BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780368|ref|YP_003064781.1| electron transfer flavoprotein
beta subunit [Candidatus Liberibacter asiaticus str. psy62]
         (249 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780368|ref|YP_003064781.1| electron transfer flavoprotein beta subunit [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040045|gb|ACT56841.1| electron transfer flavoprotein beta subunit [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 249

 Score =  499 bits (1285), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 249/249 (100%), Positives = 249/249 (100%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV
Sbjct: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT
Sbjct: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL
Sbjct: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE
Sbjct: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240

Query: 241 ILKSKHDLL 249
           ILKSKHDLL
Sbjct: 241 ILKSKHDLL 249


>gi|315121836|ref|YP_004062325.1| electron transfer flavoprotein beta subunit [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495238|gb|ADR51837.1| electron transfer flavoprotein beta subunit [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 249

 Score =  400 bits (1029), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/249 (80%), Positives = 222/249 (89%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVPIKGVI+YN KVRIK D SGIE +N K+S+NPFDEIALEESL+L+EKGIATEVIV
Sbjct: 1   MKILVPIKGVIDYNAKVRIKIDGSGIEQDNMKMSINPFDEIALEESLRLKEKGIATEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+ KVE VLKN+LAMGADRGI IESNE LE LSIAKIL EIVK+E PI VIAGKQTT
Sbjct: 61  VSIGTYKVEAVLKNALAMGADRGIFIESNEILESLSIAKILCEIVKQEKPIAVIAGKQTT 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           DNESNQTGQMLAAL+ WPQATFVS I++  +HAI  RE+GHGTMT+E PLPAVITVDLNL
Sbjct: 121 DNESNQTGQMLAALLGWPQATFVSKIEMSGDHAITVREMGHGTMTIEIPLPAVITVDLNL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRYISLPNI+KARKK++EKK A+DFAI+LTPRLKVL+FEENRAER   RLYS T+LIE
Sbjct: 181 NEPRYISLPNILKARKKQLEKKMASDFAINLTPRLKVLKFEENRAERTSSRLYSATELIE 240

Query: 241 ILKSKHDLL 249
            LKSKH LL
Sbjct: 241 TLKSKHGLL 249


>gi|218679809|ref|ZP_03527706.1| electron transport flavoprotein, beta subunit [Rhizobium etli CIAT
           894]
          Length = 249

 Score =  288 bits (737), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 187/249 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K D +G+E  N K+SMNPFDEI++EE+L+L+E G A EV+V
Sbjct: 1   MKILVPVKRVVDYNVKIRVKPDGTGVELANVKMSMNPFDEISVEEALRLKEAGKAEEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+++ +EPL++AKIL+ +   E P ++I GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILVETDDQVEPLAVAKILKAVADAEQPGLIITGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+   QATF S I+I D  A VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALLGSAQATFASKIEIGDGKATVTREVDGGLQTIEIKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++++   DF +D TPRLKVL+ EE    + G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDRQAPADFGVDTTPRLKVLKTEEPSGRKAGVKVKSVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|307943484|ref|ZP_07658828.1| electron transfer flavoprotein subunit beta [Roseibium sp.
           TrichSKD4]
 gi|307773114|gb|EFO32331.1| electron transfer flavoprotein subunit beta [Roseibium sp.
           TrichSKD4]
          Length = 249

 Score =  288 bits (736), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 188/249 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K VI+YN KVR+K D SG++  N K+SMNPFDEI++EE+L+L+E G ATEV+V
Sbjct: 1   MKILVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEISVEEALRLKEAGKATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K  E L+  LAMGADRGIL+E++ET+EPL++AKIL+ IV+ E P +VI GKQ  
Sbjct: 61  VSIGPKKATETLRTGLAMGADRGILVETDETVEPLAVAKILKSIVEAEEPGLVIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W Q TF S + + D    VTREV  G  T++  +PA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWAQGTFASKVDLGDGTVDVTREVDGGLQTIKLKMPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+ SLPNI+KA+KK I++K   DF +D+TPRL V++ EE    + G+++ S  +L++
Sbjct: 181 NEPRFASLPNIMKAKKKPIDEKTPADFGVDITPRLSVVKTEEPPVRQAGVKVESVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|332186705|ref|ZP_08388448.1| electron transfer flavodomain protein [Sphingomonas sp. S17]
 gi|332013357|gb|EGI55419.1| electron transfer flavodomain protein [Sphingomonas sp. S17]
          Length = 249

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 185/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K D SG++  N K+SMNPFDEIA+EE+++L+E G A EV+V
Sbjct: 1   MKILVPVKRVVDYNVKIRVKPDGSGVDLANVKMSMNPFDEIAIEEAVRLKEAGAAEEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + ++ L+ +LAMGADR ILI++ + +EPLS+AK+L+ +V+ E P +V+ GKQ  
Sbjct: 61  VSIGPAQAQDTLRTALAMGADRAILIKAEDAVEPLSVAKLLKAVVETEAPQLVLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W QATF S IK+  + A VTREV  G   +E  LP V+TVDL L
Sbjct: 121 DDDSNQTGQMLAALLGWSQATFASEIKLDGDRATVTREVDGGLQVIEATLPTVVTVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E K A DF + + PRLKVL+ EE  A   G+++ S  +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPLEDKTAADFGVSIAPRLKVLKTEEPAARSAGVKVGSVAELVT 240

Query: 241 ILKSKHDLL 249
            LK +  +L
Sbjct: 241 KLKVEAAVL 249


>gi|115350992|ref|YP_772831.1| electron transfer flavoprotein subunit beta [Burkholderia ambifaria
           AMMD]
 gi|172059997|ref|YP_001807649.1| electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           ambifaria MC40-6]
 gi|115280980|gb|ABI86497.1| electron transfer flavoprotein beta-subunit [Burkholderia ambifaria
           AMMD]
 gi|171992514|gb|ACB63433.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           ambifaria MC40-6]
          Length = 249

 Score =  285 bits (728), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 184/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+ESN+++EPL++AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSVGVAQAQETLRTALAIGADRAILVESNDSVEPLAVAKILKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + I D  A V REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVTIADGKATVAREVDGGAETLSLTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+TPRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLENVKPEDLGVDVTPRLKTLKVAEPPKRAAGVKVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|153008346|ref|YP_001369561.1| electron transfer flavoprotein alpha/beta-subunit [Ochrobactrum
           anthropi ATCC 49188]
 gi|151560234|gb|ABS13732.1| Electron transfer flavoprotein alpha/beta-subunit [Ochrobactrum
           anthropi ATCC 49188]
          Length = 248

 Score =  284 bits (726), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 184/244 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN K+R+K D SG+E  N K+SMNPFDEIA+EE+++L+E G  TE++ 
Sbjct: 1   MKVLVAVKRVVDYNVKIRVKGDGSGVELANVKMSMNPFDEIAVEEAIRLKEAGKVTEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LAMGADR IL++S+ET+EPL +AK+L+ +V  E P +V  GKQ  
Sbjct: 61  VSVGPAQAQETLRTALAMGADRAILVKSDETVEPLGVAKVLKGVVDAEKPDLVFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQML+AL+ W QATF S +++ D  A VTREV  G  T++  LPA++TVDL L
Sbjct: 121 DDDSNQTGQMLSALLNWSQATFASKVELGDGSAKVTREVDGGLQTIDVKLPAIVTVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N+PRY SLPNI+KA+KK +++K   DF  D+ PRLKVL+ EE    + G+++ S ++L+E
Sbjct: 181 NQPRYASLPNIMKAKKKPLDEKSPADFGADIAPRLKVLKTEEPGGRKAGVKVGSVSELVE 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKA 244


>gi|186475527|ref|YP_001856997.1| electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           phymatum STM815]
 gi|184191986|gb|ACC69951.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           phymatum STM815]
          Length = 249

 Score =  283 bits (725), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR ILIESNE L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSAGVTQCQETLRTALAIGADRAILIESNEDLQPLAVAKLLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + I D  A V+REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALANLPQATFASKVVIADGKATVSREVDGGAETLSLKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+TPRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVTPRLKTLKVSEPPKRSAGVKVADVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|254472150|ref|ZP_05085550.1| electron transfer flavoprotein beta chain [Pseudovibrio sp. JE062]
 gi|211958433|gb|EEA93633.1| electron transfer flavoprotein beta chain [Pseudovibrio sp. JE062]
          Length = 249

 Score =  283 bits (725), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 187/249 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K D SG+E  N K+SMNPFDEIA+EE+L+L+E G ATE+IV
Sbjct: 1   MKILVPVKRVVDYNVKVRVKADGSGVELANVKMSMNPFDEIAVEEALRLKEAGKATEIIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E ++  LAMGADRGIL+++++T+EPL++AK+L+ IV++E P +VI GKQ  
Sbjct: 61  VSIGPKQATETIRTGLAMGADRGILVQTDDTVEPLAVAKVLKGIVEEEEPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL+ W Q TF S + + DN   VTRE+  G  T++  +PA++T DL L
Sbjct: 121 DDDCNQTGQMLAALLGWAQGTFASKVDLGDNTVDVTREIDGGLQTVKLNMPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I +K   DF +D TPRLKVL   E  A + G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPIAEKTLADFGVDATPRLKVLNTAEPEARKAGVKVGSVEELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|209552154|ref|YP_002284070.1| electron transfer flavoprotein alpha/beta-subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209539747|gb|ACI59678.1| Electron transfer flavoprotein alpha/beta-subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 249

 Score =  283 bits (724), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 187/249 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN K+R++ D +G+E  N K+SMNPFDEI++EE+L+L+E G ATEV+V
Sbjct: 1   MKVLVPVKRVVDYNVKIRVRPDGTGVELSNVKMSMNPFDEISVEEALRLKEGGNATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+++ +EPL++AKIL+ +   E P +VI GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILVETDDHVEPLAVAKILKGVADAEKPGLVIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+   QATF S I++ +  A+VTRE+  G  T+E  LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALLNVAQATFASAIEVSEGRALVTREIDGGLQTIEIKLPAVVTSDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +++K   DF +   PRLKVL+ EE    + G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLDRKSPDDFGVSTAPRLKVLKTEEPSGRKAGVKVESVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAGVL 249


>gi|170698400|ref|ZP_02889473.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           ambifaria IOP40-10]
 gi|170136653|gb|EDT04908.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           ambifaria IOP40-10]
          Length = 249

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+ESN+ +EPL++AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSVGVTQAQETLRTALAIGADRAILVESNDNVEPLAVAKILKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + I D  A V REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVTIADGKATVAREVDGGAETLSLTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+TPRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLENVKPEDLGVDVTPRLKTLKVAEPPKRAAGVKVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|170693735|ref|ZP_02884893.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           graminis C4D1M]
 gi|170141517|gb|EDT09687.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           graminis C4D1M]
          Length = 249

