HHSEARCH alignment of GI: 254780368 and SCOP domain: d3clsc1

Alignment
>d3clsc1 c.26.2.3 (C:1-262) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}
Probab=100.00  E-value=0  Score=515.39  Aligned_cols=245  Identities=32%  Similarity=0.547  Sum_probs=226.7

Q ss_pred             CEEEEEEEEECCCCCCEEECCCCCEEEECCCCEECCCHHHHHHHHHHHHHHCCCC-CCEEEEEECCCHHHHHHHHHHHHC
Q ss_conf             9699986030388760598078881632487733260136899999999855998-528999971410158888878507
Q gi|254780368|r    1 MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIA-TEVIVVSIGSCKVEEVLKNSLAMG   79 (249)
Q Consensus         1 M~I~V~vK~VpD~~~~i~i~~~~~~i~~~~~~~~in~~D~~AlE~Al~lke~~~g-~~V~~lsvG~~~~~~~Lr~alAmG   79 (249)
                      |||+||+|||||++++++++++++.+++++++++|||||+||||+||||||+++| .+|+++||||++++++||+|||||
T Consensus         1 M~IlV~vKqVPD~~~~i~i~~~~~~l~~~~~~~viNp~D~~AlE~Al~lke~~gg~~~Vtvvt~Gp~~a~~~Lr~alAmG   80 (262)
T d3clsc1           1 MKILVAVKQTAALEEDFEIREDGMDVDEDFMMYDLNEWDDFSLEEAMKIKESSDTDVEVVVVSVGPDRVDESLRKCLAKG   80 (262)
T ss_dssp             CEEEEECCEEEEECTTCCBCTTSSSBCGGGEEEEECHHHHHHHHHHHHHHHHCSSCCEEEEEEESCTTHHHHHHHHHHTT
T ss_pred             CEEEEEEEECCCCCCCEEECCCCCEEECCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHCC
T ss_conf             97999998677887606985899887647885326862599999999998547983599999616636789999998607


Q ss_pred             CCCCEEEECC--CCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEEHHHHHHHHHCCCCEEEEEEEEEC--CCEEEE
Q ss_conf             7762376336--547889999999998612686499996113588861289999998579613324433432--865999
Q gi|254780368|r   80 ADRGILIESN--ETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKII--DNHAIV  155 (249)
Q Consensus        80 aD~ai~i~d~--~~~D~~~~A~~La~~i~~~~~DLIl~G~~S~D~~~g~v~~~lA~~Lg~p~vt~v~~i~~~--~~~~~v  155 (249)
                      ||+++||+|+  +++|+++||++||+++++.+|||||||+||+|+++||||+++|++|||||+|+|.+++++  ++.+++
T Consensus        81 aD~avli~d~~~~~~d~~~tA~~lA~~i~~~~~DLIl~G~~s~D~~~gqvg~~lAe~Lg~P~vt~v~~i~~~~~~~~~~v  160 (262)
T d3clsc1          81 ADRAVRVWDDAAEGSDAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYLNWPHAAVVADLQYKPGDNKAVI  160 (262)
T ss_dssp             CSEEEEECCGGGTTCCHHHHHHHHHHHHHHHCCSEEEEESCCTTTCCCCHHHHHHHHHTCCEEEEEEEEECCTTCSEEEE
T ss_pred             CCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCHHHHHHHHHCCCCEEEEEEEEEECCCCCEEEE
T ss_conf             97369996045566128889999999862348868999632147775637799998738864778878733279954999


Q ss_pred             EEECCCC-EEEEEECCCEEEEEECCCCCCCCCCHHHHHHHHHCCCCEECHHHHCCCC------CCCEEEEEEECCCCCCC
Q ss_conf             9835896-7999963988999843556545469888998852166120498907666------68457999517885247
Q gi|254780368|r  156 TREVGHG-TMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDL------TPRLKVLRFEENRAERK  228 (249)
Q Consensus       156 ~r~~e~g-~e~v~~~lPavisv~~~~n~PR~psl~~im~A~kk~i~~~~~~dlg~d~------~~~~~v~~~~~p~~~~~  228 (249)
                      +|++++| +|++++++|||+||++++|+||||||++||+|+||||++|+++|||++.      .+++++.++++|+ +++
T Consensus       161 ~R~~e~g~~e~v~~~lPavitv~~~~n~PR~pslk~im~A~kk~i~~~~~~dlg~~~~~~g~~~s~t~v~~~~~P~-~~~  239 (262)
T d3clsc1         161 RRELEGGMLQEVEINCPAVLTIQLGINKPRYASLRGIKQAATKPIEEVSLADIGLSANDVGAAQSMSRVRRMYIPE-KGR  239 (262)
T ss_dssp             EEEETTTEEEEEEEESSCEEEECTTSSCCTTCC--------CCCCEEECTGGGTCCGGGSSGGGSSSEEEEEECCC-CCC
T ss_pred             EEEECCCEEEEEEECCCEEEEEECCCCCCCCCCHHHHHHHCCCCEEEECHHHCCCCHHHCCCCCCCEEEEEECCCC-CCC
T ss_conf             9994799189999668589997057676568997999975558805943999498877745568967898875998-887


Q ss_pred             CEEECC-----HHHHHHHHHHHHC
Q ss_conf             455379-----9999999998617
Q gi|254780368|r  229 GLRLYS-----TTKLIEILKSKHD  247 (249)
Q Consensus       229 g~~~e~-----~~eLv~~L~~e~~  247 (249)
                      ++++++     +++|+++|| |+|
T Consensus       240 ~~~i~g~~~e~a~~l~~~L~-e~K  262 (262)
T d3clsc1         240 ATMIEGTISEQAAKIIQIIN-EFK  262 (262)
T ss_dssp             CEECCSCHHHHHHHHHHHHH-HHC
T ss_pred             CEEEECCHHHHHHHHHHHHH-HCC
T ss_conf             45993887999999999997-539


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: ETFP subunits
domain: Small, beta subunit of electron transfer flavoprotein ETFP
species: Methylophilus methylotrophus [TaxId: 17]