEEECCHHHHHHHCCCHHHHHHHHCHHHHHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             899799999--889999999999599979784999998599999999986989999999999999845898399748631


No 200
>TIGR01862 N2-ase-Ialpha nitrogenase component I, alpha chain; InterPro: IPR010143   This entry represents all three varieties (Fe-Fe, Mo-Fe and V-Fe) of the component I alpha chain of nitrogenase.   Nitrogenase (1.18.6.1 from EC)  is the enzyme system responsible for biological nitrogen fixation. Nitrogenase is an oligomeric complex which consists of two components: component 2 is an homodimer of an iron-sulphur protein, while component 1 which contains the active site for the reduction of nitrogen to ammonia exists in three different forms: the molybdenum-iron containing protein (MoFe) is a hetero-tetramer consisting of two pairs of alpha (nifD) and beta (nifK) subunits; the vanadium-iron containing protein (VFe) is a hexamer of two pairs each of alpha (vnfD), beta (vnfK), and delta (vnfG) subunits; the third form seems to only contain iron and is a hexamer composed of alpha (anfD), beta (anfK), and delta (anfG) subunits. The alpha and beta chains of the three types of component 1 are evolutionary related and they are also related to proteins nifE and nifN, which are most probably involved in the iron-molybdenum cofactor biosynthesis .; GO: 0016163 nitrogenase activity, 0051536 iron-sulfur cluster binding, 0009399 nitrogen fixation.
Probab=25.88  E-value=48  Score=14.07  Aligned_cols=30  Identities=17%  Similarity=0.038  Sum_probs=14.6

Q ss_pred             HHHHHHHCCCCCCEEEEEECCCHHHHHHHH
Q ss_conf             999998559985289999714101588888
Q gi|254780368|r   45 ESLQLREKGIATEVIVVSIGSCKVEEVLKN   74 (249)
Q Consensus        45 ~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~   74 (249)
                      =|-.|+++++=--+-+=+.|.....++||+
T Consensus       264 Ia~~le~rYGIP~~~~dffG~~~~~e~LR~  293 (510)
T TIGR01862       264 IANELEERYGIPWLKIDFFGFEYIAESLRA  293 (510)
T ss_pred             HHHHHHHCCCCCEEEECCCCCHHHHHHHHH
T ss_conf             999855307875377546570378998999


No 201
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homolog
Probab=25.78  E-value=48  Score=14.06  Aligned_cols=96  Identities=19%  Similarity=0.149  Sum_probs=55.7

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEEC-----C-CCCCHHHHHHHHHHHHHCC
Q ss_conf             260136899999999855998528999971410158888878507776237633-----6-5478899999999986126
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIES-----N-ETLEPLSIAKILREIVKKE  108 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d-----~-~~~D~~~~A~~La~~i~~~  108 (249)
                      ++..-.+..+.|-.|.++  |-+|+++|-++.......        ...+.+..     . ...-.+.....+...+++.
T Consensus        13 ~GG~e~~~~~la~~L~~~--Gh~V~v~t~~~~~~~~~~--------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (364)
T cd03814          13 VNGVVRTLQRLVEHLRAR--GHEVLVIAPGPFRESEGP--------ARVVPVPSVPLPGYPEIRLALPPRRRVRRLLDAF   82 (364)
T ss_pred             CCCHHHHHHHHHHHHHHC--CCEEEEEECCCCCCCCCC--------CCEEEEEEEECCCCCCCEECCCHHHHHHHHHHHC
T ss_conf             884999999999999977--998999978997655556--------6346786674688876300203299999999865


Q ss_pred             CCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEE
Q ss_conf             86499996113588861289999998579613324
Q gi|254780368|r  109 NPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFV  143 (249)
Q Consensus       109 ~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v  143 (249)
                      .||+|.+-..   .-.+..+..++...++|.+...
T Consensus        83 ~pDiIh~~~~---~~~~~~a~~~~~~~~ip~i~~~  114 (364)
T cd03814          83 APDVVHIATP---GPLGLAALRAARRLGIPVVTSY  114 (364)
T ss_pred             CCCEEEECCC---CHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9999998784---1678999999997599789997


No 202
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases. aviGT4 in Streptomyces viridochromogenes has been shown to be involved in biosynthesis of oligosaccharide antibiotic avilamycin A. Inactivation of aviGT4 resulted in a mutant that accumulated a novel avilamycin derivative lacking the terminal eurekanate residue.
Probab=25.57  E-value=49  Score=14.03  Aligned_cols=97  Identities=12%  Similarity=0.069  Sum_probs=54.7

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECC-CCCCHHHHHHHHHHHHHCCCCCEE
Q ss_conf             2601368999999998559985289999714101588888785077762376336-547889999999998612686499
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESN-ETLEPLSIAKILREIVKKENPIIV  113 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~-~~~D~~~~A~~La~~i~~~~~DLI  113 (249)
                      +.-.-.+..+.|-.|.++  |-+|++++-+......-+..    ........... .....+.....+...++..+||+|
T Consensus        18 ~GG~e~~~~~La~~L~~~--Gh~V~v~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dvv   91 (335)
T cd03802          18 YGGTERVVAALTEGLVAR--GHEVTLFASGDSKTAAPLVP----VVPEPLRLDAPGRDRAEAEALALAERALAAGDFDIV   91 (335)
T ss_pred             CCCHHHHHHHHHHHHHHC--CCEEEEEECCCCCCCCCCCC----CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             897999999999999976--99899996289877885004----567665445442212456899999999975798589


Q ss_pred             EEEECCCCCCCEEHHHHHHHHHCCCCEEEEE
Q ss_conf             9961135888612899999985796133244
Q gi|254780368|r  114 IAGKQTTDNESNQTGQMLAALMRWPQATFVS  144 (249)
Q Consensus       114 l~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~  144 (249)
                      .+  +     +.......+...+.|.+....
T Consensus        92 h~--~-----~~~~~~~~~~~~~~p~v~t~H  115 (335)
T cd03802          92 HN--H-----SLHLPLPFARPLPVPVVTTLH  115 (335)
T ss_pred             EE--C-----CCHHHHHHHHHCCCCEEEEEC
T ss_conf             98--9-----717899998627997899989


No 203
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional
Probab=25.53  E-value=49  Score=14.03  Aligned_cols=79  Identities=20%  Similarity=0.286  Sum_probs=52.7

Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCC-CCCEEEECCCCCCHHHHHHHHHHHHHCC--CCCEEEE
Q ss_conf             368999999998559985289999714101588888785077-7623763365478899999999986126--8649999
Q gi|254780368|r   39 DEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGA-DRGILIESNETLEPLSIAKILREIVKKE--NPIIVIA  115 (249)
Q Consensus        39 D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGa-D~ai~i~d~~~~D~~~~A~~La~~i~~~--~~DLIl~  115 (249)
                      -..++|.|++..   .+++|+++-.-+...+-.-+++-..|. |+..++..++.           +++.+.  .||.||.
T Consensus        52 GsvsiEaa~~~~---~~~~V~aIE~~~e~~~~~~~N~~kfg~~~nv~~i~G~ap-----------~~l~~l~p~pD~vFI  117 (198)
T PRK00377         52 GSVSVEAALIVG---EGGKVYAIDKDELAVELTKKNAEKFGVGDNVVLIEGEAP-----------EVLPKLNPKSDRYFI  117 (198)
T ss_pred             EHHHHHHHHHCC---CCCEEEEEECCHHHHHHHHHHHHHCCCCCCEEEEECCHH-----------HHHHCCCCCCCEEEE
T ss_conf             299999999669---787599996788899999999998099988599952548-----------877208998898999


Q ss_pred             EECCCCCCCEEHHHHHHHHHC
Q ss_conf             611358886128999999857
Q gi|254780368|r  116 GKQTTDNESNQTGQMLAALMR  136 (249)
Q Consensus       116 G~~S~D~~~g~v~~~lA~~Lg  136 (249)
                      |     |.+|+....+-..+.
T Consensus       118 G-----G~~g~l~~il~~~~~  133 (198)
T PRK00377        118 G-----GGGEELPEIIQAALE  133 (198)
T ss_pred             E-----CCCCCHHHHHHHHHH
T ss_conf             7-----887778999999998


No 204
>PRK06456 acetolactate synthase catalytic subunit; Reviewed
Probab=25.50  E-value=49  Score=14.02  Aligned_cols=53  Identities=19%  Similarity=0.245  Sum_probs=35.4

Q ss_pred             CCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEE
Q ss_conf             788999999999861268649999611358886128999999857961332443
Q gi|254780368|r   92 LEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSN  145 (249)
Q Consensus        92 ~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~  145 (249)
                      .|+..+.++ ++.+++-.--+|++|......+...---.+|+.|++|.++....
T Consensus       192 ~d~~~i~~a-~~lL~~AkrPvIl~G~G~~~~~a~~~l~~lae~l~~Pv~tT~~g  244 (572)
T PRK06456        192 IDRQKIKKA-AEILINAERPIILVGTGVVWSNATPEVLELAELLHIPIVSTFPG  244 (572)
T ss_pred             CCHHHHHHH-HHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHCCCCEECCCC
T ss_conf             899999999-99998189988999558241436499999999839981220145


No 205
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
Probab=25.43  E-value=49  Score=14.02  Aligned_cols=96  Identities=21%  Similarity=0.106  Sum_probs=55.5

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEE-CC--CCCC---HHHHHHHHHHHHHCC
Q ss_conf             26013689999999985599852899997141015888887850777623763-36--5478---899999999986126
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIE-SN--ETLE---PLSIAKILREIVKKE  108 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~-d~--~~~D---~~~~A~~La~~i~~~  108 (249)
                      ++-.-.+..+.|-.|.++  |-+|+++|-..+.....-       ....+... ..  ...+   .+.....+...+++.
T Consensus        13 ~GG~~~~~~~La~~L~~~--GheV~Vit~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   83 (374)
T cd03817          13 VNGVATSIRRLAEELEKR--GHEVYVVAPSYPGAPEEE-------EVVVVRPFRVPTFKYPDFRLPLPIPRALIIILKEL   83 (374)
T ss_pred             CCCHHHHHHHHHHHHHHC--CCEEEEEECCCCCCCCCC-------CCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             980999999999999977--998999972798877543-------57628984367776521345555799999999866


Q ss_pred             CCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEE
Q ss_conf             8649999611358886128999999857961332
Q gi|254780368|r  109 NPIIVIAGKQTTDNESNQTGQMLAALMRWPQATF  142 (249)
Q Consensus       109 ~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~  142 (249)
                      ++|+|.+-  + -...+..+..++..+++|++..
T Consensus        84 ~~DvIh~~--~-~~~~~~~a~~~~~~~~ip~V~t  114 (374)
T cd03817          84 GPDIVHTH--T-PFSLGLLGLRVARKLGIPVVAT  114 (374)
T ss_pred             CCCEEEEC--C-HHHHHHHHHHHHHHCCCCEEEE
T ss_conf             99999987--8-2588999999999749959999