 Score =  283 bits (723), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 184/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++LRE G+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLREAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G+ + +E L+ +LA+GADR ILIESNE L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSAGATQSQETLRTALAIGADRAILIESNEELQPLAVAKLLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V+REV  G  T+   LPAVIT DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVVVADGKATVSREVDGGAETLSLKLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+TPRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLEVVKPEDLGVDVTPRLKTLKVVEPPKRSAGVKVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|239832973|ref|ZP_04681302.1| Electron transfer flavoprotein subunit beta [Ochrobactrum
           intermedium LMG 3301]
 gi|239825240|gb|EEQ96808.1| Electron transfer flavoprotein subunit beta [Ochrobactrum
           intermedium LMG 3301]
          Length = 248

 Score =  282 bits (722), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 184/244 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN K+R+K D SG+E  N K+SMNPFDEIA+EE+++L+E G  TE++ 
Sbjct: 1   MKVLVAVKRVVDYNVKIRVKGDGSGVELSNVKMSMNPFDEIAVEEAIRLKEAGKVTEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LAMGADR IL++++ET+EPL +AK+L+ +V+ E P +V  GKQ  
Sbjct: 61  VSVGPAQAQETLRTALAMGADRAILVKTDETVEPLGVAKVLKGVVEAEKPDLVFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQML+AL+ W QATF S +++ D  A VTREV  G  T++  LPA++TVDL L
Sbjct: 121 DDDSNQTGQMLSALLNWSQATFASKVELGDGSAKVTREVDGGLQTIDVKLPAIVTVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N+PRY SLPNI+KA+KK +++K   DF  D+ PRLKVL+ EE    + G+++ S  +L+E
Sbjct: 181 NQPRYASLPNIMKAKKKPLDEKSPADFGADIAPRLKVLKTEEPGGRKAGVKVGSVAELVE 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKA 244


>gi|78060411|ref|YP_366986.1| electron transfer flavoprotein subunit beta [Burkholderia sp. 383]
 gi|77964961|gb|ABB06342.1| Electron transfer flavoprotein beta-subunit [Burkholderia sp. 383]
          Length = 249

 Score =  282 bits (721), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 181/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKGDGTGVDLSNVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+ESN+ +EPL +AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSVGVAQAQETLRTALAIGADRAILVESNDGVEPLGVAKILKALVDKEQPQLVIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL  +PQATF S + + D  A V REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALAGFPQATFASKVTVADGKATVAREVDGGAETLSLQLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVAPRLKTLKVVEPPKRAAGVKVPDVQTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|307730604|ref|YP_003907828.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           CCGE1003]
 gi|307585139|gb|ADN58537.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           CCGE1003]
          Length = 249

 Score =  281 bits (720), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR ILIESNE L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVTQSQETLRTALAIGADRAILIESNEELQPLAVAKLLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V+REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVVVADGKATVSREVDGGAETLSLKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+TPRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETIKPEDLGVDVTPRLKTLKVAEPPGRSAGVKVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|53720109|ref|YP_109095.1| electron transfer flavoprotein subunit beta [Burkholderia
           pseudomallei K96243]
 gi|53724770|ref|YP_102224.1| electron transfer flavoprotein subunit beta [Burkholderia mallei
           ATCC 23344]
 gi|76811197|ref|YP_334356.1| electron transfer flavoprotein subunit beta [Burkholderia
           pseudomallei 1710b]
 gi|83721332|ref|YP_442190.1| electron transfer flavoprotein subunit beta [Burkholderia
           thailandensis E264]
 gi|121601394|ref|YP_993857.1| electron transfer flavoprotein, beta subunit [Burkholderia mallei
           SAVP1]
 gi|124384242|ref|YP_001026921.1| electron transfer flavoprotein, beta subunit [Burkholderia mallei
           NCTC 10229]
 gi|126440582|ref|YP_001059886.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 668]
 gi|126448625|ref|YP_001079793.1| electron transfer flavoprotein, beta subunit [Burkholderia mallei
           NCTC 10247]
 gi|126454707|ref|YP_001067173.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 1106a]
 gi|167581069|ref|ZP_02373943.1| electron transfer flavoprotein, beta subunit [Burkholderia
           thailandensis TXDOH]
 gi|167619149|ref|ZP_02387780.1| electron transfer flavoprotein, beta subunit [Burkholderia
           thailandensis Bt4]
 gi|167720649|ref|ZP_02403885.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei DM98]
 gi|167739635|ref|ZP_02412409.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 14]
 gi|167816840|ref|ZP_02448520.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 91]
 gi|167825242|ref|ZP_02456713.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 9]
 gi|167846746|ref|ZP_02472254.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei B7210]
 gi|167895332|ref|ZP_02482734.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 7894]
 gi|167911967|ref|ZP_02499058.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 112]
 gi|167919959|ref|ZP_02507050.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei BCC215]
 gi|226197838|ref|ZP_03793412.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei Pakistan 9]
 gi|254176976|ref|ZP_04883633.1| electron transfer flavoprotein, beta subunit [Burkholderia mallei
           ATCC 10399]
 gi|254181104|ref|ZP_04887702.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 1655]
 gi|254191896|ref|ZP_04898396.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254195666|ref|ZP_04902093.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei S13]
 gi|254260037|ref|ZP_04951091.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 1710a]
 gi|254295637|ref|ZP_04963095.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 406e]
 gi|254360055|ref|ZP_04976325.1| electron transfer flavoprotein, beta subunit [Burkholderia mallei
           2002721280]
 gi|257138380|ref|ZP_05586642.1| electron transfer flavoprotein, beta subunit [Burkholderia
           thailandensis E264]
 gi|52210523|emb|CAH36506.1| electron transfer flavoprotein beta-subunit [Burkholderia
           pseudomallei K96243]
 gi|52428193|gb|AAU48786.1| electron transfer flavoprotein, beta subunit [Burkholderia mallei
           ATCC 23344]
 gi|76580650|gb|ABA50125.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 1710b]
 gi|83655157|gb|ABC39220.1| electron transfer flavoprotein, beta subunit [Burkholderia
           thailandensis E264]
 gi|121230204|gb|ABM52722.1| electron transfer flavoprotein, beta subunit [Burkholderia mallei
           SAVP1]
 gi|124292262|gb|ABN01531.1| electron transfer flavoprotein, beta subunit [Burkholderia mallei
           NCTC 10229]
 gi|126220075|gb|ABN83581.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 668]
 gi|126228349|gb|ABN91889.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 1106a]
 gi|126241495|gb|ABO04588.1| electron transfer flavoprotein, beta subunit [Burkholderia mallei
           NCTC 10247]
 gi|148029295|gb|EDK87200.1| electron transfer flavoprotein, beta subunit [Burkholderia mallei
           2002721280]
 gi|157805486|gb|EDO82656.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 406e]
 gi|157987718|gb|EDO95483.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160698017|gb|EDP87987.1| electron transfer flavoprotein, beta subunit [Burkholderia mallei
           ATCC 10399]
 gi|169652412|gb|EDS85105.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei S13]
 gi|184211643|gb|EDU08686.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 1655]
 gi|225930026|gb|EEH26039.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei Pakistan 9]
 gi|254218726|gb|EET08110.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 1710a]
          Length = 249

 Score =  281 bits (719), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+ESN+ ++PLS+AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSVGVAQAQETLRTALAIGADRAILVESNDEVQPLSVAKILKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALANLPQATFASKVTVADGKATVAREVDGGAETLSLTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVAPRLKTLKVVEPPKRAAGVKVADVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|134277474|ref|ZP_01764189.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 305]
 gi|217420379|ref|ZP_03451884.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 576]
 gi|237813280|ref|YP_002897731.1| electron transfer flavoprotein subunit beta (beta-etf)
           (electrontransfer flavoprotein small subunit) (etfss)
           [Burkholderia pseudomallei MSHR346]
 gi|238561676|ref|ZP_00441650.2| electron transfer flavoprotein, beta subunit [Burkholderia mallei
           GB8 horse 4]
 gi|242316926|ref|ZP_04815942.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 1106b]
 gi|251766988|ref|ZP_02265585.2| electron transfer flavoprotein, beta subunit [Burkholderia mallei
           PRL-20]
 gi|254203909|ref|ZP_04910269.1| electron transfer flavoprotein, beta subunit [Burkholderia mallei
           FMH]
 gi|254208889|ref|ZP_04915237.1| electron transfer flavoprotein, beta subunit [Burkholderia mallei
           JHU]
 gi|134251124|gb|EBA51203.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 305]
 gi|147745421|gb|EDK52501.1| electron transfer flavoprotein, beta subunit [Burkholderia mallei
           FMH]
 gi|147750765|gb|EDK57834.1| electron transfer flavoprotein, beta subunit [Burkholderia mallei
           JHU]
 gi|217395791|gb|EEC35808.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 576]
 gi|237506158|gb|ACQ98476.1| electron transfer flavoprotein subunit beta (beta-etf)
           (electrontransfer flavoprotein small subunit) (etfss)
           [Burkholderia pseudomallei MSHR346]
 gi|238524115|gb|EEP87550.1| electron transfer flavoprotein, beta subunit [Burkholderia mallei
           GB8 horse 4]
 gi|242140165|gb|EES26567.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei 1106b]
 gi|243064242|gb|EES46428.1| electron transfer flavoprotein, beta subunit [Burkholderia mallei
           PRL-20]
          Length = 251

 Score =  281 bits (719), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 3   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 62

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+ESN+ ++PLS+AKIL+ +V KE P +VI GKQ  
Sbjct: 63  VSVGVAQAQETLRTALAIGADRAILVESNDEVQPLSVAKILKALVDKEQPQLVILGKQAI 122

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V REV  G  T+   LPAV+T DL L
Sbjct: 123 DDDSNQTGQMLAALANLPQATFASKVTVADGKATVAREVDGGAETLSLTLPAVVTTDLRL 182

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PRLK L+  E      G+++     L+E
Sbjct: 183 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVAPRLKTLKVVEPPKRAAGVKVADVKTLVE 242

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 243 KLKTEAKVL 251


>gi|167903718|ref|ZP_02490923.1| electron transfer flavoprotein, beta subunit [Burkholderia
           pseudomallei NCTC 13177]
          Length = 249

 Score =  281 bits (719), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+ESN+ ++PLS+AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSVGVAQAQETLRTALAIGADRAILVESNDEVQPLSVAKILKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALANLPQATFASKVTVADGKATVAREVDGGAETLSLTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVVPRLKTLKVVEPPKRAAGVKVADVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|116689085|ref|YP_834708.1| electron transfer flavoprotein beta-subunit [Burkholderia
           cenocepacia HI2424]
 gi|170732373|ref|YP_001764320.1| electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           cenocepacia MC0-3]
 gi|116647174|gb|ABK07815.1| electron transfer flavoprotein beta-subunit [Burkholderia
           cenocepacia HI2424]
 gi|169815615|gb|ACA90198.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           cenocepacia MC0-3]
          Length = 249

