HHsearch alignment of GI: 254780368 and MMDB domain: 3ih5_A_1-122_163-217

>3ih5_A (A:1-122,A:163-217) Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron}
Probab=99.64  E-value=6.3e-16  Score=122.20  Aligned_cols=118  Identities=16%  Similarity=0.216  Sum_probs=104.1

Q ss_pred             EEECCCCEECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEECC--CCCCHHHHHHHHHH
Q ss_conf             6324877332601368999999998559985289999714101588888785077762376336--54788999999999
Q gi|254780368|r   26 IETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESN--ETLEPLSIAKILRE  103 (249)
Q Consensus        26 i~~~~~~~~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alAmGaD~ai~i~d~--~~~D~~~~A~~La~  103 (249)
                      +-.+.....+||+|..+|++|.+|+++ .|++|+++++|+. .++.+++++++|+|+.++++++  +..++...+.+|++
T Consensus         8 Vv~E~~~g~l~~~slElL~~A~~LA~~-~G~~V~alv~G~~-~~~~~~~l~a~Gad~Vi~v~~~~l~~~~~e~~a~aLa~   85 (177)
T 3ih5_A            8 VYCEIEEGIVADVSLELLTKGRSLANE-LNCQLEAVVAGTG-LKEIEKQILPYGVDKLHVFDAEGLYPYTSLPHTSILVN   85 (177)
T ss_dssp             EECCEETTEECHHHHHHHHHHHHHHHH-HTCCEEEEEEESC-CTTTHHHHGGGTCSEEEEEECGGGSSCCHHHHHHHHHH
T ss_pred             EEEECCCCEECHHHHHHHHHHHHHHHH-CCCCEEEEEECCC-HHHHHHHHHHCCCCEEEEECCCHHCCCCHHHHHHHHHH
T ss_conf             999835999988999999999999986-4994899996797-58988765212762499976720023206789999998


Q ss_pred             HHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEE
Q ss_conf             861268649999611358886128999999857961332443343
Q gi|254780368|r  104 IVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKI  148 (249)
Q Consensus       104 ~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~  148 (249)
                      ++++.+||+||+|..+.+++   ++|++|.+||+|+++.|.+-.+
T Consensus        86 ~ik~~~p~lVL~g~Ts~Grd---laprLAa~LgaglvsdV~~~~~  127 (177)
T 3ih5_A           86 LFKEEQPQICLXGATVIGRD---LGPRVSSALTSGLTADCHRPQX  127 (177)
T ss_dssp             HHHHHCCSEEEEECSHHHHH---HHHHHHHHTTCCCBCSCSSSEE
T ss_pred             HHHHCCCCEEEECCCHHHHH---HHHHHHHHHCCCCCCCECCCEE
T ss_conf             87532651588526874878---9999999849986413597489