No 206
>cd02649 nuc_hydro_CeIAG nuc_hydro_CeIAG: Nucleoside hydrolases similar to the inosine-adenosine-guanosine-preferring nucleoside hydrolase from Caenorhabditis elegans.  Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the respective base. These enzymes vary in their substrate specificity. This group contains eukaryotic, bacterial and archeal proteins similar to the purine-preferring nucleoside hydrolase (IAG-NH) from C. elegans and the salivary purine nucleosidase from Aedes aegypti.  C. elegans IAG-NH exhibits a high affinity for the substrate analogue p-nitrophenylriboside (p-NPR).
Probab=25.36  E-value=49  Score=14.01  Aligned_cols=80  Identities=19%  Similarity=0.185  Sum_probs=42.0

Q ss_pred             ECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHH-HHHH----------HHHHHHCCCCCEEE----ECCC----CCCH
Q ss_conf             32601368999999998559985289999714101-5888----------88785077762376----3365----4788
Q gi|254780368|r   34 SMNPFDEIALEESLQLREKGIATEVIVVSIGSCKV-EEVL----------KNSLAMGADRGILI----ESNE----TLEP   94 (249)
Q Consensus        34 ~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~-~~~L----------r~alAmGaD~ai~i----~d~~----~~D~   94 (249)
                      ...+.+++|.+.-+++-.++ .++||.++.||-.- .-+|          ++-.-||-.  +..    ...+    ..||
T Consensus        96 ~~~~~~~~A~~~i~~~~~~~-p~eitiva~GPlTNlAlal~~~P~~~~~i~~iviMGGa--~~~~GN~tp~AEfNi~~DP  172 (306)
T cd02649          96 ELELQKEHAVDAIIRLVREY-PGEITLVALGPLTNLALAYRLDPSLPQKIKRLYIMGGN--REGVGNTTPAAEFNFHVDP  172 (306)
T ss_pred             CCCCCCCCHHHHHHHHHHHC-CCCEEEEECCCHHHHHHHHHHCHHHHHHCCEEEEEECC--CCCCCCCCCCCHHCCCCCH
T ss_conf             57778755999999999858-99779997676489999999796778537828998155--6678899856021336699


Q ss_pred             HHHHHHHHHHHHCCCCCEEEEEECCC
Q ss_conf             99999999986126864999961135
Q gi|254780368|r   95 LSIAKILREIVKKENPIIVIAGKQTT  120 (249)
Q Consensus        95 ~~~A~~La~~i~~~~~DLIl~G~~S~  120 (249)
                      .+...++.    ..+.++.++|-..+
T Consensus       173 eAA~iVf~----s~g~~itmv~LDvT  194 (306)
T cd02649         173 EAAHIVLN----SFGCPITIVPWETT  194 (306)
T ss_pred             HHHHHHHH----CCCCCEEEECCHHH
T ss_conf             99999984----78998799652443


No 207
>KOG2994 consensus
Probab=25.35  E-value=37  Score=14.79  Aligned_cols=33  Identities=27%  Similarity=0.250  Sum_probs=26.2

Q ss_pred             EEEEEECCCCCCCCCCHHHHHHHHHCCCCEECHHH
Q ss_conf             89998435565454698889988521661204989
Q gi|254780368|r  172 AVITVDLNLNEPRYISLPNIIKARKKRIEKKKATD  206 (249)
Q Consensus       172 avisv~~~~n~PR~psl~~im~A~kk~i~~~~~~d  206 (249)
                      .-+||+.++-.|  |||++|.+.-+..|+-+...+
T Consensus       149 LsFSV~~gvp~P--PSLkNIYkEl~~Di~df~~P~  181 (297)
T KOG2994         149 LSFSVQPGVPPP--PSLKNIYKELSSDIEDFVIPK  181 (297)
T ss_pred             EEEECCCCCCCC--CHHHHHHHHHHCCCCCCCCCC
T ss_conf             566058999989--249999999850146652579


No 208
>PRK13948 shikimate kinase; Provisional
Probab=25.15  E-value=50  Score=13.98  Aligned_cols=69  Identities=14%  Similarity=0.053  Sum_probs=37.9

Q ss_pred             CCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCC-EEE--EE-------EECCCCE-EEEEECCCEEEEEEC
Q ss_conf             649999611358886128999999857961332443343286-599--99-------8358967-999963988999843
Q gi|254780368|r  110 PIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDN-HAI--VT-------REVGHGT-MTMETPLPAVITVDL  178 (249)
Q Consensus       110 ~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~-~~~--v~-------r~~e~g~-e~v~~~lPavisv~~  178 (249)
                      .-++|.|-..+  +-..+|-.||..||||++--=..++-..+ ++.  ..       |+.|.-. ..+.-.-++|||...
T Consensus        11 ~~IvLIG~mGs--GKStiGk~LA~~l~~~fiD~D~~Ie~~~g~sI~eIF~~~GE~~FR~~E~~~l~~l~~~~~~VIStGG   88 (182)
T PRK13948         11 TFVALAGFMGT--GKSRIGWELSRALALHFVDTDKLITRVVGKSIPEVFAQEGEEYFRACEKEVVRRVTRLDYAVISLGG   88 (182)
T ss_pred             CCEEEECCCCC--CHHHHHHHHHHHHCCCEEECHHHHHHHHCCCHHHHHHHHCHHHHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             81898899999--8899999999996959888849999988939999999848999999999999999747996997588


Q ss_pred             CC
Q ss_conf             55
Q gi|254780368|r  179 NL  180 (249)
Q Consensus       179 ~~  180 (249)
                      |+
T Consensus        89 G~   90 (182)
T PRK13948         89 GT   90 (182)
T ss_pred             CE
T ss_conf             50


No 209
>pfam00342 PGI Phosphoglucose isomerase. Phosphoglucose isomerase catalyses the interconversion of glucose-6-phosphate and fructose-6-phosphate.
Probab=24.74  E-value=30  Score=15.36  Aligned_cols=47  Identities=15%  Similarity=0.351  Sum_probs=25.3

Q ss_pred             CEEEEEECCCHHHH-HHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHH
Q ss_conf             28999971410158-888878507776237633654788999999999
Q gi|254780368|r   57 EVIVVSIGSCKVEE-VLKNSLAMGADRGILIESNETLEPLSIAKILRE  103 (249)
Q Consensus        57 ~V~~lsvG~~~~~~-~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~  103 (249)
                      .|+.+.+|+..... .+-+||.--....+.+.--.+.||...+.+|+.
T Consensus        98 ~vV~IGIGGS~LGp~~~~~AL~~~~~~~~~~~FvsN~Dp~~~~~~l~~  145 (483)
T pfam00342        98 DVVNIGIGGSDLGPRMVIEALKHYSENALIVFFVSNVDGTHIAEVLKK  145 (483)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHC
T ss_conf             389956565007699999998653369822899568987899999960


No 210
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases. wbuB in E. coli is involved in the biosynthesis of the O26 O-antigen.  It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
Probab=24.67  E-value=51  Score=13.93  Aligned_cols=107  Identities=14%  Similarity=0.111  Sum_probs=52.4

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEE---CCCCCC-----------HHHHHHH
Q ss_conf             26013689999999985599852899997141015888887850777623763---365478-----------8999999
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIE---SNETLE-----------PLSIAKI  100 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~---d~~~~D-----------~~~~A~~  100 (249)
                      ++....+..+.|-.|.++  |-+|+++|-.+.............-..+++.+.   ......           .+.....
T Consensus        13 ~gG~~~~~~~la~~L~~~--Gh~V~v~t~~~~~~~~~~~~~~~~~~~~gi~v~r~~~~~~~~~~~~~~~~~~~~~~~~~~   90 (394)
T cd03794          13 LGGGAFRTTELAEELVKR--GHEVTVITGSPNYPSGKIYKGYKREEVDGVRVHRVPLPPYKKNGLLKRLLNYLSFALSAL   90 (394)
T ss_pred             CCCHHHHHHHHHHHHHHC--CCEEEEEECCCCCCCCCCCCCCCEEEECCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             982999999999999977--997999954787764323566644664885999933776677527889999999999999


Q ss_pred             HHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEE
Q ss_conf             999861268649999611358886128999999857961332443
Q gi|254780368|r  101 LREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSN  145 (249)
Q Consensus       101 La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~  145 (249)
                      +....+..+||+|++-  +.-...+..+..++...+.|.+..+.+
T Consensus        91 ~~~~~~~~~~Div~~~--~~~~~~~~~~~~~~~~~~~p~v~~~hd  133 (394)
T cd03794          91 LALLKRRRRPDVIIAT--SPPLLIALAALLLARLKGAPFVLEVRD  133 (394)
T ss_pred             HHHHHHCCCCCEEEEC--CCCHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             9999855899889991--784788999999998639969999687


No 211
>cd06404 PB1_aPKC PB1 domain is an essential modular domain of the atypical protein kinase C (aPKC) which in complex with Par6 and Par3  proteins is crucial for establishment of apical-basal polarity of animal cells. PB1 domain is a modular domain mediating specific protein-protein interaction which play roles in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi,
Probab=24.64  E-value=51  Score=13.92  Aligned_cols=34  Identities=24%  Similarity=0.356  Sum_probs=23.8

Q ss_pred             CEEEECCCCEECCCHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             816324877332601368999999998559985289
Q gi|254780368|r   24 SGIETENTKISMNPFDEIALEESLQLREKGIATEVI   59 (249)
Q Consensus        24 ~~i~~~~~~~~in~~D~~AlE~Al~lke~~~g~~V~   59 (249)
                      .++|.+|-|-.|+  ...-|+||+||-|.....+++
T Consensus        44 KWiDeEGDPctIS--Sq~EL~EA~RLye~n~ds~L~   77 (83)
T cd06404          44 KWIDEEGDPCTIS--SQMELEEAFRLYELNKDSELN   77 (83)
T ss_pred             EEECCCCCCEEEE--CHHHHHHHHHHHHHCCCCCEE
T ss_conf             9763789950653--588789999998715776479


No 212
>cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins. Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+. In L. lactis, DHOD B (encoded by pyrDa) is co-expressed with pyrK and both gene products are required for full activity, as well as NAD binding. NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal domain may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD (formi
Probab=24.59  E-value=51  Score=13.92  Aligned_cols=39  Identities=15%  Similarity=0.285  Sum_probs=16.8

Q ss_pred             CCCEEEECCCCCCHHHHHHHHHHHHHCCC-CCEEEEEECCCCC
Q ss_conf             76237633654788999999999861268-6499996113588
Q gi|254780368|r   81 DRGILIESNETLEPLSIAKILREIVKKEN-PIIVIAGKQTTDN  122 (249)
Q Consensus        81 D~ai~i~d~~~~D~~~~A~~La~~i~~~~-~DLIl~G~~S~D~  122 (249)
                      ++.++|..--+.-|   ...+++.+++.+ .-.++.|.++.+.
T Consensus        98 ~~~llVaGG~GiaP---l~~l~~~l~~~g~~v~~i~g~r~~~~  137 (243)
T cd06192          98 GTVLLVAGGIGLAP---LLPIAKKLAANGNKVTVLAGAKKAKE  137 (243)
T ss_pred             CEEEEEECCCCHHH---HHHHHHHHHHCCCCEEEEEEECCHHH
T ss_conf             76999956734165---99999999877996699999388899