 Score =  281 bits (719), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+ESN+++EPL++AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSVGVTQAQETLRTALAIGADRAILVESNDSVEPLAVAKILKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVTVADGKATVAREVDGGAETLSLTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVAPRLKTLKVVEPPKRAAGVKVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|107022140|ref|YP_620467.1| electron transfer flavoprotein beta-subunit [Burkholderia
           cenocepacia AU 1054]
 gi|105892329|gb|ABF75494.1| electron transfer flavoprotein beta-subunit [Burkholderia
           cenocepacia AU 1054]
          Length = 249

 Score =  281 bits (719), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+ESN+++EPL++AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSVGVTQAQETLRTALAIGADRAILVESNDSVEPLAVAKILKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVTVADGKATVAREVDGGAETLSLTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVAPRLKTLKVVEPLKRAAGVKVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|311109837|ref|YP_003982688.1| electron transfer flavoprotein subunit beta 3 [Achromobacter
           xylosoxidans A8]
 gi|310764526|gb|ADP19973.1| electron transfer flavoprotein subunit beta 3 [Achromobacter
           xylosoxidans A8]
          Length = 249

 Score =  281 bits (719), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 183/245 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+ +L+EKG ATEV+ 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDQTGVDIANVKMSMNPFDEIAVEEATRLKEKGAATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRG+L++++  L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGVLVQTDAELQPLAVAKLLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ WPQATF S +++ D  A VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDANQTGQMLAALLDWPQATFASKVELADGKATVTREVDGGLETLTLKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++     D  +D  PRLK L+  E  A + G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTVTPADLGVDPAPRLKTLKVSEPPARKAGIKVADVAALVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|254245976|ref|ZP_04939297.1| Electron transfer flavoprotein beta-subunit [Burkholderia
           cenocepacia PC184]
 gi|124870752|gb|EAY62468.1| Electron transfer flavoprotein beta-subunit [Burkholderia
           cenocepacia PC184]
          Length = 251

 Score =  281 bits (718), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 3   MKILVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 62

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+ESN+++EPL++AKIL+ +V KE P +VI GKQ  
Sbjct: 63  VSVGVTQAQETLRTALAIGADRAILVESNDSVEPLAVAKILKALVDKEQPQLVILGKQAI 122

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V REV  G  T+   LPAV+T DL L
Sbjct: 123 DDDSNQTGQMLAALAGLPQATFASKVTVADGKATVAREVDGGAETLSLTLPAVVTTDLRL 182

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PRLK L+  E      G+++     L+E
Sbjct: 183 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVAPRLKTLKVVEPPKRAAGVKVPDVKTLVE 242

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 243 KLKTEAKVL 251


>gi|295677261|ref|YP_003605785.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           CCGE1002]
 gi|295437104|gb|ADG16274.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           CCGE1002]
          Length = 249

 Score =  281 bits (718), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR ILIESNE L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSAGVTQSQETLRTALAIGADRAILIESNEELQPLAVAKLLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V+REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALANLPQATFASKVIVADGKATVSREVDGGAETLSLTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+TPRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETIKPEDLGVDVTPRLKTLKVAEPPKRSAGVKVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|254252912|ref|ZP_04946230.1| Electron transfer flavoprotein beta-subunit [Burkholderia dolosa
           AUO158]
 gi|124895521|gb|EAY69401.1| Electron transfer flavoprotein beta-subunit [Burkholderia dolosa
           AUO158]
          Length = 251

 Score =  281 bits (718), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEV+ 
Sbjct: 3   MKILVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVVA 62

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E L+ +LA+GADR IL+ESN+++EPL++AKIL+ +V KE P +VI GKQ  
Sbjct: 63  VSIGVAQAQETLRTALAIGADRAILVESNDSVEPLAVAKILKALVDKEQPQLVILGKQAI 122

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + I D  A V REV  G  T+   LPAV+T DL L
Sbjct: 123 DDDSNQTGQMLAALAGLPQATFASKVTIADGKATVAREVDGGAETLSLKLPAVVTTDLRL 182

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PR+K L+  E      G+++     L+E
Sbjct: 183 NEPRYVTLPNIMKAKKKPLETLKPEDLGVDVAPRMKTLKVVEPPKRAAGVKVPDVKTLVE 242

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 243 KLKTEAKVL 251


>gi|17986380|ref|NP_539014.1| electron transfer flavoprotein subunit beta [Brucella melitensis
           bv. 1 str. 16M]
 gi|23502819|ref|NP_698946.1| electron transfer flavoprotein subunit beta [Brucella suis 1330]
 gi|148559192|ref|YP_001259788.1| electron transfer flavoprotein subunit beta [Brucella ovis ATCC
           25840]
 gi|161619889|ref|YP_001593776.1| electron transfer flavoprotein subunit beta [Brucella canis ATCC
           23365]
 gi|163843993|ref|YP_001628397.1| electron transfer flavoprotein subunit beta [Brucella suis ATCC
           23445]
 gi|225853407|ref|YP_002733640.1| electron transfer flavoprotein subunit beta [Brucella melitensis
           ATCC 23457]
 gi|254700609|ref|ZP_05162437.1| Electron transfer flavoprotein subunit beta [Brucella suis bv. 5
           str. 513]
 gi|254704979|ref|ZP_05166807.1| Electron transfer flavoprotein subunit beta [Brucella suis bv. 3
           str. 686]
 gi|254708858|ref|ZP_05170669.1| Electron transfer flavoprotein subunit beta [Brucella pinnipedialis
           B2/94]
 gi|254713617|ref|ZP_05175428.1| Electron transfer flavoprotein subunit beta [Brucella ceti
           M644/93/1]
 gi|254716029|ref|ZP_05177840.1| Electron transfer flavoprotein subunit beta [Brucella ceti
           M13/05/1]
 gi|256030385|ref|ZP_05443999.1| Electron transfer flavoprotein subunit beta [Brucella pinnipedialis
           M292/94/1]
 gi|256045572|ref|ZP_05448453.1| Electron transfer flavoprotein subunit beta [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256059942|ref|ZP_05450127.1| Electron transfer flavoprotein subunit beta [Brucella neotomae
           5K33]
 gi|256112299|ref|ZP_05453220.1| Electron transfer flavoprotein subunit beta [Brucella melitensis
           bv. 3 str. Ether]
 gi|256158467|ref|ZP_05456365.1| Electron transfer flavoprotein subunit beta [Brucella ceti
           M490/95/1]
 gi|256253886|ref|ZP_05459422.1| Electron transfer flavoprotein subunit beta [Brucella ceti B1/94]
 gi|256263113|ref|ZP_05465645.1| electron transfer flavoprotein beta-subunit [Brucella melitensis
           bv. 2 str. 63/9]
 gi|256370373|ref|YP_003107884.1| electron transfer flavoprotein, beta subunit [Brucella microti CCM
           4915]
 gi|260562883|ref|ZP_05833369.1| electron transfer flavoprotein beta-subunit [Brucella melitensis
           bv. 1 str. 16M]
 gi|260567547|ref|ZP_05838017.1| electron transfer flavoprotein beta-subunit [Brucella suis bv. 4
           str. 40]
 gi|261217797|ref|ZP_05932078.1| electron transfer flavoprotein alpha/beta-subunit [Brucella ceti
           M13/05/1]
 gi|261221023|ref|ZP_05935304.1| electron transfer flavoprotein alpha/beta-subunit [Brucella ceti
           B1/94]
 gi|261316351|ref|ZP_05955548.1| electron transfer flavoprotein alpha/beta-subunit [Brucella
           pinnipedialis B2/94]
 gi|261321355|ref|ZP_05960552.1| electron transfer flavoprotein alpha/beta-subunit [Brucella ceti
           M644/93/1]
 gi|261323914|ref|ZP_05963111.1| electron transfer flavoprotein alpha/beta-subunit [Brucella
           neotomae 5K33]
 gi|261751118|ref|ZP_05994827.1| electron transfer flavoprotein alpha/beta-subunit [Brucella suis
           bv. 5 str. 513]
 gi|261755680|ref|ZP_05999389.1| electron transfer flavoprotein alpha/beta-subunit [Brucella suis
           bv. 3 str. 686]
 gi|265987423|ref|ZP_06099980.1| electron transfer flavoprotein alpha/beta-subunit [Brucella
           pinnipedialis M292/94/1]
 gi|265991997|ref|ZP_06104554.1| electron transfer flavoprotein alpha/beta-subunit [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|265993732|ref|ZP_06106289.1| electron transfer flavoprotein alpha/beta-subunit [Brucella
           melitensis bv. 3 str. Ether]
 gi|265996983|ref|ZP_06109540.1| electron transfer flavoprotein alpha/beta-subunit [Brucella ceti
           M490/95/1]
 gi|294851209|ref|ZP_06791882.1| electron transfer flavoprotein beta subunit [Brucella sp. NVSL
           07-0026]
 gi|17981970|gb|AAL51278.1| electron transfer flavoprotein beta-subunit [Brucella melitensis
           bv. 1 str. 16M]
 gi|23348843|gb|AAN30861.1| electron transfer flavoprotein, beta subunit [Brucella suis 1330]
 gi|148370449|gb|ABQ60428.1| electron transfer flavoprotein, beta subunit [Brucella ovis ATCC
           25840]
 gi|161336700|gb|ABX63005.1| Electron transfer flavoprotein subunit beta [Brucella canis ATCC
           23365]
 gi|163674716|gb|ABY38827.1| Electron transfer flavoprotein subunit beta [Brucella suis ATCC
           23445]
 gi|225641772|gb|ACO01686.1| Electron transfer flavoprotein subunit beta [Brucella melitensis
           ATCC 23457]
 gi|256000536|gb|ACU48935.1| electron transfer flavoprotein, beta subunit [Brucella microti CCM
           4915]
 gi|260152899|gb|EEW87991.1| electron transfer flavoprotein beta-subunit [Brucella melitensis
           bv. 1 str. 16M]
 gi|260157065|gb|EEW92145.1| electron transfer flavoprotein beta-subunit [Brucella suis bv. 4
           str. 40]
 gi|260919607|gb|EEX86260.1| electron transfer flavoprotein alpha/beta-subunit [Brucella ceti
           B1/94]
 gi|260922886|gb|EEX89454.1| electron transfer flavoprotein alpha/beta-subunit [Brucella ceti
           M13/05/1]
 gi|261294045|gb|EEX97541.1| electron transfer flavoprotein alpha/beta-subunit [Brucella ceti
           M644/93/1]
 gi|261295574|gb|EEX99070.1| electron transfer flavoprotein alpha/beta-subunit [Brucella
           pinnipedialis B2/94]
 gi|261299894|gb|EEY03391.1| electron transfer flavoprotein alpha/beta-subunit [Brucella
           neotomae 5K33]
 gi|261740871|gb|EEY28797.1| electron transfer flavoprotein alpha/beta-subunit [Brucella suis
           bv. 5 str. 513]
 gi|261745433|gb|EEY33359.1| electron transfer flavoprotein alpha/beta-subunit [Brucella suis
           bv. 3 str. 686]
 gi|262551451|gb|EEZ07441.1| electron transfer flavoprotein alpha/beta-subunit [Brucella ceti
           M490/95/1]
 gi|262764713|gb|EEZ10634.1| electron transfer flavoprotein alpha/beta-subunit [Brucella
           melitensis bv. 3 str. Ether]
 gi|263003063|gb|EEZ15356.1| electron transfer flavoprotein alpha/beta-subunit [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|263093014|gb|EEZ17164.1| electron transfer flavoprotein beta-subunit [Brucella melitensis
           bv. 2 str. 63/9]
 gi|264659620|gb|EEZ29881.1| electron transfer flavoprotein alpha/beta-subunit [Brucella
           pinnipedialis M292/94/1]
 gi|294819798|gb|EFG36797.1| electron transfer flavoprotein beta subunit [Brucella sp. NVSL
           07-0026]
 gi|326409970|gb|ADZ67035.1| electron transfer flavoprotein subunit beta [Brucella melitensis
           M28]
 gi|326539687|gb|ADZ87902.1| electron transfer flavoprotein subunit beta [Brucella melitensis
           M5-90]
          Length = 248

