HHsearch results for GI: 254780368 and protein with PDBid: 1efv_A

>1efv_A Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 c.31.1.2 PDB: 2a1u_A* 1t9g_R* 2a1t_R*
Probab=98.78  E-value=4.7e-07  Score=64.21  Aligned_cols=142  Identities=18%  Similarity=0.176  Sum_probs=104.6

Q ss_pred             ECCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHH-HCCCCCEEEECC--CCCCHHHHHHHHHHHHHCCCC
Q ss_conf             32601368999999998559985289999714101588888785-077762376336--547889999999998612686
Q gi|254780368|r   34 SMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLA-MGADRGILIESN--ETLEPLSIAKILREIVKKENP  110 (249)
Q Consensus        34 ~in~~D~~AlE~Al~lke~~~g~~V~~lsvG~~~~~~~Lr~alA-mGaD~ai~i~d~--~~~D~~~~A~~La~~i~~~~~  110 (249)
                      .++|.-.-.|..|-+|     |++|+++.+|.. .+..-.+++. .|+|+.|.+.++  +...+...+.++++.+++.+|
T Consensus        14 ~l~~~s~Ell~~A~~L-----g~~v~avv~G~~-~~~~a~~l~~~~Gad~V~~~~~~~~~~~~~e~~a~al~~~~~~~~p   87 (315)
T 1efv_A           14 SLAPITLNTITAATRL-----GGEVSCLVAGTK-CDKVAQDLCKVAGIAKVLVAQHDVYKGLLPEELTPLILATQKQFNY   87 (315)
T ss_dssp             EECTHHHHHHHHHHTT-----TSEEEEEEEESC-CHHHHHHHHHSTTCCEEEEEECGGGTTCCHHHHHHHHHHHHHHHCC
T ss_pred             EECHHHHHHHHHHHHH-----CCCEEEEEECCC-CHHHHHHHHCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             9999999999999985-----897489998888-0899999851369878999458202035603457899888751485


Q ss_pred             CEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEECCCC--EEEEEE-CCCEEEEEECCCCCCCCCC
Q ss_conf             4999961135888612899999985796133244334328659999835896--799996-3988999843556545469
Q gi|254780368|r  111 IIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHG--TMTMET-PLPAVITVDLNLNEPRYIS  187 (249)
Q Consensus       111 DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~~~~~~v~r~~e~g--~e~v~~-~lPavisv~~~~n~PR~ps  187 (249)
                      ++||+|.-.   ...-+.++||.+|+.++++.+.+++.++.   ..|...+|  ..++++ ..|.++++..+..+|.-+.
T Consensus        88 ~~VL~~~T~---~GrdlaprLAarL~~g~vsdv~~l~~~~~---~~r~~~~g~~~~~~~~~~~~~~~tvr~~~f~~~~~~  161 (315)
T 1efv_A           88 THICAGASA---FGKNLLPRVAAKLEVAPISDIIAIKSPDT---FVRTIYAGNALCTVKCDEKVKVFSVRGTSFDAAATS  161 (315)
T ss_dssp             SEEEEESSH---HHHHHHHHHHHHHTCCCEEEECEEEETTE---EEEEETTTTEEEEEEECCSSEEEEECGGGSCCCCSS
T ss_pred             CEEEECCCH---HHHHHHHHHHHHCCCCCEEEEEEEECCCE---EEEEEECCCCEEEEEECCCCEEEEECCCCCCCCCCC
T ss_conf             489963774---36678999999809971516899945995---999997453179996247614887415643454455