No 213
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase; InterPro: IPR005982    Reactive oxygen species (ROS) are known mediators of intracellular signaling cascades. Excessive production of ROS may, however, lead to oxidative stress, loss of cell function, and ultimately apoptosis or necrosis. A balance between oxidant and antioxidant intracellular systems is hence vital for cell function, regulation, and adaptation to diverse growth conditions. Thioredoxin reductase in conjunction with thioredoxin is a ubiquitous oxidoreductase system with antioxidant and redox regulatory roles. Thioredoxin reductase (1.8.1.9 from EC) reduces oxidised thioredoxin in the presence of NADPH. Reduced thioredoxin serves as an electron donor for thioredoxin peroxidase which consequently reduces H_2O_2 to H_2O. In mammals, extracellular forms of Trx also have cytokine-like effects. Mammalian TrxR has a highly reactive active site selenocysteine residue resulting in a profound reductive capacity, reducing several substrates in addition to Trx .; GO: 0004791 thioredoxin-disulfide reductase activity, 0019430 removal of superoxide radicals, 0005737 cytoplasm.
Probab=24.45  E-value=51  Score=13.90  Aligned_cols=32  Identities=34%  Similarity=0.390  Sum_probs=12.7

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCC
Q ss_conf             2899997141015888887850777623763365
Q gi|254780368|r   57 EVIVVSIGSCKVEEVLKNSLAMGADRGILIESNE   90 (249)
Q Consensus        57 ~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~   90 (249)
                      +|.|+-=|....+++|  .|+.=+++.++|.-++
T Consensus       153 ~V~VvGGGdsA~eEA~--yL~~~a~kV~lvHRRd  184 (321)
T TIGR01292       153 EVAVVGGGDSALEEAL--YLTRIAKKVTLVHRRD  184 (321)
T ss_pred             EEEEECCCCHHHHHHH--HHHHCCCEEEEEECCC
T ss_conf             8999879824888889--9985387679997798


No 214
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase; InterPro: IPR010210   This entry represents a clade of primarily archaeal sequences related to fructose-bisphosphate aldolase. The members appear to be phospho-2-dehydro-3-deoxyheptonate aldolases. This enzyme is the first step of the chorismate biosynthesis pathway. Evidence for this assignment is based on gene clustering and phylogenetic profiling. A group of species lack members of the three other types of phospho-2-dehydro-3-deoxyheptonate aldolase (represented by IPR006219 from INTERPRO, IPR002480 from INTERPRO and IPR006268 from INTERPRO), and also apparently lack the well-known forms of step 2 (3-dehydroquinate synthase), but contain all other steps of the pathway: Aquifex, Archaeoglobus, Halobacterium, Methanococcus, Methanopyrus and Methanobacterium. In Aquifex, Archaeoglobus, Halobacterium, Methanopyrus and Methanosarcina the genes are clustered with other genes from the chorismate, phenylalanine, tyrosine and tryptophan biosynthesis pathways. In addition, these genes in Archaeoglobus, Halobacterium, and Methanosarcina are adjacent to 3-dehydroquinate synthase (IPR002812 from INTERPRO) which also has the property of having members only in those species which lack steps 1 and 2. Together these two genes appear to perform the synthesis of 3-dehydroquinate. It is presumed that the substrates and the chemical transformations involved are identical, but this has not yet been proven experimentally..
Probab=24.33  E-value=51  Score=13.89  Aligned_cols=125  Identities=15%  Similarity=0.174  Sum_probs=73.2

Q ss_pred             EECCCHHH----HHHHHHHHHCCCCC-EEEE--CCCCCCHHHHHHHHHHHHHCCC-CCEEEE-EECC-CC-CC-CEEHHH
Q ss_conf             97141015----88888785077762-3763--3654788999999999861268-649999-6113-58-88-612899
Q gi|254780368|r   62 SIGSCKVE----EVLKNSLAMGADRG-ILIE--SNETLEPLSIAKILREIVKKEN-PIIVIA-GKQT-TD-NE-SNQTGQ  129 (249)
Q Consensus        62 svG~~~~~----~~Lr~alAmGaD~a-i~i~--d~~~~D~~~~A~~La~~i~~~~-~DLIl~-G~~S-~D-~~-~g~v~~  129 (249)
                      |++|...+    .+..+|+.+|||-. |||.  ++..+|.+.-.-.+|+.+...| |=|=++ -+.+ +| .. +..|  
T Consensus        82 ~L~P~p~~K~~~~tVE~Ai~~GADAVS~HvNvGs~~e~d~~~~lg~vA~~ad~~GvPlLAMmYaRG~~i~~e~d~~~v--  159 (259)
T TIGR01949        82 SLSPDPNDKRIVTTVEDAIRLGADAVSIHVNVGSDTEADQIEDLGDVAEIADDWGVPLLAMMYARGPRIDDEVDPEVV--  159 (259)
T ss_pred             CCCCCCCCCEEEECHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCHHECCCCCCCCCCCCCCHHHH--
T ss_conf             258888787578514899732898679988648987389999998999988654884201127886887664476788--


Q ss_pred             HHHHHHCCCCEEEEEEEEECCCEEEEEEECCCCEEEE-EECCCEEEEEECCCCCCCCCCHHHHHHHHH
Q ss_conf             9999857961332443343286599998358967999-963988999843556545469888998852
Q gi|254780368|r  130 MLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTM-ETPLPAVITVDLNLNEPRYISLPNIIKARK  196 (249)
Q Consensus       130 ~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g~e~v-~~~lPavisv~~~~n~PR~psl~~im~A~k  196 (249)
                      .=|.+||.-.=..|.|..+.|+.       +.-.+.+ .|+.|.|+.=-+..+.-| =.|+.|.-|-.
T Consensus       160 ~HAaRlg~ElGADvvK~~Y~Gd~-------~SF~~VV~~c~~PVvvAGG~k~~s~~-efLq~v~DA~~  219 (259)
T TIGR01949       160 AHAARLGEELGADVVKVPYTGDI-------DSFEEVVKACAVPVVVAGGPKLASDR-EFLQMVKDAME  219 (259)
T ss_pred             HHHHHHHHHHCCCEEEECCCCCH-------HHHHHHHCCCCCCEEEECCCCCCCCH-HHHHHHHHHHH
T ss_conf             88876535345776651431774-------67999962178777873777988746-77788999998


No 215
>PRK12581 oxaloacetate decarboxylase; Provisional
Probab=24.18  E-value=52  Score=13.87  Aligned_cols=104  Identities=18%  Similarity=0.236  Sum_probs=51.6

Q ss_pred             ECCCHHHHHHHHHHHHHHCCCCCCE-EEEEE--CCCH----HHHHHHHHHHHCCCCCEEEECCCCC-CHHHHHHHHHHHH
Q ss_conf             3260136899999999855998528-99997--1410----1588888785077762376336547-8899999999986
Q gi|254780368|r   34 SMNPFDEIALEESLQLREKGIATEV-IVVSI--GSCK----VEEVLKNSLAMGADRGILIESNETL-EPLSIAKILREIV  105 (249)
Q Consensus        34 ~in~~D~~AlE~Al~lke~~~g~~V-~~lsv--G~~~----~~~~Lr~alAmGaD~ai~i~d~~~~-D~~~~A~~La~~i  105 (249)
                      .+|  |...++.+++...+. |.++ .+++.  .|..    .-+..|+...+|+|+ +.|.|-+|. .|..+...+ ..+
T Consensus       127 ~LN--d~~n~~~ai~~vk~~-G~~~~~~i~yt~sp~ht~~yy~~~ak~l~~~Gad~-I~iKDmaGlL~P~~a~~LV-~~l  201 (468)
T PRK12581        127 ALN--DPRNIQQALRAVKKT-GKEAQLCIAYTTSPVHTLNYYLSLVKELVEMGADS-ICIKDMAGILTPKAAKELV-SGI  201 (468)
T ss_pred             CCC--CHHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCHHHHHHHHHHHHHCCCCE-EEEECCCCCCCHHHHHHHH-HHH
T ss_conf             467--678999999999963-87489999966897554999999999999739998-9984787776889999999-999


Q ss_pred             HC--------------------------CCCCEEEEEECCCCCCCEE--HHHHHHHHHCCCCEEE
Q ss_conf             12--------------------------6864999961135888612--8999999857961332
Q gi|254780368|r  106 KK--------------------------ENPIIVIAGKQTTDNESNQ--TGQMLAALMRWPQATF  142 (249)
Q Consensus       106 ~~--------------------------~~~DLIl~G~~S~D~~~g~--v~~~lA~~Lg~p~vt~  142 (249)
                      |+                          .|.|+|=|...|.-+.++|  +..+++.+-+.++-+.
T Consensus       202 K~~~~iPI~~HtH~t~Gla~a~~laAieAGaDiVD~Ai~~~s~gtSqP~~~s~v~~l~~~~~~~~  266 (468)
T PRK12581        202 KAMTNLPLIVHTHATSGISQMTYLAAVEAGADRIDTALSPFSEGTSQPATESMYLALKEAGYDIT  266 (468)
T ss_pred             HHCCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCC
T ss_conf             83679865998258875499999999981999997446453579888669999999733898876


No 216
>PRK10161 transcriptional regulator PhoB; Provisional
Probab=23.82  E-value=53  Score=13.82  Aligned_cols=67  Identities=13%  Similarity=0.231  Sum_probs=37.7

Q ss_pred             CCCHHHHHHHHHHHHHHCCC--CCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHC
Q ss_conf             26013689999999985599--85289999714101588888785077762376336547889999999998612
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGI--ATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKK  107 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~--g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~  107 (249)
                      ++..|...++..-+|+++..  +.-|..+|.  ....+..-.+|..|||. |+.   .+.++...-.-+.+.+++
T Consensus        54 i~lP~~dG~~~~~~ir~~~~~~~~PII~lta--~~~~~d~v~gl~~GADD-Yl~---KPf~~~EL~aRi~a~lrR  122 (229)
T PRK10161         54 WMLPGGSGIQFIKHLKRESMTRDIPVVMLTA--RGEEEDRVRGLETGADD-YIT---KPFSPKELVARIKAVMRR  122 (229)
T ss_pred             CCCCCCCCHHHHHHHHHCCCCCCCCEEEEEC--CCCHHHHHHHHHCCCCE-EEE---CCCCHHHHHHHHHHHHHH
T ss_conf             8998876335878877502468975899955--66657799998769876-520---899989999999999712


No 217
>PRK00973 glucose-6-phosphate isomerase; Provisional
Probab=23.77  E-value=35  Score=14.92  Aligned_cols=72  Identities=25%  Similarity=0.252  Sum_probs=32.9