 Score =  280 bits (717), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 126/244 (51%), Positives = 185/244 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN K+R+K D SG+E  N K+SMNPFDEIA+EE+++L+E G  TE++ 
Sbjct: 1   MKVLVAVKRVVDYNVKIRVKGDGSGVELANVKMSMNPFDEIAVEEAIRLKEAGKVTEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LAMGADR IL++++ET+EPL +AK+L+ +V+ E P +V  GKQ  
Sbjct: 61  VSVGPAQAQETLRTALAMGADRAILVKTDETVEPLGVAKVLKGVVEAEKPDLVFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQML+AL+ W QATF S +++ +  A VTREV  G  T++  LPA++TVDL L
Sbjct: 121 DDDSNQTGQMLSALLNWSQATFASKVELGEGSAKVTREVDGGLQTIDVKLPAIVTVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N+PRY SLPNI+KA+KK +++K   DF  D+ PRLKVL+ EE    + G+++ S ++L+E
Sbjct: 181 NQPRYASLPNIMKAKKKPLDEKSPADFGADIAPRLKVLKTEEPGGRKAGVKVGSVSELVE 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKA 244


>gi|161525412|ref|YP_001580424.1| electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           multivorans ATCC 17616]
 gi|189349851|ref|YP_001945479.1| electron transfer flavoprotein subunit beta [Burkholderia
           multivorans ATCC 17616]
 gi|160342841|gb|ABX15927.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           multivorans ATCC 17616]
 gi|189333873|dbj|BAG42943.1| electron transfer flavoprotein beta subunit [Burkholderia
           multivorans ATCC 17616]
          Length = 249

 Score =  280 bits (717), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEV+ 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+ESN+ +EPL++AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSVGVAQAQETLRTALAIGADRAILVESNDGVEPLAVAKILKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + I D  A V REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVTIADGKATVAREVDGGAETLSLTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVAPRLKTLKVVEPPKRAAGVKVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|225628170|ref|ZP_03786205.1| Electron transfer flavoprotein subunit beta [Brucella ceti str.
           Cudo]
 gi|225628997|ref|ZP_03787031.1| Electron transfer flavoprotein subunit beta [Brucella ceti str.
           Cudo]
 gi|260169294|ref|ZP_05756105.1| electron transfer flavoprotein, beta subunit [Brucella sp. F5/99]
 gi|261758806|ref|ZP_06002515.1| electron transfer flavoprotein beta-subunit [Brucella sp. F5/99]
 gi|225616843|gb|EEH13891.1| Electron transfer flavoprotein subunit beta [Brucella ceti str.
           Cudo]
 gi|225616995|gb|EEH14042.1| Electron transfer flavoprotein subunit beta [Brucella ceti str.
           Cudo]
 gi|261738790|gb|EEY26786.1| electron transfer flavoprotein beta-subunit [Brucella sp. F5/99]
          Length = 248

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 126/244 (51%), Positives = 185/244 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN K+R+K D SG+E  N K+SMNPFDEIA+EE+++L+E G  TE++ 
Sbjct: 1   MKVLVAVKRVVDYNVKIRVKGDGSGVELANVKMSMNPFDEIAVEEAIRLKEAGKVTEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LAMGADR IL++++ET+EPL +AK+L+ +V+ E P +V  GKQ  
Sbjct: 61  VSVGPAQAQETLRTALAMGADRAILVKTDETVEPLGVAKVLKGVVEAEKPDLVFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQML+AL+ W QATF S +++ +  A VTREV  G  T++  LPA++TVDL L
Sbjct: 121 DDDSNQTGQMLSALLNWSQATFASKVELGEGSAKVTREVDGGLQTIDMKLPAIVTVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N+PRY SLPNI+KA+KK +++K   DF  D+ PRLKVL+ EE    + G+++ S ++L+E
Sbjct: 181 NQPRYASLPNIMKAKKKPLDEKSPADFGADIAPRLKVLKTEEPGGRKAGVKVGSVSELVE 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKA 244


>gi|78065647|ref|YP_368416.1| electron transfer flavoprotein subunit beta [Burkholderia sp. 383]
 gi|77966392|gb|ABB07772.1| Electron transfer flavoprotein beta-subunit [Burkholderia sp. 383]
          Length = 249

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 181/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+ESN+ +EPL +AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSVGVAQAQETLRTALAIGADRAILVESNDGVEPLGVAKILKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V REV  G  T+   LPAVIT DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVTVADGKATVAREVDGGAETLSLSLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVAPRLKTLKVVEPPKRAAGVKVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|254718021|ref|ZP_05179832.1| Electron transfer flavoprotein subunit beta [Brucella sp. 83/13]
 gi|265982969|ref|ZP_06095704.1| electron transfer flavoprotein alpha/beta-subunit [Brucella sp.
           83/13]
 gi|306839802|ref|ZP_07472603.1| Electron transfer flavoprotein subunit beta [Brucella sp. NF 2653]
 gi|306842893|ref|ZP_07475529.1| Electron transfer flavoprotein subunit beta [Brucella sp. BO2]
 gi|306843408|ref|ZP_07476009.1| Electron transfer flavoprotein subunit beta [Brucella sp. BO1]
 gi|264661561|gb|EEZ31822.1| electron transfer flavoprotein alpha/beta-subunit [Brucella sp.
           83/13]
 gi|306276099|gb|EFM57799.1| Electron transfer flavoprotein subunit beta [Brucella sp. BO1]
 gi|306286916|gb|EFM58436.1| Electron transfer flavoprotein subunit beta [Brucella sp. BO2]
 gi|306405157|gb|EFM61435.1| Electron transfer flavoprotein subunit beta [Brucella sp. NF 2653]
          Length = 248

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 126/244 (51%), Positives = 184/244 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN K+R+K D SG+E  N K+SMNPFDEIA+EE+++L+E G  TE++ 
Sbjct: 1   MKVLVAVKRVVDYNVKIRVKGDGSGVELANVKMSMNPFDEIAVEEAIRLKEAGKVTEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LAMGADR IL++++ET+EPL +AK+L+ +V+ E P +V  GKQ  
Sbjct: 61  VSVGPAQAQETLRTALAMGADRAILVKTDETVEPLGVAKVLKGVVEAEKPDLVFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQML+AL+ W QATF S +++ +  A VTREV  G  T++  LPA++TVDL L
Sbjct: 121 DDDSNQTGQMLSALLNWSQATFASKVELGEGSAKVTREVDGGLQTIDVKLPAIVTVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N+PRY SLPNI+KA+KK +++K   DF  D+ PRLKVL+ EE    + G+++ S  +L+E
Sbjct: 181 NQPRYASLPNIMKAKKKPLDEKSPADFGADIAPRLKVLKTEEPGGRKAGVKVGSVAELVE 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKA 244


>gi|332716383|ref|YP_004443849.1| electron transfer flavoprotein beta subunit [Agrobacterium sp.
           H13-3]
 gi|325063068|gb|ADY66758.1| electron transfer flavoprotein beta subunit [Agrobacterium sp.
           H13-3]
          Length = 248

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 185/244 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K+D SG+E  N K+SMNPFDEI++EE+L+L+E G A EV+V
Sbjct: 1   MKILVPVKRVVDYNVKIRVKSDGSGVELANVKMSMNPFDEISVEEALRLKEAGKAEEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR ILIE++ET+EPL++AK+L+ + + E P +VI GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILIETDETVEPLAVAKLLKGVAEAEQPGLVIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W Q TF S +   D    VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWGQGTFASKVVPSDGKVAVTREVDGGLQTVELKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +D+TPRLKVL+ EE    + G+R+ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKTPADFGVDVTPRLKVLKTEEPAGRKAGIRVGSVAELVE 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKA 244


>gi|221201276|ref|ZP_03574316.1| electron transfer flavoprotein, beta subunit [Burkholderia
           multivorans CGD2M]
 gi|221206270|ref|ZP_03579283.1| electron transfer flavoprotein, beta subunit [Burkholderia
           multivorans CGD2]
 gi|221213549|ref|ZP_03586523.1| electron transfer flavoprotein, beta subunit [Burkholderia
           multivorans CGD1]
 gi|221166338|gb|EED98810.1| electron transfer flavoprotein, beta subunit [Burkholderia
           multivorans CGD1]
 gi|221173579|gb|EEE06013.1| electron transfer flavoprotein, beta subunit [Burkholderia
           multivorans CGD2]
 gi|221179126|gb|EEE11533.1| electron transfer flavoprotein, beta subunit [Burkholderia
           multivorans CGD2M]
          Length = 251

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEV+ 
Sbjct: 3   MKILVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVVA 62

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+ESN+ +EPL++AKIL+ +V KE P +VI GKQ  
Sbjct: 63  VSVGVAQAQETLRTALAIGADRAILVESNDGVEPLAVAKILKALVDKEQPQLVILGKQAI 122

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + I D  A V REV  G  T+   LPAV+T DL L
Sbjct: 123 DDDSNQTGQMLAALAGLPQATFASKVTIADGKATVAREVDGGAETLSLTLPAVVTTDLRL 182

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PRLK L+  E      G+++     L+E
Sbjct: 183 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVAPRLKTLKVVEPPKRAAGVKVPDVKTLVE 242

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 243 KLKTEAKVL 251


>gi|206561270|ref|YP_002232035.1| electron transfer flavoprotein beta-subunit [Burkholderia
           cenocepacia J2315]
 gi|198037312|emb|CAR53235.1| electron transfer flavoprotein beta-subunit [Burkholderia
           cenocepacia J2315]
          Length = 249