Q ss_pred             CEECCCHHHHHHHHHHHHHHCCC-CCCEEEEEECCCHHH-HHHHHHHH--------HCCCCCEEEECCCCCCHHHHHHHH
Q ss_conf             73326013689999999985599-852899997141015-88888785--------077762376336547889999999
Q gi|254780368|r   32 KISMNPFDEIALEESLQLREKGI-ATEVIVVSIGSCKVE-EVLKNSLA--------MGADRGILIESNETLEPLSIAKIL  101 (249)
Q Consensus        32 ~~~in~~D~~AlE~Al~lke~~~-g~~V~~lsvG~~~~~-~~Lr~alA--------mGaD~ai~i~d~~~~D~~~~A~~L  101 (249)
                      .|.==|||.--++.-..+++... -..|+++.+|+.... .++-+||.        .-......+.--.+.||..++.+|
T Consensus        48 g~~~lp~~~~~~~~~~~~~~~~k~~~~vV~IGIGGS~LG~~a~~~aL~~~~~n~~~~~~~~~~~i~f~~NvDp~~l~~~l  127 (454)
T PRK00973         48 GFLDVIFDRSWLDSYLELKEWIKNFENVVVLGIGGSALGNLALHTALLPLNYNELSKEERNGYRIFVLDNVDPEKTASIL  127 (454)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHHCCCCCCHHCCCCCEEEEEECCCHHHHHHHH
T ss_conf             74258897679999999999747898799954353678999999995001123100111689759998089989999999


Q ss_pred             HH
Q ss_conf             99
Q gi|254780368|r  102 RE  103 (249)
Q Consensus       102 a~  103 (249)
                      ..
T Consensus       128 ~~  129 (454)
T PRK00973        128 DV  129 (454)
T ss_pred             HH
T ss_conf             74


No 218
>PRK10834 hypothetical protein; Provisional
Probab=23.71  E-value=53  Score=13.81  Aligned_cols=104  Identities=13%  Similarity=0.194  Sum_probs=67.4

Q ss_pred             ECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCC-----HHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCC
Q ss_conf             326013689999999985599852899997141-----015888887850777623763365478899999999986126
Q gi|254780368|r   34 SMNPFDEIALEESLQLREKGIATEVIVVSIGSC-----KVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKE  108 (249)
Q Consensus        34 ~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~-----~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~~  108 (249)
                      ..|+|=.+=|+.|++|-+++ -.+...+|-...     +....-+..+++|...-..+.|.+|.+|+..-.--.+.....
T Consensus        61 ~pn~~~~~RldaA~~LY~~G-Kv~~iLvSGDn~~~~YnEp~~Mk~~Li~~GVP~e~I~~D~AGfrT~DS~vRAk~VF~~~  139 (239)
T PRK10834         61 VINQYYRYRIQGAINAYNSG-KVNYLLLSGDNALQSYNEPMTMRKDLIAAGVDPADIVLDYAGFRTLDSIVRTRKVFDTN  139 (239)
T ss_pred             CCCHHHHHHHHHHHHHHHCC-CCCEEEECCCCCCCCCCCHHHHHHHHHHCCCCHHHEECCCCCCCHHHHHHHHHHHHCCC
T ss_conf             81989999999999999869-97489866899988898289999999985998999505667654899999999980998


Q ss_pred             CCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEE
Q ss_conf             864999961135888612899999985796133244
Q gi|254780368|r  109 NPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVS  144 (249)
Q Consensus       109 ~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~  144 (249)
                      .+ +|++    . ..+-.=.-.+|..+|+-.+.+..
T Consensus       140 ~~-iIVT----Q-~FH~~RAlfiAr~~GidA~g~~a  169 (239)
T PRK10834        140 DF-IIIT----Q-RFHCERALFIALHMGIQAQCYAV  169 (239)
T ss_pred             CE-EEEE----C-CHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             28-9994----6-01389999999974983699716


No 219
>PRK09483 response regulator; Provisional
Probab=23.71  E-value=53  Score=13.81  Aligned_cols=49  Identities=18%  Similarity=0.228  Sum_probs=28.1

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEE
Q ss_conf             2601368999999998559985289999714101588888785077762376
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILI   86 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i   86 (249)
                      ++..|...+|..-+++..+....|.++|.-.  .....+.++..||+ +|+.
T Consensus        55 l~lp~~~Gl~~~~~i~~~~p~~~vivls~~~--~~~~~~~al~~Ga~-gyl~  103 (216)
T PRK09483         55 MNMPGIGGLEATRKILRSTPDVKIIMLTVHT--ENPLPAKVMQAGAA-GYLS  103 (216)
T ss_pred             CCCCCCCCHHHHHHHHHHCCCCCEEEECCCC--CHHHHHHHHHCCCC-EEEE
T ss_conf             8898987523778887408998578630566--32889999974887-8994


No 220
>COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane]
Probab=23.52  E-value=53  Score=13.79  Aligned_cols=31  Identities=19%  Similarity=0.088  Sum_probs=14.6

Q ss_pred             HHHHHHC---CCCEEEEEEEE-----ECCCEEEEEEECC
Q ss_conf             9999857---96133244334-----3286599998358
Q gi|254780368|r  130 MLAALMR---WPQATFVSNIK-----IIDNHAIVTREVG  160 (249)
Q Consensus       130 ~lA~~Lg---~p~vt~v~~i~-----~~~~~~~v~r~~e  160 (249)
                      .+++.|.   ...+|.+.++.     ...+.+.+....+
T Consensus       112 ~~~~~L~~~~~~~aTl~~~i~~~ee~~nPN~VKvV~d~~  150 (247)
T COG1212         112 AVAENLENSNADMATLAVKITDEEEAFNPNVVKVVLDKE  150 (247)
T ss_pred             HHHHHHHHCCCCEEEEEEECCCHHHHCCCCCEEEEECCC
T ss_conf             999998737766045534337888845998279997599


No 221
>PRK10403 transcriptional regulator NarP; Provisional
Probab=23.52  E-value=53  Score=13.79  Aligned_cols=41  Identities=20%  Similarity=0.392  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCC
Q ss_conf             3689999999985599852899997141015888887850777
Q gi|254780368|r   39 DEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGAD   81 (249)
Q Consensus        39 D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD   81 (249)
                      |.+.++..-+|++.+....|.++|.-  ...+.++.++..||+
T Consensus        64 ~~~G~~~~~~l~~~~p~~~iivlt~~--~~~~~~~~al~~Ga~  104 (215)
T PRK10403         64 GMSGLDTLNALRRDGVTAQIIILTVS--DASSDIFALIDAGAD  104 (215)
T ss_pred             CCCCCCHHHHHHHCCCCCCEEEEECC--CCHHHHHHHHHCCCC
T ss_conf             99874123356541887736886324--323678998746876


No 222
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]
Probab=23.49  E-value=53  Score=13.78  Aligned_cols=25  Identities=16%  Similarity=0.127  Sum_probs=9.4

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             4788999999999861268649999
Q gi|254780368|r   91 TLEPLSIAKILREIVKKENPIIVIA  115 (249)
Q Consensus        91 ~~D~~~~A~~La~~i~~~~~DLIl~  115 (249)
                      |+||.++++---+..+..++|+|||
T Consensus       203 G~DpAaVafDAi~~Akar~~Dvvli  227 (340)
T COG0552         203 GADPAAVAFDAIQAAKARGIDVVLI  227 (340)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEE
T ss_conf             9980899999999999769999999


No 223
>PRK09935 transcriptional regulator FimZ; Provisional
Probab=23.48  E-value=53  Score=13.78  Aligned_cols=46  Identities=11%  Similarity=0.031  Sum_probs=24.3

Q ss_pred             HHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEE
Q ss_conf             1368999999998559985289999714101588888785077762376
Q gi|254780368|r   38 FDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILI   86 (249)
Q Consensus        38 ~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i   86 (249)
                      .|...++..-+++..+.+..|.++|.-.  ....++.++..||+- |+.
T Consensus        60 p~~~g~~~i~~i~~~~p~~~ilvls~~~--~~~~~~~a~~~Ga~g-~l~  105 (210)
T PRK09935         60 PGTDGFTLLKRIKQIQETVKVLFLSSKS--ECFYAGRAIRAGANG-FVS  105 (210)
T ss_pred             CCCCCCCHHHHHHHHCCCCCEEEEECCC--CHHHHHHHHHCCCCE-EEE
T ss_conf             9988640567898738997089971767--299999999668776-886


No 224
>PRK07133 DNA polymerase III subunits gamma and tau; Validated
Probab=23.35  E-value=54  Score=13.77  Aligned_cols=46  Identities=24%  Similarity=0.276  Sum_probs=39.0

Q ss_pred             EECCCHHHHHHHHHHHHCC-CCCEEEECCCCCCHHHHHHHHHHHHHC
Q ss_conf             9714101588888785077-762376336547889999999998612
Q gi|254780368|r   62 SIGSCKVEEVLKNSLAMGA-DRGILIESNETLEPLSIAKILREIVKK  107 (249)
Q Consensus        62 svG~~~~~~~Lr~alAmGa-D~ai~i~d~~~~D~~~~A~~La~~i~~  107 (249)
                      -+|......+|+.++..|= ..|++.....|..-..+|+++|.++.-
T Consensus        20 VIGQe~Vv~tL~nAI~~gRIaHAYLF~GPRGvGKTT~ARIfAKaLNC   66 (718)
T PRK07133         20 IKGQDHIIETLKNIIKSGKISHAYLFSGPHGTGKTSVAKIFANALNC   66 (718)
T ss_pred             HCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC
T ss_conf             22859999999999974997505862389986889999999999679


No 225
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase. In a number of bacteria, including Oxalobacter formigenes from the human gut, a two-gene operon of oxc (oxalyl-CoA decarboxylase) and frc (formyl-CoA transferase) encodes a system for degrading and therefore detoxifying oxalate. Members of this family are the thiamine pyrophosphate (TPP)-containing enzyme oxalyl-CoA decarboxylase.
Probab=23.32  E-value=54  Score=13.76  Aligned_cols=52  Identities=13%  Similarity=0.215  Sum_probs=34.6

Q ss_pred             CHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEE
Q ss_conf             88999999999861268649999611358886128999999857961332443
Q gi|254780368|r   93 EPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSN  145 (249)
Q Consensus        93 D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~  145 (249)
                      ++-.+.++ ++.+++-.-=+|++|......+...-=-.+|+.+|+|.++....
T Consensus       192 ~~~~i~~a-~~~L~~AkrPvIi~G~g~~~~~a~~~l~~lae~~~iPv~tt~~g  243 (554)
T TIGR03254       192 SPDSVDRA-VELLKDAKRPLILLGKGAAYAQADEEIREFVEKTGIPFLPMSMA  243 (554)
T ss_pred             CHHHHHHH-HHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCEEEECCC
T ss_conf             99999999-99998279968996886214448999999999729838962454


No 226
>PRK12338 hypothetical protein; Provisional
Probab=23.29  E-value=54  Score=13.76  Aligned_cols=12  Identities=33%  Similarity=0.595  Sum_probs=7.4

Q ss_pred             CHHHHHHHHHHH
Q ss_conf             999999999986
Q gi|254780368|r  234 STTKLIEILKSK  245 (249)
Q Consensus       234 ~~~eLv~~L~~e  245 (249)
                      .+++.++.|.++
T Consensus       259 e~d~Fik~ln~~  270 (320)
T PRK12338        259 EADKFIKILNEE  270 (320)
T ss_pred             HHHHHHHHHHCC
T ss_conf             899999998308


No 227
>cd06315 PBP1_ABC_sugar_binding_like_6 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=23.13  E-value=54  Score=13.74  Aligned_cols=30  Identities=23%  Similarity=0.327  Sum_probs=14.4

Q ss_pred             ECCCHHHHHHHHHHHHHHCCCCCCEEEEEEC
Q ss_conf             3260136899999999855998528999971
Q gi|254780368|r   34 SMNPFDEIALEESLQLREKGIATEVIVVSIG   64 (249)
Q Consensus        34 ~in~~D~~AlE~Al~lke~~~g~~V~~lsvG   64 (249)
                      ++|++|..++..+++...+ .|-.|+....+
T Consensus        61 ii~~~D~~~~~~~l~~A~~-agIPvv~~~~~   90 (280)
T cd06315          61 VLGGVDAAELQAELELAQK-AGIPVVGWHAG   90 (280)
T ss_pred             EECCCCHHHHHHHHHHHHH-CCCCEEEECCC
T ss_conf             9998297887899999998-79978962477


No 228
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional
Probab=23.08  E-value=54  Score=13.73  Aligned_cols=67  Identities=13%  Similarity=0.198  Sum_probs=39.5

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHC
Q ss_conf             2601368999999998559985289999714101588888785077762376336547889999999998612
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKK  107 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~  107 (249)
                      ++..|.+.++.+-+|++.....-|..+|-  ....+..-.|+.+|||. |+.   .+.+.-..-..+.+.+++
T Consensus        52 ~~lp~~~G~~l~~~ir~~~~~~piI~lta--~~~~~~~~~al~~Gadd-yl~---KP~~~~eL~arv~~~lrr  118 (223)
T PRK10816         52 LGLPDEDGLSLIRRWRSNDVSLPILVLTA--RESWQDKVEVLSAGADD-YVT---KPFHIEEVMARMQALMRR  118 (223)
T ss_pred             CCCCCCCCCCCCCCHHCCCCCCCEEEEEC--CCCHHHHHHHHHCCCCE-EEC---CCCCHHHHHHHHHHHHCC
T ss_conf             99989886400120110489876899944--45677899999869988-641---897778999999999665


No 229
>COG4034 Uncharacterized protein conserved in archaea [Function unknown]
Probab=23.02  E-value=54  Score=13.72  Aligned_cols=75  Identities=15%  Similarity=0.199  Sum_probs=31.9

Q ss_pred             CCHHHHHHHHHHHHHHCCCCCCEE---EEEECCCHHHHHHHH-HHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             601368999999998559985289---999714101588888-7850777623763365478899999999986126864
Q gi|254780368|r   36 NPFDEIALEESLQLREKGIATEVI---VVSIGSCKVEEVLKN-SLAMGADRGILIESNETLEPLSIAKILREIVKKENPI  111 (249)
Q Consensus        36 n~~D~~AlE~Al~lke~~~g~~V~---~lsvG~~~~~~~Lr~-alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~~~~D  111 (249)
                      .|--.-.++.-+++.|.. + -+.   -.-=|.......++. +-+||- +++.+.-..+  ...++..|.+.+++.+.|
T Consensus        59 GP~p~~~i~g~~~i~e~~-~-i~~~~t~~~rg~~~~~pqi~raaralg~-e~v~v~~~~g--v~gl~e~lk~lv~~~~id  133 (328)
T COG4034          59 GPRPPDEIRGVVRINEGL-Y-IANGRTRAERGGRRVKPQIVRAARALGK-EAVAVDLVDG--VRGLAEGLKALVEKEGID  133 (328)
T ss_pred             CCCCHHHHHHHHHHCCCC-E-EECCCCHHHCCCCEECHHHHHHHHHHCC-EEEEEECCCC--CCCHHHHHHHHHHHHCCC
T ss_conf             998958961041121450-4-5056210102782531889999998096-1699962577--311889999999861855


Q ss_pred             EEEE
Q ss_conf             9999
Q gi|254780368|r  112 IVIA  115 (249)
Q Consensus       112 LIl~  115 (249)
                      +|+.
T Consensus       134 ~Ivg  137 (328)
T COG4034         134 LIVG  137 (328)
T ss_pred             EEEE
T ss_conf             7999


No 230
>PRK08617 acetolactate synthase; Reviewed
Probab=22.77  E-value=55  Score=13.69  Aligned_cols=51  Identities=20%  Similarity=0.274  Sum_probs=31.5

Q ss_pred             CHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEE
Q ss_conf             8899999999986126864999961135888612899999985796133244
Q gi|254780368|r   93 EPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVS  144 (249)
Q Consensus        93 D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~  144 (249)
                      ++..+.+ +++.+++-.-=+|++|......+...--..+|+.||+|.++...
T Consensus       187 ~~~~i~~-a~~~L~~AkrPvii~G~g~~~~~~~~~l~~lae~~~iPv~tt~~  237 (552)
T PRK08617        187 SPEDINY-LAELIKNAKLPVLLLGMRASDPEVTAAIRRLLERTNLPVVETFQ  237 (552)
T ss_pred             CHHHHHH-HHHHHHHCCCCEEEECHHHCCHHHHHHHHHHHHHHCCCEEECCC
T ss_conf             9999999-99999846587488322233364999999988874984884467


No 231
>KOG0092 consensus
Probab=22.63  E-value=55  Score=13.68  Aligned_cols=87  Identities=17%  Similarity=0.250  Sum_probs=51.0

Q ss_pred             CEECCCHHHH---HHHHHHHHHHCCCCCC-EEE---EEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHH
Q ss_conf             7332601368---9999999985599852-899---99714101588888785077762376336547889999999998
Q gi|254780368|r   32 KISMNPFDEI---ALEESLQLREKGIATE-VIV---VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREI  104 (249)
Q Consensus        32 ~~~in~~D~~---AlE~Al~lke~~~g~~-V~~---lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~  104 (249)
                      +++-|.|+++   -++.|-..+--..+.. |.-   =|.|.++ -..|-.-+-+||+-|+++.|-...+++..|+---.-
T Consensus        24 Rfvk~~F~e~~e~TIGaaF~tktv~~~~~~ikfeIWDTAGQER-y~slapMYyRgA~AAivvYDit~~~SF~~aK~Wvke  102 (200)
T KOG0092          24 RFVKDQFHENIEPTIGAAFLTKTVTVDDNTIKFEIWDTAGQER-YHSLAPMYYRGANAAIVVYDITDEESFEKAKNWVKE  102 (200)
T ss_pred             HHHHCCCCCCCCCCCCEEEEEEEEEECCCEEEEEEEECCCCCC-CCCCCCCEECCCCEEEEEEECCCHHHHHHHHHHHHH
T ss_conf             2232756632345400078999998489578999987677300-335561010477679999855667899999999999


Q ss_pred             HHC-CCCCEEE--EEECC
Q ss_conf             612-6864999--96113
Q gi|254780368|r  105 VKK-ENPIIVI--AGKQT  119 (249)
Q Consensus       105 i~~-~~~DLIl--~G~~S  119 (249)
                      ++. ..+++|+  +|..+
T Consensus       103 L~~~~~~~~vialvGNK~  120 (200)
T KOG0092         103 LQRQASPNIVIALVGNKA  120 (200)
T ss_pred             HHHHCCCCEEEEEECCHH
T ss_conf             986279875999832516


No 232
>PRK00179 pgi glucose-6-phosphate isomerase; Reviewed
Probab=22.57  E-value=46  Score=14.21  Aligned_cols=46  Identities=20%  Similarity=0.329  Sum_probs=16.2

Q ss_pred             EEEEEECCCHHH-HHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHH
Q ss_conf             899997141015-8888878507776237633654788999999999
Q gi|254780368|r   58 VIVVSIGSCKVE-EVLKNSLAMGADRGILIESNETLEPLSIAKILRE  103 (249)
Q Consensus        58 V~~lsvG~~~~~-~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~  103 (249)
                      |+.+.+|+.... ..+-+||.--.+..+.+.--.+.|+...+.+|..
T Consensus       133 VV~IGIGGS~LGp~~~~~AL~~~~~~~~~i~FvsNvD~~~l~~~l~~  179 (525)
T PRK00179        133 VVNIGIGGSDLGPRAVIEALRPYFDNLLRVHFVSNVDPTYIAEVLKK  179 (525)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHH
T ss_conf             89966566017699999999864669841799678886899999972


No 233
>PRK10768 ribonucleoside hydrolase RihC; Provisional
Probab=22.54  E-value=56  Score=13.66  Aligned_cols=81  Identities=23%  Similarity=0.354  Sum_probs=50.1

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHH-----------HHHHHHHHHHCCCCCE-EEECC-C---CCCHHHHH
Q ss_conf             2601368999999998559985289999714101-----------5888887850777623-76336-5---47889999
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIATEVIVVSIGSCKV-----------EEVLKNSLAMGADRGI-LIESN-E---TLEPLSIA   98 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~-----------~~~Lr~alAmGaD~ai-~i~d~-~---~~D~~~~A   98 (249)
                      -.+.+++|++.-.++-.++ .++||.+++||-.-           .+.+++-.-||-.-.. -+... +   ..||.+..
T Consensus        96 ~~~~~~~A~~~i~~~~~~~-~~~itiva~GPLTNiA~al~~~P~~~~~i~~iviMGGa~~~GN~tp~AEfN~~~DPeAA~  174 (304)
T PRK10768         96 RKPLSKPAVEAMRDALMAA-PEPVTLVAIGPLTNIALLLSQYPEVKPNIRRLVLMGGSAGRGNMTPNAEFNIAVDPEAAA  174 (304)
T ss_pred             CCCCCCCHHHHHHHHHHHC-CCCEEEEECCCHHHHHHHHHHCHHHHHHCCEEEEECCCCCCCCCCCHHHHCCCCCHHHHH
T ss_conf             7778867999999999868-996799966761699999997978886437799944634689998413308766979999


Q ss_pred             HHHHHHHHCCCCCEEEEEECCCC
Q ss_conf             99999861268649999611358
Q gi|254780368|r   99 KILREIVKKENPIIVIAGKQTTD  121 (249)
Q Consensus        99 ~~La~~i~~~~~DLIl~G~~S~D  121 (249)
                      .++.+     +..++++|...+-
T Consensus       175 iVl~s-----g~~i~~vpLDvT~  192 (304)
T PRK10768        175 IVFRS-----GLEIVMCGLDVTN  192 (304)
T ss_pred             HHHHC-----CCCEEEECCCCCC
T ss_conf             99838-----9987992133101


No 234
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional
Probab=22.43  E-value=56  Score=13.65  Aligned_cols=101  Identities=11%  Similarity=0.003  Sum_probs=41.6