 Score =  280 bits (716), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+ESN+++EPL++AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSVGVTQAQETLRTALAIGADRAILVESNDSVEPLAVAKILKVLVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVTVADGKATVAREVDGGAETLSLTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVAPRLKTLKVVEPPKRAAGVKVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|254505255|ref|ZP_05117406.1| electron transfer flavoprotein domain [Labrenzia alexandrii DFL-11]
 gi|222441326|gb|EEE48005.1| electron transfer flavoprotein domain [Labrenzia alexandrii DFL-11]
          Length = 249

 Score =  280 bits (716), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 186/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K VI+YN KVR+K D SG++  N K+SMNPFDEI++EE+L+L+E G ATEV+V
Sbjct: 1   MKILVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEISVEEALRLKEAGKATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  +  E L+  LAMGADRGIL++++ET EPL++AKIL+ IV+ E P +VI GKQ  
Sbjct: 61  VSVGPQQATETLRTGLAMGADRGILVKTDETTEPLAVAKILKGIVEAEEPGLVIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQML+AL+ W Q TF S + + D+   VTREV  G  T++  LPA++T DL L
Sbjct: 121 DDDCNQTGQMLSALLGWSQGTFASKVDLGDSTVDVTREVDGGLQTVKLKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I++K   D+ +D+TPRL V+   E  A   G+++ S ++L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPIDEKTPDDYGVDITPRLTVVTTAEPAAREAGIKVGSVSELVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|134295094|ref|YP_001118829.1| electron transfer flavoprotein subunit beta [Burkholderia
           vietnamiensis G4]
 gi|134138251|gb|ABO53994.1| electron transfer flavoprotein beta-subunit [Burkholderia
           vietnamiensis G4]
          Length = 249

 Score =  280 bits (716), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 131/249 (52%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEV+ 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+ES + +EPL++AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSVGVTQAQETLRTALAIGADRAILVESTDGVEPLAVAKILKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVTVADGKATVAREVDGGAETLSLTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+TPRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVTPRLKTLKVAEPPKRAAGVKVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|56479157|ref|YP_160746.1| electron transfer flavoprotein, beta-subunit [Aromatoleum
           aromaticum EbN1]
 gi|56315200|emb|CAI09845.1| Electron transfer flavoprotein, beta-subunit [Aromatoleum
           aromaticum EbN1]
          Length = 249

 Score =  280 bits (715), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 181/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E GIATEV+ 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAIEEAVRLKEAGIATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G    +E L+ ++A+GADRGIL+E++  L+PL++AK+L+ +  KE P +VI GKQ  
Sbjct: 61  VSCGVAACQETLRAAMAIGADRGILVETDVELQPLAVAKLLKALCDKEAPQVVICGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAALM WPQATF S + I    A VTRE+  G  T+E  LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALMSWPQATFASKLVIAGGAATVTREIDGGLETLEIKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +LPNI+KA+KK +E  K  D  +D+ PRL  L+  E      G+R+    +L++
Sbjct: 181 NEPRYATLPNIMKAKKKPLETVKPADLGVDVAPRLATLKVVEPAKRSAGVRVADVAQLVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|323526938|ref|YP_004229091.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           CCGE1001]
 gi|323383940|gb|ADX56031.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           CCGE1001]
          Length = 249

 Score =  280 bits (715), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR ILIESNE L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSAGVTQSQETLRTALAIGADRAILIESNEELQPLAVAKLLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V+REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVVVADGKATVSREVDGGAETLSLTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+TPRL+ L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETIKPEDLGVDVTPRLQTLKVAEPPKRSAGVKVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|222149950|ref|YP_002550907.1| electron transfer flavoprotein beta subunit [Agrobacterium vitis
           S4]
 gi|221736932|gb|ACM37895.1| electron transfer flavoprotein beta subunit [Agrobacterium vitis
           S4]
          Length = 249

 Score =  280 bits (715), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 141/249 (56%), Positives = 188/249 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K D SG+E  N K+SMNPFDEI++EE+L+L+E G A EV+V
Sbjct: 1   MKILVPVKRVVDYNVKIRVKPDGSGVELANVKMSMNPFDEISVEEALRLKEAGKAEEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+ + +EPL++AKIL+ IV+ E P ++I GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILVETEDAVEPLAVAKILKGIVEAEAPGLIIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W QATF S ++I D  A VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWAQATFASKLEIGDGSANVTREVDGGLQTIAVKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +D TPRLKVL+ EE    + G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKTPADFGVDTTPRLKVLKTEEPGGRKAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|328541740|ref|YP_004301849.1| electron transfer flavoprotein beta subunit-like protein
           [polymorphum gilvum SL003B-26A1]
 gi|326411492|gb|ADZ68555.1| Electron transfer flavoprotein beta subunit-like protein
           [Polymorphum gilvum SL003B-26A1]
          Length = 249

 Score =  279 bits (713), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 186/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K VI+YN KVR+K D SG++  N K+SMNPFDEI++EE+L+L+E G A+EV+V
Sbjct: 1   MKILVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEISVEEALRLKEAGKASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E L+  LAMGADRGIL++++ T EPL++AKIL++IV +E P +VI GKQ  
Sbjct: 61  VSIGPAQATETLRTGLAMGADRGILVKTDATTEPLAVAKILKKIVDEEQPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL+ W Q TF S + + D    VTREV  G  T++  LPA++T DL L
Sbjct: 121 DDDCNQTGQMLAALLGWGQGTFASKVDLGDGTVDVTREVDGGLQTVKLKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I++K   D+ +D++PRL V++  E  A + G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPIDEKTPEDYGVDVSPRLSVVKTAEPAARQAGVKVGSVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|15891345|ref|NP_357017.1| electron transfer flavoprotein beta subunit [Agrobacterium
           tumefaciens str. C58]
 gi|15159730|gb|AAK89802.1| electron transfer flavoprotein beta subunit [Agrobacterium
           tumefaciens str. C58]
          Length = 248

 Score =  279 bits (713), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 138/244 (56%), Positives = 185/244 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K+D SG+E  N K+SMNPFDEI++EE+L+L+E G A EV+V
Sbjct: 1   MKILVPVKRVVDYNVKIRVKSDGSGVELANVKMSMNPFDEISVEEALRLKEAGKAEEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR ILIE++ET+EPL++AK+L+ + + E P +VI GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILIETDETVEPLAVAKLLKGVAEAEQPGLVIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W Q TF S +   D    VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWGQGTFASKVVPADGKVAVTREVDGGLQTVELKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +D++PRLKVL+ EE    + G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKAPADFGVDVSPRLKVLKTEEPAGRKAGIKVGSVAELVE 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKA 244


>gi|260576305|ref|ZP_05844297.1| Electron transfer flavoprotein alpha/beta-subunit [Rhodobacter sp.
           SW2]
 gi|259021573|gb|EEW24877.1| Electron transfer flavoprotein alpha/beta-subunit [Rhodobacter sp.
           SW2]
          Length = 253

 Score =  279 bits (713), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 186/253 (73%), Gaps = 4/253 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D +G++  N K+SMNPFDEIA+E++++LRE G A+EVIV
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGTGVDLANVKMSMNPFDEIAVEQAIRLREAGTASEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIES----NETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR ILIE+    +  +EPL++AK+L  +V+ E P +V+ G
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILIEAASDVHTDIEPLAVAKLLAAVVRDEAPGLVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQMLAAL+ W QATF+S + I  +HA+VTREV  G  ++   +P++ITV
Sbjct: 121 KQAIDNDMNATGQMLAALLGWSQATFISELAIEGDHALVTREVDGGLQSIRVTMPSIITV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +E+K A D+ +D++PRL VL+  E    + G+R+ S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLEEKTAADYGVDVSPRLSVLKTTEPAGRKAGVRVASVA 240

Query: 237 KLIEILKSKHDLL 249
            L+  LK +  +L
Sbjct: 241 DLVAKLKDEAGVL 253


>gi|167563611|ref|ZP_02356527.1| Electron transfer flavoprotein beta-subunit [Burkholderia
           oklahomensis EO147]
 gi|167570774|ref|ZP_02363648.1| Electron transfer flavoprotein beta-subunit [Burkholderia
           oklahomensis C6786]
          Length = 249

 Score =  279 bits (713), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 131/249 (52%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKTDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+ESN+ ++PL +AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSVGVAQAQETLRTALAIGADRAILVESNDEVQPLGVAKILKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALANLPQATFASKVTVADGRATVAREVDGGAETLSLQLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVAPRLKTLKVVEPPKRAAGVKVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|62290819|ref|YP_222612.1| electron transfer flavoprotein subunit beta [Brucella abortus bv. 1
           str. 9-941]
 gi|82700731|ref|YP_415305.1| electron transfer flavoprotein subunit beta [Brucella melitensis
           biovar Abortus 2308]
 gi|189025038|ref|YP_001935806.1| Electron transfer flavoprotein beta-subunit [Brucella abortus S19]
 gi|237816333|ref|ZP_04595326.1| Electron transfer flavoprotein subunit beta [Brucella abortus str.
           2308 A]
 gi|254690109|ref|ZP_05153363.1| Electron transfer flavoprotein beta-subunit [Brucella abortus bv. 6
           str. 870]
 gi|254694599|ref|ZP_05156427.1| Electron transfer flavoprotein beta-subunit [Brucella abortus bv. 3
           str. Tulya]
 gi|254696224|ref|ZP_05158052.1| Electron transfer flavoprotein beta-subunit [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254731142|ref|ZP_05189720.1| Electron transfer flavoprotein beta-subunit [Brucella abortus bv. 4
           str. 292]
 gi|256258363|ref|ZP_05463899.1| Electron transfer flavoprotein beta-subunit [Brucella abortus bv. 9
           str. C68]
 gi|260546086|ref|ZP_05821826.1| electron transfer flavoprotein beta-subunit [Brucella abortus NCTC
           8038]
 gi|260755648|ref|ZP_05867996.1| electron transfer flavoprotein alpha/beta-subunit [Brucella abortus
           bv. 6 str. 870]
 gi|260758873|ref|ZP_05871221.1| electron transfer flavoprotein alpha/beta-subunit [Brucella abortus
           bv. 4 str. 292]
 gi|260760597|ref|ZP_05872940.1| electron transfer flavoprotein alpha/beta-subunit [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260884673|ref|ZP_05896287.1| electron transfer flavoprotein alpha/beta-subunit [Brucella abortus
           bv. 9 str. C68]
 gi|261214923|ref|ZP_05929204.1| electron transfer flavoprotein alpha/beta-subunit [Brucella abortus
           bv. 3 str. Tulya]
 gi|297247205|ref|ZP_06930923.1| electron transfer flavoprotein subunit beta [Brucella abortus bv. 5
           str. B3196]
 gi|62196951|gb|AAX75251.1| EtfB, electron transfer flavoprotein, beta subunit [Brucella
           abortus bv. 1 str. 9-941]
 gi|82616832|emb|CAJ11928.1| Electron transfer flavoprotein beta-subunit [Brucella melitensis
           biovar Abortus 2308]
 gi|189020610|gb|ACD73332.1| Electron transfer flavoprotein beta-subunit [Brucella abortus S19]
 gi|237788400|gb|EEP62615.1| Electron transfer flavoprotein subunit beta [Brucella abortus str.
           2308 A]
 gi|260096193|gb|EEW80069.1| electron transfer flavoprotein beta-subunit [Brucella abortus NCTC
           8038]
 gi|260669191|gb|EEX56131.1| electron transfer flavoprotein alpha/beta-subunit [Brucella abortus
           bv. 4 str. 292]
 gi|260671029|gb|EEX57850.1| electron transfer flavoprotein alpha/beta-subunit [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260675756|gb|EEX62577.1| electron transfer flavoprotein alpha/beta-subunit [Brucella abortus
           bv. 6 str. 870]
 gi|260874201|gb|EEX81270.1| electron transfer flavoprotein alpha/beta-subunit [Brucella abortus
           bv. 9 str. C68]
 gi|260916530|gb|EEX83391.1| electron transfer flavoprotein alpha/beta-subunit [Brucella abortus
           bv. 3 str. Tulya]
 gi|297174374|gb|EFH33721.1| electron transfer flavoprotein subunit beta [Brucella abortus bv. 5
           str. B3196]
          Length = 248