Q ss_pred             HHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCC--CCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCC
Q ss_conf             999985599852899997141015888887850777623763365--478899999999986126864999961135888
Q gi|254780368|r   46 SLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNE--TLEPLSIAKILREIVKKENPIIVIAGKQTTDNE  123 (249)
Q Consensus        46 Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~--~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~  123 (249)
                      +-.|||.  |.+|+++.-+....---|.+-+.--.|+.+..+||.  +.-.+.| ..|...+++..+|+|+.---..   
T Consensus       118 akaLke~--GN~V~~IiGaR~kdlvilede~~~~sdel~i~TDDGS~G~kG~VT-d~L~elle~~k~D~V~aIGP~~---  191 (993)
T PRK12775        118 LRAFKEA--GARTTAIMGFRNKDLVFWEDKFREYADDLIICTDDGSYGEPGFVT-AALKRVCEKQKPDKVVAIGPMP---  191 (993)
T ss_pred             HHHHHHC--CCEEEEEEECCCCCCEEHHHHHHHHCCCEEEECCCCCCCCCCEEH-HHHHHHHHCCCCCEEEEECCHH---
T ss_conf             9999985--990899984266002334999986468389976899987564206-9999998668988899989889---


Q ss_pred             CEEHHHHHHHHHCCCCEEEEEEEEECCCE
Q ss_conf             61289999998579613324433432865
Q gi|254780368|r  124 SNQTGQMLAALMRWPQATFVSNIKIIDNH  152 (249)
Q Consensus       124 ~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~  152 (249)
                      .=..-..+..-+|+|.+-....+=+|+..
T Consensus       192 MMK~vs~~Tk~ygIpT~VSLNpIMVDGTG  220 (993)
T PRK12775        192 MMHACVETTRPFGVKTMVSLNTIMVDGTG  220 (993)
T ss_pred             HHHHHHHHHCCCCCCEEEECCCEEECCCC
T ss_conf             99999987252599758963574475687


No 235
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism]
Probab=22.33  E-value=56  Score=13.64  Aligned_cols=28  Identities=25%  Similarity=0.321  Sum_probs=16.2

Q ss_pred             CEEEEEECCCCCCCEEHHHHHHHHHCCCCE
Q ss_conf             499996113588861289999998579613
Q gi|254780368|r  111 IIVIAGKQTTDNESNQTGQMLAALMRWPQA  140 (249)
Q Consensus       111 DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~v  140 (249)
                      -+||+|-..+  +-..+|-+||..|++|++
T Consensus         4 ~IvLiG~mGa--GKSTIGr~LAk~L~~~F~   31 (172)
T COG0703           4 NIVLIGFMGA--GKSTIGRALAKALNLPFI   31 (172)
T ss_pred             CEEEECCCCC--CHHHHHHHHHHHCCCCCC
T ss_conf             1899717999--776899999998199802


No 236
>PRK04182 cytidylate kinase; Provisional
Probab=22.32  E-value=56  Score=13.64  Aligned_cols=17  Identities=12%  Similarity=0.173  Sum_probs=8.5

Q ss_pred             CEEHHHHHHHHHCCCCE
Q ss_conf             61289999998579613
Q gi|254780368|r  124 SNQTGQMLAALMRWPQA  140 (249)
Q Consensus       124 ~g~v~~~lA~~Lg~p~v  140 (249)
                      ...++-+||+.|||+++
T Consensus        13 k~tIak~LA~~lg~~~~   29 (178)
T PRK04182         13 KTTVARLLAEKLGLKLV   29 (178)
T ss_pred             HHHHHHHHHHHHCCEEE
T ss_conf             79999999999599387


No 237
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]
Probab=22.31  E-value=56  Score=13.63  Aligned_cols=66  Identities=23%  Similarity=0.320  Sum_probs=43.3

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             260136899999999855998528999971410158888878507776237633654788999999999861
Q gi|254780368|r   35 MNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVK  106 (249)
Q Consensus        35 in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~  106 (249)
                      ++-.+...+|..-+|++.+...+|.++|+-  .....++.++..||+- |+..+   .++-....++..+..
T Consensus        54 l~mP~~~G~e~~~~l~~~~p~~~vvvlt~~--~~~~~v~~~l~~Ga~g-yl~K~---~~~~~l~~ai~~v~~  119 (211)
T COG2197          54 LSMPGMDGLEALKQLRARGPDIKVVVLTAH--DDPAYVIRALRAGADG-YLLKD---ASPEELVEAIRAVAA  119 (211)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCEEEEEECC--CCHHHHHHHHHCCCCE-EEECC---CCHHHHHHHHHHHHC
T ss_conf             788998759999999986899729999677--8989999999779969-98679---999999999999975


No 238
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase. Members of this protein family are sulfoacetaldehyde acetyltransferase, an enzyme of taurine utilization. Taurine, or 2-aminoethanesulfonate, can be used by bacteria as a source of carbon, nitrogen, and sulfur.
Probab=21.77  E-value=58  Score=13.56  Aligned_cols=52  Identities=13%  Similarity=0.125  Sum_probs=33.1

Q ss_pred             CCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEE
Q ss_conf             78899999999986126864999961135888612899999985796133244
Q gi|254780368|r   92 LEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVS  144 (249)
Q Consensus        92 ~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~  144 (249)
                      .|+..+.++. +.+++-.-=+|++|....-.+...---.+||.||+|.++...
T Consensus       181 ~~~~~i~~a~-~~L~~A~rPvIi~G~gv~~~~a~~~l~~Lae~lg~PV~tt~~  232 (579)
T TIGR03457       181 GGATSLAQAA-RLLAEAKFPVIISGGGVVMGDAVEECKALAERLGAPVVNSYL  232 (579)
T ss_pred             CCHHHHHHHH-HHHHCCCCCEEEECCCCCCCCHHHHHHHHHHHHCCCCEECCC
T ss_conf             9999999999-999648996899797424432699999999973977011544


No 239
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit. This enzyme, together with CofG, complete the biosynthesis of 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, the chromophore of coenzyme F420. The chromophore is also used in cyanobacteria DNA photolyases.
Probab=21.46  E-value=58  Score=13.52  Aligned_cols=16  Identities=13%  Similarity=0.069  Sum_probs=10.1

Q ss_pred             HHHHHHHCCCCEEEEE
Q ss_conf             9999985796133244
Q gi|254780368|r  129 QMLAALMRWPQATFVS  144 (249)
Q Consensus       129 ~~lA~~Lg~p~vt~v~  144 (249)
                      -..|..||+|.-+...
T Consensus       185 ~~~Ah~lGi~ttatml  200 (343)
T TIGR03551       185 IKTAHKLGIPTTATIM  200 (343)
T ss_pred             HHHHHHCCCCCCCCEE
T ss_conf             9999985997202234


No 240
>KOG1712 consensus
Probab=21.42  E-value=59  Score=13.52  Aligned_cols=86  Identities=15%  Similarity=0.157  Sum_probs=59.0

Q ss_pred             CCEEEECCC--CCCHHHHHHHHHHH---HHC---CCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEE
Q ss_conf             623763365--47889999999998---612---6864999961135888612899999985796133244334328659
Q gi|254780368|r   82 RGILIESNE--TLEPLSIAKILREI---VKK---ENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHA  153 (249)
Q Consensus        82 ~ai~i~d~~--~~D~~~~A~~La~~---i~~---~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~  153 (249)
                      ++|...|--  -.||.+.-+.+.-.   ++.   .+.|.| .|-+|   ..-..||.+|-.||.+|+.-=..=.+-|..+
T Consensus        24 ~GI~F~Di~pll~dP~af~~lidlf~~h~~~~~~~~Id~i-aGlEa---RGFLFGP~iAlalG~~fVPiRK~gKLPG~~i   99 (183)
T KOG1712          24 KGIMFQDITPLLLDPKAFKKLIDLFVDHYRETFEMKIDVI-AGLEA---RGFLFGPSIALALGAGFVPIRKPGKLPGEVI   99 (183)
T ss_pred             CCEEHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCEEE-EEEEE---CCEECCCHHHHHHCCCEEECCCCCCCCCCEE
T ss_conf             8600200066643979999999999999998736761299-85410---4400283899983897566146898987546


Q ss_pred             EEEEECCCCEEEEEECCC
Q ss_conf             999835896799996398
Q gi|254780368|r  154 IVTREVGHGTMTMETPLP  171 (249)
Q Consensus       154 ~v~r~~e~g~e~v~~~lP  171 (249)
                      .++-+.|.|..++|+.--
T Consensus       100 ~~~Y~lEYg~d~~Emq~~  117 (183)
T KOG1712         100 SESYELEYGEDRFEMQKG  117 (183)
T ss_pred             EEEEEEECCCCCEEEECC
T ss_conf             778765027001121124


No 241
>COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription]
Probab=21.38  E-value=59  Score=13.51  Aligned_cols=65  Identities=23%  Similarity=0.356  Sum_probs=45.4

Q ss_pred             HHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCE
Q ss_conf             785077762376336547889999999998612686499996113588861289999998579613324433432865
Q gi|254780368|r   75 SLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNH  152 (249)
Q Consensus        75 alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~  152 (249)
                      .+.+|.|+-.++-||+.    ..++.|+.++++.||+...++.         +...++..--.|..-.|.++.+.+|+
T Consensus         3 ~~~~~pd~~lllvdDD~----~f~~~LaRa~e~RGf~v~~a~~---------~~eal~~art~~PayAvvDlkL~~gs   67 (182)
T COG4567           3 LMMIGPDKSLLLVDDDT----PFLRTLARAMERRGFAVVTAES---------VEEALAAARTAPPAYAVVDLKLGDGS   67 (182)
T ss_pred             CCCCCCCCEEEEECCCH----HHHHHHHHHHHCCCCEEEEECC---------HHHHHHHHHCCCCCEEEEEEEECCCC
T ss_conf             21148876058961876----9999999998606862576144---------99999998517985288986406887


No 242
>cd04106 Rab23_lke Rab23-like subfamily.  Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina.  Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system.  GTPase activating proteins (GAPs) interact with G
Probab=21.24  E-value=59  Score=13.50  Aligned_cols=75  Identities=17%  Similarity=0.191  Sum_probs=48.7

Q ss_pred             CHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCC--CCCEEEEEECCCCCCCE----EHHHHHHHHHCCCC
Q ss_conf             1015888887850777623763365478899999999986126--86499996113588861----28999999857961
Q gi|254780368|r   66 CKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKE--NPIIVIAGKQTTDNESN----QTGQMLAALMRWPQ  139 (249)
Q Consensus        66 ~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~~--~~DLIl~G~~S~D~~~g----~v~~~lA~~Lg~p~  139 (249)
                      .+.-..++...-.++|-++++.|-...+++....-.-.-++..  ..-+||+|..+--.+..    +-+-.+|..+|+|+
T Consensus        61 ~e~~~~l~~~~~~~a~~~ilvydvt~~~Sf~~l~~w~~~~~~~~~~~piilVgNK~DL~~~r~V~~~e~~~~a~~~~~~~  140 (162)
T cd04106          61 QEEFDAITKAYYRGAQACILVFSTTDRESFEAIESWKEKVEAECGDIPMVLVQTKIDLLDQAVITNEEAEALAKRLQLPL  140 (162)
T ss_pred             CCCCCCCHHHHHHHHCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCHHHHHHHHHHCCCEE
T ss_conf             70134152456123031268840698899999999999999766996299984054441017789999999999869879


Q ss_pred             E
Q ss_conf             3
Q gi|254780368|r  140 A  140 (249)
Q Consensus       140 v  140 (249)
                      .
T Consensus       141 ~  141 (162)
T cd04106         141 F  141 (162)
T ss_pred             E
T ss_conf             9


No 243
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family. A family of closely related, thiamine pyrophosphate-dependent enzymes includes indolepyruvate decarboxylase (EC 4.1.1.74), phenylpyruvate decarboxylase (EC 4.1.1.43), pyruvate decarboxylase (EC 4.1.1.1), branched-chain alpha-ketoacid decarboxylase, etc.. Members of this group of homologs may overlap in specificity. This model represents a clade that includes a Azospirillum brasilense member active as both phenylpyruvate decarboxylase and indolepyruvate decarboxylase.
Probab=21.22  E-value=59  Score=13.49  Aligned_cols=47  Identities=9%  Similarity=0.019  Sum_probs=32.2

Q ss_pred             HHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEE
Q ss_conf             99999861268649999611358886128999999857961332443
Q gi|254780368|r   99 KILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSN  145 (249)
Q Consensus        99 ~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~  145 (249)
                      ..+++.+++-.-=+|++|......+...---.+||.||+|.++.-..
T Consensus       192 ~~~~~~l~~A~rPvi~~G~Gv~~~~a~~~l~~lae~l~~PV~tt~~g  238 (535)
T TIGR03394       192 DEVLARMRSATSPVMMVCVEVRRYGLEAKVAELAQRLGVPVVTTFMG  238 (535)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             99999998556882998314002457999999999728884426455


No 244
>PRK06217 hypothetical protein; Validated
Probab=21.22  E-value=59  Score=13.49  Aligned_cols=28  Identities=25%  Similarity=0.436  Sum_probs=15.8

Q ss_pred             EEEEEECCCCCCCEEHHHHHHHHHCCCCEE
Q ss_conf             999961135888612899999985796133
Q gi|254780368|r  112 IVIAGKQTTDNESNQTGQMLAALMRWPQAT  141 (249)
Q Consensus       112 LIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt  141 (249)
                      +.++|  ++-.+....+-.||+.||+|++.
T Consensus         4 I~i~G--~sGsGkSTla~~La~~l~~~~~~   31 (185)
T PRK06217          4 IHITG--ASGSGTTTLGAALAEALDLPHLD   31 (185)
T ss_pred             EEEEC--CCCCCHHHHHHHHHHHHCCCEEE
T ss_conf             99978--99887899999999975989686


No 245
>TIGR02528 EutP ethanolamine utilization protein, EutP; InterPro: IPR012381   Members of this family function in ethanolamine  and propanediol  degradation pathways. Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively.  The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems.  Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose , . More than 10f the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect , . The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella , , . Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 biogenic amine metabolic process.
Probab=21.14  E-value=23  Score=16.13  Aligned_cols=61  Identities=13%  Similarity=0.205  Sum_probs=44.1

Q ss_pred             CCCCEEEEEECCCCCCCEEHHHHHHHHHCC-CCEEEEEEEEECCCEEEE---EEECCC-CE-EEEEEC
Q ss_conf             686499996113588861289999998579-613324433432865999---983589-67-999963
Q gi|254780368|r  108 ENPIIVIAGKQTTDNESNQTGQMLAALMRW-PQATFVSNIKIIDNHAIV---TREVGH-GT-MTMETP  169 (249)
Q Consensus       108 ~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~-p~vt~v~~i~~~~~~~~v---~r~~e~-g~-e~v~~~  169 (249)
                      .+.|+|.. .|+.+......||..+.+..= |.+.-|+++++.+....+   +|.+.. |. +.+++.
T Consensus        62 aDAd~i~l-V~~a~~~~~~f~PgF~~~f~kK~~IG~vTK~DLA~~d~~i~r~~~~L~~AG~~~iF~~~  128 (144)
T TIGR02528        62 ADADVIAL-VQSATDEESRFSPGFASIFVKKEVIGIVTKIDLAEADKDIERAKRLLETAGAEKIFEIS  128 (144)
T ss_pred             HCCEEEEE-EECCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCEEEC
T ss_conf             21023667-73577642237850002367886347884037887734799999998723654331650


No 246
>PRK08327 acetolactate synthase catalytic subunit; Validated
Probab=21.13  E-value=59  Score=13.48  Aligned_cols=53  Identities=15%  Similarity=0.228  Sum_probs=32.9

Q ss_pred             CCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEE
Q ss_conf             788999999999861268649999611358886128999999857961332443
Q gi|254780368|r   92 LEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSN  145 (249)
Q Consensus        92 ~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~  145 (249)
                      .++..+.++. +.+++-.-=+|++|..........---.+|+.||+|.++....
T Consensus       205 ~~~~~l~~~~-~~l~~AkrPvii~G~G~~~~~a~~~l~~lae~lg~PV~tt~~~  257 (568)
T PRK08327        205 PDPEDIQRAA-EMLAAAERPVIITQRGGRRAEAFASLDRLAEELGIPVVEYNGE  257 (568)
T ss_pred             CCHHHHHHHH-HHHHHCCCCEEECCCCCCHHHHHHHHHHHHHHCCCCEEECCCC
T ss_conf             9999999999-9998367974751787335789999999987549967955765


No 247
>COG1929 Glycerate kinase [Carbohydrate transport and metabolism]
Probab=20.99  E-value=60  Score=13.46  Aligned_cols=46  Identities=13%  Similarity=0.250  Sum_probs=30.1

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCEEE--EEECCCCCCCEEHHHHHHHHHC
Q ss_conf             478899999999986126864999--9611358886128999999857
Q gi|254780368|r   91 TLEPLSIAKILREIVKKENPIIVI--AGKQTTDNESNQTGQMLAALMR  136 (249)
Q Consensus        91 ~~D~~~~A~~La~~i~~~~~DLIl--~G~~S~D~~~g~v~~~lA~~Lg  136 (249)
                      ...++.|-..|.+++.+.--.+|+  -|.-|.|++.|+.-.+=+.+|+
T Consensus       108 ~~ts~GtGeLI~~Ald~Ga~~IiiGiGGSATnDgG~Gml~ALG~~f~d  155 (378)
T COG1929         108 ITTSYGTGELIKHALDAGAKHIIIGIGGSATNDGGAGMLQALGAQFLD  155 (378)
T ss_pred             CCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHCCHHHH
T ss_conf             023566889999999679738999515543576228899982843331


No 248
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites. NDP is a member of the NAD(P)H-dependent flavin oxidoreductase family that reduce a range of alternative electron acceptors. Most use FAD/FMN as a cofactor and NAD(P)H as electron donor. Some contain 4Fe-4S cluster to transfer electron from FAD to FMN.
Probab=20.91  E-value=60  Score=13.45  Aligned_cols=72  Identities=18%  Similarity=0.168  Sum_probs=27.9

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEE-EECCC------CCCCEEH
Q ss_conf             8528999971410158888878507776237633654788999999999861268649999-61135------8886128
Q gi|254780368|r   55 ATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIA-GKQTT------DNESNQT  127 (249)
Q Consensus        55 g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~~~~DLIl~-G~~S~------D~~~g~v  127 (249)
                      +..++.++.|++.  +.++..-+.|    +.+.-.-.  +.    ..+..+.+.+.|.|++ |.++.      +..+..+
T Consensus        80 ~v~~v~~~~g~p~--~~v~~l~~~g----~~v~~~v~--s~----~~A~~a~~~GaD~iv~qG~eAGGH~g~~~~~~~~l  147 (236)
T cd04730          80 GVPVVSFSFGPPA--EVVERLKAAG----IKVIPTVT--SV----EEARKAEAAGADALVAQGAEAGGHRGTFDIGTFAL  147 (236)
T ss_pred             CCCEEEECCCCCH--HHHHHHHHCC----CEEEEECC--CH----HHHHHHHHCCCCEEEEECCCCCCCCCCCCCCHHHH
T ss_conf             9999998798978--9999999829----98999589--89----99999998189989997777777889875556779


Q ss_pred             HHHHHHHHCCC
Q ss_conf             99999985796
Q gi|254780368|r  128 GQMLAALMRWP  138 (249)
Q Consensus       128 ~~~lA~~Lg~p  138 (249)
                      =+++.+.+++|
T Consensus       148 v~~v~~~~~ip  158 (236)
T cd04730         148 VPEVRDAVDIP  158 (236)
T ss_pred             HHHHHHHHCCC
T ss_conf             99999982986


No 249
>pfam01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus. This family represents the N-terminal region of the D-alanine--D-alanine ligase enzyme EC:6.3.2.4 which is thought to be involved in substrate binding. D-Alanine is one of the central molecules of the cross-linking step of peptidoglycan assembly. There are three enzymes involved in the D-alanine branch of peptidoglycan biosynthesis: the pyridoxal phosphate-dependent D-alanine racemase (Alr), the ATP-dependent D-alanine:D-alanine ligase (Ddl), and the ATP-dependent D-alanine:D-alanine-adding enzyme (MurF).
Probab=20.88  E-value=60  Score=13.45  Aligned_cols=35  Identities=14%  Similarity=0.071  Sum_probs=28.3

Q ss_pred             HCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEE
Q ss_conf             126864999961135888612899999985796133
Q gi|254780368|r  106 KKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQAT  141 (249)
Q Consensus       106 ~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt  141 (249)
                      +...+|++|-.-+-..++.|++-.+ .+++++|++.
T Consensus        75 ~~~~~DvvF~~lHG~~GEDG~iQgl-le~~~iPytG  109 (110)
T pfam01820        75 LAEKVDVVFPVLHGPFGEDGTIQGL-LELLGIPYVG  109 (110)
T ss_pred             HCCCCCEEEEECCCCCCCCCHHHHH-HHHCCCCCCC
T ss_conf             1248899999888988665789999-9981999889


No 250
>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers
Probab=20.79  E-value=60  Score=13.44  Aligned_cols=14  Identities=14%  Similarity=0.408  Sum_probs=7.4

Q ss_pred             CCCCHHHHHHHHHH
Q ss_conf             54788999999999
Q gi|254780368|r   90 ETLEPLSIAKILRE  103 (249)
Q Consensus        90 ~~~D~~~~A~~La~  103 (249)
                      .+.|.+...+.|.+
T Consensus        52 P~~~G~el~~~ir~   65 (113)
T cd00156          52 PGMDGLELLRRIRK   65 (113)
T ss_pred             CCCCCHHHHHHHHH
T ss_conf             89872699999998


No 251
>pfam00072 Response_reg Response regulator receiver domain. This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.
Probab=20.78  E-value=60  Score=13.43  Aligned_cols=11  Identities=9%  Similarity=0.356  Sum_probs=4.8

Q ss_pred             CCCHHHHHHHH
Q ss_conf             47889999999
Q gi|254780368|r   91 TLEPLSIAKIL  101 (249)
Q Consensus        91 ~~D~~~~A~~L  101 (249)
                      +.|.+...+.|
T Consensus        54 ~~dG~el~~~i   64 (111)
T pfam00072        54 GMDGLELLRRI   64 (111)
T ss_pred             CCCHHHHHHHH
T ss_conf             95015799999