 Score =  278 bits (712), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 125/244 (51%), Positives = 185/244 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN K+R+K D SG+E  N K+S+NPFDEIA+EE+++L+E G  TE++ 
Sbjct: 1   MKVLVAVKRVVDYNVKIRVKGDGSGVELANVKMSINPFDEIAVEEAIRLKEAGKVTEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LAMGADR IL++++ET+EPL +AK+L+ +V+ E P +V  GKQ  
Sbjct: 61  VSVGPAQAQETLRTALAMGADRAILVKTDETVEPLGVAKVLKGVVEAEKPDLVFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQML+AL+ W QATF S +++ +  A VTREV  G  T++  LPA++TVDL L
Sbjct: 121 DDDSNQTGQMLSALLNWSQATFASKVELGEGSAKVTREVDGGLQTIDVKLPAIVTVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N+PRY SLPNI+KA+KK +++K   DF  D+ PRLKVL+ EE    + G+++ S ++L+E
Sbjct: 181 NQPRYASLPNIMKAKKKPLDEKSPADFGADIAPRLKVLKTEEPGGRKAGVKVGSVSELVE 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKA 244


>gi|300704736|ref|YP_003746339.1| electron transfer flavoprotein, beta-subunit [Ralstonia
           solanacearum CFBP2957]
 gi|299072400|emb|CBJ43745.1| Electron transfer flavoprotein, beta-subunit [Ralstonia
           solanacearum CFBP2957]
          Length = 249

 Score =  278 bits (711), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+YN KVR+K+D SG++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKVLVAVKRVIDYNVKVRVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G+ + +E L+ ++A+GADRGIL+E+NE L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGAAQCQETLRTAMAIGADRGILVETNEELQPLAVAKLLKALVDKEQPQLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S ++I D  A VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDANQTGQMLAALAGLPQATFASKVQIADGKASVTREVDGGLETLSVKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+ PRLK L+  E      G+ +     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTVKPEDLGVDVAPRLKTLKVAEPPKRSAGVMVPDVATLVA 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|114570913|ref|YP_757593.1| electron transfer flavoprotein subunit beta [Maricaulis maris
           MCS10]
 gi|114341375|gb|ABI66655.1| electron transfer flavoprotein beta-subunit [Maricaulis maris
           MCS10]
          Length = 249

 Score =  278 bits (711), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 185/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K D +G++  N K+SMNPF EIA+EE+++L+EKG+A E+IV
Sbjct: 1   MKILVPVKRVVDYNVKVRVKPDQTGVDLANVKMSMNPFCEIAVEEAIRLKEKGVAEEIIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E ++ +LAMGADRGILI++++ +EPL++AK+L+ +V +E+P IV+ GKQ  
Sbjct: 61  VSVGPAQAQETIRTALAMGADRGILIQTDDAVEPLAVAKLLKAVVDEESPEIVLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAAL+ WPQ TF S + I D  A VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DGDNNQTGQMLAALLDWPQGTFASEVTIADGKATVTREIDGGLQTLSLTLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K I+ K   D+ +D  PRL V++  E      G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKRKPIDTKAPADYGVDTAPRLSVVKVTEPPKREAGIKVESVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAGVI 249


>gi|238026551|ref|YP_002910782.1| Electron transfer flavoprotein subunit beta [Burkholderia glumae
           BGR1]
 gi|237875745|gb|ACR28078.1| Electron transfer flavoprotein beta-subunit [Burkholderia glumae
           BGR1]
          Length = 249

 Score =  278 bits (710), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 131/249 (52%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G ATEV+ 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGTATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E L+ +LA+GADR IL+E+ + +EPL++AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSIGVAQAQETLRTALAIGADRAILVEAGDGVEPLAVAKILKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + I D  A V REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVTIADGKATVAREVDGGAETLALTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLENVKPEDLGVDVAPRLKTLKVAEPPKRAAGVKVADVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|114328758|ref|YP_745915.1| electron transfer flavoprotein beta-subunit [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316932|gb|ABI62992.1| electron transfer flavoprotein beta-subunit [Granulibacter
           bethesdensis CGDNIH1]
          Length = 283

 Score =  278 bits (710), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN +VR++ D +G+ET   K+SMNPFDEIA+EE+++L+EKG+ATE++V
Sbjct: 35  MKILVPVKRVVDYNVQVRVRADGTGVETAGVKMSMNPFDEIAVEEAVRLKEKGVATEIVV 94

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + ++ L+  +AMGADRGIL++  ET+EPL +AKILR +V++E P +V+ GKQ  
Sbjct: 95  VSVGPAQAQDTLRTGMAMGADRGILVQVEETVEPLGVAKILRALVQQEQPGLVVMGKQAI 154

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ N TGQMLAAL+ WPQ TF S + + +    VTRE+  G  T++  LPAV+T DL L
Sbjct: 155 DDDMNATGQMLAALLGWPQGTFASAVAVENGGITVTREIDGGAQTVQLSLPAVVTADLRL 214

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I+     D  +D +PRL VLR  E    + G+++ S  +L+ 
Sbjct: 215 NEPRYASLPNIMKAKKKPIQTMTPADLGVDASPRLTVLRVAEPPPRQGGVKVGSVDELVS 274

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 275 KLKTEAKVI 283


>gi|163856210|ref|YP_001630508.1| electron transfer flavoprotein, beta-subunit [Bordetella petrii DSM
           12804]
 gi|163259938|emb|CAP42239.1| electron transfer flavoprotein, beta-subunit [Bordetella petrii]
          Length = 249

 Score =  277 bits (709), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 184/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+ +L+EKG ATEV+ 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDQTGVDIANVKMSMNPFDEIAVEEATRLKEKGGATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL++++  L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGILVQTDAELQPLAVAKLLKGLVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ WPQATF S +++ D    VTREV  G  T++  LPA++T DL L
Sbjct: 121 DDDANQTGQMLAALLDWPQATFASKVELADGEVTVTREVDGGLETLKLKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E     D  +D  PRLK L+  E  A + G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVTPQDLGVDAAPRLKTLKVTEPPARKAGIKVADVATLVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAKVL 249


>gi|91784795|ref|YP_560001.1| electron transfer flavoprotein subunit beta [Burkholderia
           xenovorans LB400]
 gi|91688749|gb|ABE31949.1| Electron transfer flavoprotein, beta-subunit [Burkholderia
           xenovorans LB400]
          Length = 249

 Score =  277 bits (709), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR ILIES E L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSAGVTQSQETLRTALAIGADRAILIESGEELQPLAVAKLLKALVDKEQPQLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V+REV  G  T+   LPAVIT DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVVVADGKATVSREVDGGAETLSLTLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+TPRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETIKPEDLGVDVTPRLKTLKVVEPPKRSAGVKVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|296114284|ref|ZP_06832938.1| electron transfer flavoprotein subunit beta [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295979045|gb|EFG85769.1| electron transfer flavoprotein subunit beta [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 249

 Score =  277 bits (709), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN K R+K D +G+ET   K+SMNPFDEIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVPVKRVIDYNIKPRVKADGTGVETAGVKMSMNPFDEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K ++ L+ ++AMGADR IL+E++   EPL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSIGEAKSQDTLRTAMAMGADRSILVETDSVTEPLAVAKVLKALVDKEKPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ N TGQMLA L+ WPQ TF S +++ D  A VTRE+  G  T+E  LPA++T DL L
Sbjct: 121 DDDMNATGQMLAGLLGWPQGTFASKVELHDGKATVTREIDGGLQTVELALPAIVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KARKK +EK    D  +D+TPRL ++   E    + G+++ S  +L+ 
Sbjct: 181 NEPRYASLPNIMKARKKPMEKITPADVGVDMTPRLSIVSVAEPTGRKAGIKVGSAAELVA 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|77462236|ref|YP_351740.1| electron transfer flavoprotein subunit beta [Rhodobacter
           sphaeroides 2.4.1]
 gi|126461098|ref|YP_001042212.1| electron transfer flavoprotein beta-subunit [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221641191|ref|YP_002527453.1| electron transfer flavoprotein beta-subunit [Rhodobacter
           sphaeroides KD131]
 gi|332560117|ref|ZP_08414439.1| Electron transfer flavoprotein beta-subunit [Rhodobacter
           sphaeroides WS8N]
 gi|12830549|gb|AAK08136.1|AF212163_1 electron transfer flavoprotein B subunit [Rhodobacter sphaeroides]
 gi|77386654|gb|ABA77839.1| Electron transfer flavoprotein beta-subunit [Rhodobacter
           sphaeroides 2.4.1]
 gi|126102762|gb|ABN75440.1| electron transfer flavoprotein beta-subunit [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221161972|gb|ACM02952.1| Electron transfer flavoprotein beta-subunit [Rhodobacter
           sphaeroides KD131]
 gi|332277829|gb|EGJ23144.1| Electron transfer flavoprotein beta-subunit [Rhodobacter
           sphaeroides WS8N]
          Length = 253

 Score =  277 bits (709), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 186/253 (73%), Gaps = 4/253 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+E +++LRE G ATEV+V
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEAAIRLREAGTATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIES----NETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+E+    ++ +EPL++AKIL+ +V+ E P +VI G
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVEAASDVHQDIEPLAVAKILKGVVEAEQPGLVICG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W QATF S++ I  + A+VTREV  G  T++  +P V+TV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQATFASDLAIEGDAAVVTREVDGGMQTIKVKMPTVVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL +NEPRY SLPNI+KA+KK +E+K A DF +D+TPRL V++  E    + G+ + S  
Sbjct: 181 DLRMNEPRYASLPNIMKAKKKPLEEKTAADFGVDVTPRLSVVKTSEPAGRKAGVMVGSVD 240