No 252
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional
Probab=20.76  E-value=60  Score=13.43  Aligned_cols=22  Identities=5%  Similarity=-0.172  Sum_probs=15.4

Q ss_pred             CCCCCEEHHHHHHHHHCCCCEE
Q ss_conf             5888612899999985796133
Q gi|254780368|r  120 TDNESNQTGQMLAALMRWPQAT  141 (249)
Q Consensus       120 ~D~~~g~v~~~lA~~Lg~p~vt  141 (249)
                      .-+.-|+...++|..+|.--+.
T Consensus       149 aaGgVG~~avQlAk~~Ga~Vi~  170 (327)
T PRK10754        149 AAGGVGLIACQWAKALGAKLIG  170 (327)
T ss_pred             CCCCCCHHHHHHHHHCCCEEEE
T ss_conf             7761126899999986999999


No 253
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]
Probab=20.66  E-value=61  Score=13.42  Aligned_cols=21  Identities=14%  Similarity=0.211  Sum_probs=12.8

Q ss_pred             EEEEEECCCCCCCEEHHHHHHHHHC
Q ss_conf             9999611358886128999999857
Q gi|254780368|r  112 IVIAGKQTTDNESNQTGQMLAALMR  136 (249)
Q Consensus       112 LIl~G~~S~D~~~g~v~~~lA~~Lg  136 (249)
                      +.+.|.    ++-|+++-++|..+|
T Consensus       170 V~I~G~----GGlGh~avQ~Aka~g  190 (339)
T COG1064         170 VAVVGA----GGLGHMAVQYAKAMG  190 (339)
T ss_pred             EEEECC----CHHHHHHHHHHHHCC
T ss_conf             999877----489999999999869


No 254
>PRK13671 hypothetical protein; Provisional
Probab=20.63  E-value=61  Score=13.42  Aligned_cols=84  Identities=18%  Similarity=0.233  Sum_probs=46.9

Q ss_pred             ECCCHHH---HHHHHHHHHHHCCCCCCEEEEEECC--------CHHHHHHH--HHHHHCCCCCEEEECC---CCCCHHHH
Q ss_conf             3260136---8999999998559985289999714--------10158888--8785077762376336---54788999
Q gi|254780368|r   34 SMNPFDE---IALEESLQLREKGIATEVIVVSIGS--------CKVEEVLK--NSLAMGADRGILIESN---ETLEPLSI   97 (249)
Q Consensus        34 ~in~~D~---~AlE~Al~lke~~~g~~V~~lsvG~--------~~~~~~Lr--~alAmGaD~ai~i~d~---~~~D~~~~   97 (249)
                      --|||-.   |-|+++   |+.. +..+++.-|.+        +-.++..|  -||..|+|=.+-+..-   ..+|-++.
T Consensus         8 EYNPFHnGH~Yhi~qa---r~~~-~ad~iIavMSGnFvQRGEPAi~dKw~Ra~~AL~~G~DLViELP~~ya~qsAe~FA~   83 (298)
T PRK13671          8 EYNPFHNGHIYQINYI---KNKF-PNEKIIIILSGKYTQRGEIAVASFEKRKKIALKYGVDKVIKLPFEYATQAAHIFAK   83 (298)
T ss_pred             EECCCCCHHHHHHHHH---HHHC-CCCEEEEEECCCCCCCCCCHHCCHHHHHHHHHHCCCCEEEECCHHHHHCCHHHHHH
T ss_conf             2079740189999999---9865-99859999458852088611178889999999849998998866998715999999


Q ss_pred             HHHHHHHHHCCCCCEEEEEECCCCCC
Q ss_conf             99999986126864999961135888
Q gi|254780368|r   98 AKILREIVKKENPIIVIAGKQTTDNE  123 (249)
Q Consensus        98 A~~La~~i~~~~~DLIl~G~~S~D~~  123 (249)
                      +.  -..+.+.|.|-+.+|.++.|-+
T Consensus        84 ga--V~lL~~lgvd~l~FGsE~~d~~  107 (298)
T PRK13671         84 GA--IKKLNKHKIDKLIFGSESNDVE  107 (298)
T ss_pred             HH--HHHHHHCCCCEEEEECCCCCHH
T ss_conf             99--9999986999799726889899


No 255
>PRK06720 hypothetical protein; Provisional
Probab=20.40  E-value=61  Score=13.38  Aligned_cols=73  Identities=11%  Similarity=0.166  Sum_probs=50.6

Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCC-CCEEEE
Q ss_conf             36899999999855998528999971410158888878507776237633654788999999999861268-649999
Q gi|254780368|r   39 DEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKEN-PIIVIA  115 (249)
Q Consensus        39 D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~~~~D~~~~A~~La~~i~~~~-~DLIl~  115 (249)
                      --...+.|.+|.+.  |..|.+...-.+..+++..+.-..|. +++.+..| -.|.-.+.+++..++++.+ .|+++-
T Consensus        26 ~GIG~a~A~~la~~--Ga~Vvi~d~~~~~~~~~~~~i~~~g~-~a~~~~~D-vs~~~~v~~~i~~~~~~~g~iDiLvN   99 (169)
T PRK06720         26 IGIGRNTALLLAKQ--GAKVIVTDIDQESGQATVEEITNLGG-EALFVSYD-MEKQGDWQRVISITLNAFSRIDMLFQ   99 (169)
T ss_pred             CHHHHHHHHHHHHC--CCEEEEECCCHHHHHHHHHHHHHCCC-CEEEEECC-CCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             48999999999986--99899952763659999999997499-53789758-89999999999999997598998998


No 256
>PRK07092 benzoylformate decarboxylase; Reviewed
Probab=20.27  E-value=62  Score=13.37  Aligned_cols=50  Identities=14%  Similarity=0.135  Sum_probs=31.0

Q ss_pred             CCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCC-EEE
Q ss_conf             788999999999861268649999611358886128999999857961-332
Q gi|254780368|r   92 LEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQ-ATF  142 (249)
Q Consensus        92 ~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~-vt~  142 (249)
                      .|+-++.+++. .+.+-.-=+|++|......+...---.+||.||+|. ++.
T Consensus       182 p~~~~l~~~~~-~L~~AkrPvii~G~g~~~~~a~~~l~~lae~l~~PV~~t~  232 (521)
T PRK07092        182 PDPAALAALGD-ALDAARNPALVVGPAVDRAGAWDDAVRLAERHRAPVWVAP  232 (521)
T ss_pred             CCHHHHHHHHH-HHHCCCCCEEEECCCCCCCCHHHHHHHHHHHHCCCEEEEC
T ss_conf             99999999999-9972899789987670403549999999998699778732


No 257
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional
Probab=20.21  E-value=62  Score=13.36  Aligned_cols=40  Identities=20%  Similarity=0.135  Sum_probs=16.3

Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCC
Q ss_conf             368999999998559985289999714101588888785077
Q gi|254780368|r   39 DEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGA   80 (249)
Q Consensus        39 D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGa   80 (249)
                      |...+|..-+|+.++....|.++|.-.  .....+.|+..||
T Consensus        57 ~~~G~~~~~~ir~~~~~~~viv~s~~~--~~~~~~~a~~~Ga   96 (204)
T PRK09958         57 GVNGIQVLETLRKRQYSGIIIIVSAKN--DHFYGKHCADAGA   96 (204)
T ss_pred             CCCCHHHHHHHHHHCCCEEEEEEECCC--CCHHHHHHHHCCC
T ss_conf             998416788898727980599997246--5211443352686


No 258
>PRK08507 prephenate dehydrogenase; Validated
Probab=20.19  E-value=62  Score=13.35  Aligned_cols=68  Identities=22%  Similarity=0.209  Sum_probs=37.9

Q ss_pred             HHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCC-CCCEEEECCCCCC-------HHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             999998559985289999714101588888785077-7623763365478-------89999999998612686499996
Q gi|254780368|r   45 ESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGA-DRGILIESNETLE-------PLSIAKILREIVKKENPIIVIAG  116 (249)
Q Consensus        45 ~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGa-D~ai~i~d~~~~D-------~~~~A~~La~~i~~~~~DLIl~G  116 (249)
                      .|+.||+++...+|+++    ...+++++.|+..|+ |+..-..+-..+|       +..+..++.+... ..++-+++=
T Consensus        15 la~alk~~~~~~~V~g~----d~~~~~~~~A~~~g~id~~~~~~~i~~aDlVila~Pv~~~~~~l~~l~~-l~~~~iitD   89 (275)
T PRK08507         15 LGLALKENKLISCVYGY----DHNEEHEKDALDLGLVDEIVEFEEIKECDVIFLAIPVDAIIEILQKLLD-IKENTTIID   89 (275)
T ss_pred             HHHHHHHCCCCCEEEEE----ECCHHHHHHHHHCCCCCCCCCHHHCCCCCEEEEECCHHHHHHHHHHHHH-CCCCCEEEE
T ss_conf             99999950998679999----5999999999986998610673123657989991769999999999860-467888983


Q ss_pred             E
Q ss_conf             1
Q gi|254780368|r  117 K  117 (249)
Q Consensus       117 ~  117 (249)
                      .
T Consensus        90 v   90 (275)
T PRK08507         90 L   90 (275)
T ss_pred             C
T ss_conf             4


No 259
>PRK08451 DNA polymerase III subunits gamma and tau; Validated
Probab=20.18  E-value=62  Score=13.35  Aligned_cols=44  Identities=20%  Similarity=0.187  Sum_probs=36.1

Q ss_pred             ECCCHHHHHHHHHHHHCC-CCCEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             714101588888785077-76237633654788999999999861
Q gi|254780368|r   63 IGSCKVEEVLKNSLAMGA-DRGILIESNETLEPLSIAKILREIVK  106 (249)
Q Consensus        63 vG~~~~~~~Lr~alAmGa-D~ai~i~d~~~~D~~~~A~~La~~i~  106 (249)
                      +|...+..+|+.++.-|- ..|++.+...|.--..+|+++|+++.
T Consensus        17 IGQe~iv~~L~nAi~~~Rl~HAYLFsGPrGvGKTt~ArifAkaLn   61 (523)
T PRK08451         17 IGQESVSKTLSLALDNNRLAHAYLFSGLRGSGKTSSARIFSRALV   61 (523)
T ss_pred             CCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             494999999999998599671587578998688999999999975


No 260
>KOG0023 consensus
Probab=20.05  E-value=63  Score=13.34  Aligned_cols=22  Identities=27%  Similarity=0.338  Sum_probs=9.0

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCC
Q ss_conf             89999714101588888785077
Q gi|254780368|r   58 VIVVSIGSCKVEEVLKNSLAMGA   80 (249)
Q Consensus        58 V~~lsvG~~~~~~~Lr~alAmGa   80 (249)
                      |.++..|. --.-+.+-|-|||.
T Consensus       185 vgI~GlGG-LGh~aVq~AKAMG~  206 (360)
T KOG0023         185 VGIVGLGG-LGHMAVQYAKAMGM  206 (360)
T ss_pred             EEEECCCC-CCHHHHHHHHHHCC
T ss_conf             98855764-01689999987086


Done!