Query: 237 KLIEILKSKHDLL 249
           +LI  LK +  ++
Sbjct: 241 ELIAKLKDEAGVI 253


>gi|146278590|ref|YP_001168749.1| electron transfer flavoprotein beta-subunit [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145556831|gb|ABP71444.1| electron transfer flavoprotein beta-subunit [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 253

 Score =  277 bits (709), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 186/253 (73%), Gaps = 4/253 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+E +++LRE G ATEV+V
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEAAIRLREAGTATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIES----NETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+E+    ++ +EPL++AKIL+ +V+ E P +VI G
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVEAASDVHQDIEPLAVAKILKGVVEAEQPGLVICG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W QATF S++ I  + AIVTREV  G  T+   +P ++TV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQATFASDLAIEGDAAIVTREVDGGMQTIRVTMPTIVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL +NEPRY SLPNI+KA+KK +E+K A DF +D+TPRL V++  E    + G+++ S  
Sbjct: 181 DLRMNEPRYASLPNIMKAKKKPLEEKSAADFGVDVTPRLSVVKTSEPAGRKAGVKVGSVD 240

Query: 237 KLIEILKSKHDLL 249
           +LI  LK +  ++
Sbjct: 241 ELIVKLKDEAGVI 253


>gi|118591387|ref|ZP_01548785.1| putative electron transfer flavoprotein beta-subunit beta-etf
           flavoprotein small subunit [Stappia aggregata IAM 12614]
 gi|118436059|gb|EAV42702.1| putative electron transfer flavoprotein beta-subunit beta-etf
           flavoprotein small subunit [Stappia aggregata IAM 12614]
          Length = 249

 Score =  277 bits (708), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 184/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K VI+YN KVR+K D SG++  N K+SMNPFDEI++EE+L+L+E G A+EVIV
Sbjct: 1   MKILVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEISVEEALRLKEAGKASEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  +  E L+  LAMGADRGIL+++++T EPL++AKIL+ IV+ E P +VI GKQ  
Sbjct: 61  VSVGPQQATETLRTGLAMGADRGILVKTDDTTEPLAVAKILKAIVEAEEPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL+ W Q TF S + + D    VTREV  G  T++  LPA++T DL L
Sbjct: 121 DDDCNQTGQMLAALLGWSQGTFASKVDLGDGTVDVTREVDGGLQTIKLKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I++K   DF +D  PRL V+   E  + + G+++ S ++L++
Sbjct: 181 NEPRYASLPNIMKAKKKPIDEKTPADFGVDTAPRLTVVSTAEPASRQAGIKVGSVSELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|158426290|ref|YP_001527582.1| electron transfer flavoprotein beta chain [Azorhizobium caulinodans
           ORS 571]
 gi|158333179|dbj|BAF90664.1| electron transfer flavoprotein beta chain [Azorhizobium caulinodans
           ORS 571]
          Length = 249

 Score =  277 bits (708), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 185/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G+E  + K+SMNPFDEIA+EE+L+L+E GIATEV+ 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDGTGVELAHVKMSMNPFDEIAVEEALRLKEAGIATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E ++ +LAMGADRGIL++++ET+EPL++AKIL+ ++ +E P +VI GKQ  
Sbjct: 61  VSIGPAQASETIRTALAMGADRGILVKTDETVEPLAVAKILKAVIGEEAPKLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W Q TF S + I  + A++TRE+  G  T+   LPA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWGQGTFASKVVIDGDAALITREIDGGLQTVRLALPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I++K    + + + PRLKVL   E    + G+++ S  +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPIDEKTPDAYGVSVAPRLKVLNTAEPAGRKAGVKVGSVAELVS 240

Query: 241 ILKSKHDLL 249
            LK +  ++
Sbjct: 241 KLKDEAGVI 249


>gi|187924961|ref|YP_001896603.1| electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           phytofirmans PsJN]
 gi|187716155|gb|ACD17379.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           phytofirmans PsJN]
          Length = 249

 Score =  277 bits (708), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR ILIES++ L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSAGVTQSQETLRTALAIGADRAILIESSQELQPLAVAKLLKALVDKEQPSLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V+REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVVVADGKATVSREVDGGAETLSLKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+TPRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLEVLKPEDLGVDVTPRLKTLKVVEPPKRSAGVKVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|56552376|ref|YP_163215.1| electron transfer flavoprotein alpha/beta-subunit [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|241761578|ref|ZP_04759665.1| Electron transfer flavoprotein alpha/beta-subunit [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
 gi|260753944|ref|YP_003226837.1| electron transfer flavoprotein alpha/beta-subunit [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
 gi|56543950|gb|AAV90104.1| Electron transfer flavoprotein alpha/beta-subunit [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|241373886|gb|EER63419.1| Electron transfer flavoprotein alpha/beta-subunit [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
 gi|258553307|gb|ACV76253.1| Electron transfer flavoprotein alpha/beta-subunit [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
          Length = 249

 Score =  277 bits (708), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 136/243 (55%), Positives = 179/243 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK++VP+K VI+YN + R+K D SGI+  N K+S+NPFDEIA+EE+++L+EKGIA EV++
Sbjct: 1   MKVIVPVKRVIDYNLRPRVKTDGSGIDLSNLKMSLNPFDEIAVEEAVRLKEKGIAKEVVL 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K ++ LK  +A+GADR ILIE+ E +EPL +AK+L+ +V +E P +VIAGKQ  
Sbjct: 61  VSIGVSKAQDQLKTGMAIGADRSILIETEENVEPLHVAKLLKAVVDQEKPDLVIAGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ WPQ  F S + I DN   VTRE+  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWPQGCFASKLTIADNKIEVTREIDGGLETISLNLPAVVTSDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++SLPNIIKARKK IE KK  DF ID+TPRLK L+ EE    + G ++ S  +   
Sbjct: 181 NEPRFVSLPNIIKARKKPIEIKKPEDFGIDITPRLKTLKVEEPPVRQAGEKVESVEEFAA 240

Query: 241 ILK 243
            LK
Sbjct: 241 KLK 243


>gi|154246102|ref|YP_001417060.1| electron transfer flavoprotein alpha/beta-subunit [Xanthobacter
           autotrophicus Py2]
 gi|154160187|gb|ABS67403.1| Electron transfer flavoprotein alpha/beta-subunit [Xanthobacter
           autotrophicus Py2]
          Length = 249

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 131/249 (52%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D SG+E  N K+SMNPFDEIA+EE+L+L+E G ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGSGVELANVKMSMNPFDEIAVEEALRLKEAGKATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E L+ +LAMGADRGIL++ +  +EPL++AKIL+ +V +E P +VI GKQ  
Sbjct: 61  VSIGPAQASETLRTALAMGADRGILVKVDGVVEPLAVAKILKGVVGEETPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL+ WPQ TF S + I D    VTRE+  G  T++   PA++T DL L
Sbjct: 121 DDDCNQTGQMLAALLGWPQGTFASKVVIEDGGVAVTREIDGGLQTVKLNGPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I +K   D+ +D+ PRL VL   E    + G+++ S  +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPIAEKTPADYGVDVAPRLTVLSTAEPAGRKAGVKVGSVAELVA 240

Query: 241 ILKSKHDLL 249
            LK +  ++
Sbjct: 241 KLKDEAGVI 249


>gi|116254054|ref|YP_769892.1| electron transfer flavoprotein beta-subunit [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115258702|emb|CAK09807.1| putative electron transfer flavoprotein beta-subunit [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 249

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 189/249 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K D +G+E  N K+SMNPFDEI++EE+L+L+E G A EV+V
Sbjct: 1   MKILVPVKRVVDYNVKIRVKPDGTGVELANVKMSMNPFDEISVEEALRLKEAGKAEEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+++ +EPL++AKIL+ +   E P ++I GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILVETDDQIEPLTVAKILKAVADAEQPGLIIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAALM   QATF S I+I D  A VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALMGIAQATFASKIEIGDGKAQVTREVDGGLQTIEIKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK  +DF++D TPRLKVL+ EE    + G+++ S  +LI+
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKTPSDFSVDTTPRLKVLKTEEPSGRKAGVKVKSVAELID 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|218460515|ref|ZP_03500606.1| electron transport flavoprotein, beta subunit [Rhizobium etli Kim
           5]
          Length = 249

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 139/249 (55%), Positives = 187/249 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K D SG+E  N K+SMNPFDEI++EE+L+L+E G A EV+V
Sbjct: 1   MKILVPVKRVVDYNVKIRVKPDGSGVELANVKMSMNPFDEISVEEALRLKEAGKAEEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+++ +EPL++AKIL+ +   E P ++I GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILVETDDQVEPLAVAKILKGVADAEQPGLIITGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+   QATF S I+I D  A VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALLGSAQATFASKIEIGDGKATVTREVDGGLQTIEIKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +D TPRLKVL+ EE    + G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKSPADFGVDTTPRLKVLKTEEPSGRKAGVKVKSVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|307727992|ref|YP_003911205.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           CCGE1003]
 gi|307588517|gb|ADN61914.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           CCGE1003]
          Length = 249

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+V +K V++YN KVR K+D +G++  N K+SMNPFDEIA+EE+++L+E GIATEVI 
Sbjct: 1   MKIIVAVKRVVDYNVKVRAKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEAGIATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR ILIESN+ L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSAGVTQCQETLRTALAIGADRAILIESNKDLQPLAVAKLLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V+REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALANLPQATFASKVVVADGKATVSREVDGGAETVSLKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+TPRLK+L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVKPADLGVDVTPRLKMLKVSEPPKRSAGVKVADVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|332528091|ref|ZP_08404122.1| electron transfer flavoprotein alpha/beta-subunit [Rubrivivax
           benzoatilyticus JA2]
 gi|332112662|gb|EGJ12455.1| electron transfer flavoprotein alpha/beta-subunit [Rubrivivax
           benzoatilyticus JA2]
          Length = 249

 Score =  276 bits (705), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 184/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR IL+E+ E L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVTQCQETLRTAMAIGADRAILVETTEELQPLAVAKLLKALVDKEQPGLVIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S I+I D  A V RE+  G  T++  LPAV+T DL L
Sbjct: 121 DDDANQTGQMLAALAGLPQATFASKIEIADGRAKVAREIDGGAETVDLKLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+TPRLK L+  E      G+++     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVKPADLGVDVTPRLKTLKVAEPPKRGAGVKVPDVATLVA 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|207725354|ref|YP_002255750.1| electron transfer flavoprotein (beta-subunit) [Ralstonia
           solanacearum MolK2]
 gi|206590590|emb|CAQ37552.1| electron transfer flavoprotein (beta-subunit) [Ralstonia
           solanacearum MolK2]
          Length = 249

 Score =  276 bits (705), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+YN KVR+K+D SG++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKVLVAVKRVIDYNVKVRVKSDGSGVDLANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G+ + +E L+ ++A+GADRGIL+E++E L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGAAQCQETLRTAMAIGADRGILVETSEELQPLAVAKLLKALVDKEQPQLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S ++I D  A VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDANQTGQMLAALAGLPQATFASKVQIADGKASVTREVDGGLETLSIKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+ PRLK L+  E      G+ +     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTVKPEDLGVDVAPRLKTLKVAEPPKRSAGVMVPDVATLVA 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|83745810|ref|ZP_00942867.1| Electron transfer flavoprotein beta-subunit [Ralstonia solanacearum
           UW551]
 gi|207743725|ref|YP_002260117.1| electron transfer flavoprotein (beta-subunit) [Ralstonia
           solanacearum IPO1609]
 gi|83727500|gb|EAP74621.1| Electron transfer flavoprotein beta-subunit [Ralstonia solanacearum
           UW551]
 gi|206595124|emb|CAQ62051.1| electron transfer flavoprotein (beta-subunit) [Ralstonia
           solanacearum IPO1609]
          Length = 249

 Score =  275 bits (704), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+YN KVR+K+D SG++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKVLVAVKRVIDYNVKVRVKSDGSGVDLANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+E++E L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGGAQCQETLRTAMAIGADRGILVETSEELQPLAVAKLLKALVDKEQPQLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S ++I D  A VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDANQTGQMLAALAGLPQATFASKVQIADGKASVTREVDGGLETLSVKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+ PRLK L+  E      G+ +     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTVKPEDLGVDVAPRLKTLKVAEPPKRSAGVMVPDVATLVA 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|148252710|ref|YP_001237295.1| electron transfer flavoprotein subunit beta [Bradyrhizobium sp.
           BTAi1]
 gi|146404883|gb|ABQ33389.1| Electron transfer flavoprotein beta-subunit [Bradyrhizobium sp.
           BTAi1]
          Length = 249

 Score =  275 bits (704), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 185/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D SG+E  N K+SMNPFDEIA+EE+L+L+E G ATEV+V
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDGSGVELANVKMSMNPFDEIAVEEALRLKEAGKATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E ++ +LAMGADRGIL+++   +EPL++AKIL+ + ++E P ++I GKQ  
Sbjct: 61  VSIGPAQASETIRTALAMGADRGILVKAEGNVEPLAVAKILKSVAQEEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W QATF S +++  +   VTREV  G  T++   PA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWAQATFASKLEVDGSDFKVTREVDGGLQTVKLKGPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I +K A D  +DLTPRL++L+  E    + G+++    +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPIAEKTAADTGVDLTPRLEILKTTEPAGRKAGVKVKDVAELVN 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAGVL 249


>gi|309781059|ref|ZP_07675797.1| electron transfer flavoprotein, beta subunit [Ralstonia sp.
           5_7_47FAA]
 gi|308920125|gb|EFP65784.1| electron transfer flavoprotein, beta subunit [Ralstonia sp.
           5_7_47FAA]
          Length = 249

 Score =  275 bits (704), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 181/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKVLVAVKRVIDYNVKVRVKTDGSGVDLANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+E+NE L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGVTQCQETLRTAMAIGADRGILVETNEELQPLAVAKLLKALVDKEQPQLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S ++I D  A VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDANQTGQMLAALAGLPQATFASKVQIADGKASVTREVDGGLETLSVKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+ PRLK L+  E      G+ +     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTVKPEDLGVDVAPRLKTLKVVEPAKRSAGVMVPDVATLVS 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|170704079|ref|ZP_02894709.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           ambifaria IOP40-10]
 gi|170131009|gb|EDS99706.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           ambifaria IOP40-10]
          Length = 254

 Score =  275 bits (704), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 130/249 (52%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           +KI+V +K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 6   VKIVVAVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 65

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+ESN+++EPL++AKIL+ +V KE P +VI GKQ  
Sbjct: 66  VSVGVTQAQETLRTALAIGADRAILVESNDSVEPLAVAKILKALVDKEQPQLVILGKQAI 125

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + I D  A V REV  G  T+   LPAV+T DL L
Sbjct: 126 DDDSNQTGQMLAALAGLPQATFASKVTIADGKATVAREVDGGAETLSLTLPAVVTTDLRL 185

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PRLK L+  E      G+++     L+E
Sbjct: 186 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVAPRLKTLKVVEPPKRAAGVKVPDVKTLVE 245

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 246 KLKTEAKML 254


>gi|39937808|ref|NP_950084.1| electron transfer flavoprotein subunit beta [Rhodopseudomonas
           palustris CGA009]
 gi|39651668|emb|CAE30190.1| electron transfer flavoprotein beta chain, (ETFSS)
           [Rhodopseudomonas palustris CGA009]
          Length = 249

 Score =  275 bits (704), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 184/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN K+R+K+D SG+E  N K+SMNPFDEIA+EE+L+L+E G ATEV+V
Sbjct: 1   MKVLVPVKRVVDYNVKIRVKSDGSGVELANVKMSMNPFDEIAVEEALRLKEAGKATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E L+  LAMGADRGIL++ +  +EPL++AKIL+ I  +E P ++I GKQ  
Sbjct: 61  VSIGPAQASETLRTGLAMGADRGILVKVDGVVEPLAVAKILKGIADEEKPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W QATF S +++  +   V REV  G+ T++   PA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWAQATFASKLEVEGSDFTVAREVDGGSQTVKLKGPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I +K A DF +D++PRL+VL+  E    + G+++    +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPIAEKTAADFGVDVSPRLEVLKTVEPGGRKAGVKVKDVAELVS 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|119898213|ref|YP_933426.1| electron transfer flavoprotein, beta-subunit [Azoarcus sp. BH72]
 gi|119898783|ref|YP_933996.1| electron transfer flavoprotein subunit beta [Azoarcus sp. BH72]
 gi|119670626|emb|CAL94539.1| electron transfer flavoprotein, beta-subunit [Azoarcus sp. BH72]
 gi|119671196|emb|CAL95109.1| electron transfer flavoprotein, beta subunit [Azoarcus sp. BH72]
          Length = 249

 Score =  275 bits (703), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G+ATEV+ 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAVRLKEAGVATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G    +E L+ ++A+GADRGIL+E++  L+PL++AK+L+ +  KE P +VI GKQ  
Sbjct: 61  VSCGVAACQETLRAAMAIGADRGILVETDVELQPLAVAKLLKALADKEEPTLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL  WPQATF S + + D  A VTRE+  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALKGWPQATFASKLTLADGKATVTREIDGGLETVAISLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +LPNI+KA+KK ++  K  D  +D+ PRL  L+  E      G+R+    +L++
Sbjct: 181 NEPRYATLPNIMKAKKKPLDTVKPADLGVDVAPRLATLKVTEPPKRSAGVRVADVAQLVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAKVL 249


>gi|329847872|ref|ZP_08262900.1| electron transfer flavoprotein subunit beta [Asticcacaulis
           biprosthecum C19]
 gi|328842935|gb|EGF92504.1| electron transfer flavoprotein subunit beta [Asticcacaulis
           biprosthecum C19]
          Length = 248

 Score =  275 bits (703), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 126/244 (51%), Positives = 181/244 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K D SG++  N K+SMNPFDEIA+EE+ +L+EKGIATEV+ 
Sbjct: 1   MKLLVPVKRVLDYNVKVRVKADQSGVDLANVKMSMNPFDEIAVEEATRLKEKGIATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  + +  +L +GADRGILI++++ +EPL++AK+L+ ++++E P +VI GKQ  
Sbjct: 61  VSIGPAQARDTIVTALTIGADRGILIQTDQDVEPLAVAKLLKAVIEQEQPDLVIMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++N TGQ+LA L+ WPQATF S + I+D  A VTREV  G  T+   LPAVIT DL L
Sbjct: 121 DGDNNATGQILATLLDWPQATFASKVVIVDGEAQVTREVDGGLQTIGVKLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++ K   D+ +D+TPRLKV++  E    + G+++    +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPLDVKTVADYGVDVTPRLKVVKVTEPAKRQAGIKVADAAELVA 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 NLKT 244


>gi|146343272|ref|YP_001208320.1| electron transfer flavoprotein subunit beta [Bradyrhizobium sp.
           ORS278]
 gi|146196078|emb|CAL80105.1| Electron transfer flavoprotein beta-subunit (Beta-ETF) (Electron
           transfer flavoprotein small subunit) (ETFSS)
           [Bradyrhizobium sp. ORS278]
          Length = 249

 Score =  275 bits (703), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 130/249 (52%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D SG+E  N K+SMNPFDEIA+EE+L+L+E G ATEV+V
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDGSGVELANVKMSMNPFDEIAVEEALRLKEAGKATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E ++ +LAMGADRGIL+++   +EPL++AKIL+ + ++E P ++I GKQ  
Sbjct: 61  VSIGPAQASETIRTALAMGADRGILVKAEGNVEPLAVAKILKAVAQEEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W QATF S +++      VTREV  G  T+    PA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWAQATFASKLEVEGADFKVTREVDGGLQTVMLKGPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I +K A D  +DLTPRL+VL+  E    + G+++    +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPIAEKTAADTGVDLTPRLEVLKTAEPAGRKAGVKVKDVAELVS 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAGVL 249


>gi|330815912|ref|YP_004359617.1| Electron transfer flavoprotein beta-subunit [Burkholderia gladioli
           BSR3]
 gi|327368305|gb|AEA59661.1| Electron transfer flavoprotein beta-subunit [Burkholderia gladioli
           BSR3]
          Length = 249

 Score =  275 bits (703), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 131/249 (52%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGTATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E L+ +LA+GADR IL+E+ E +EPL +AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSIGVAQAQETLRTALAIGADRAILVEAGEGVEPLGVAKILKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V REV  G+ T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVTVADGRATVAREVDGGSETLALTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+  RLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVRARLKTLKVSEPPKRAAGVKVADVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|83859194|ref|ZP_00952715.1| electron transfer flavoprotein beta subunit [Oceanicaulis
           alexandrii HTCC2633]
 gi|83852641|gb|EAP90494.1| electron transfer flavoprotein beta subunit [Oceanicaulis
           alexandrii HTCC2633]
          Length = 249

 Score =  275 bits (703), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 187/249 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKGIA E++V
Sbjct: 1   MKILVPVKRVVDYNVKVRVKPDQSGVDLANVKMSMNPFCEIAVEEAIRLKEKGIAEEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E ++ +LAMGADRGI + ++ET+EPL +AKIL+ +V+ E+P +V+ GKQ  
Sbjct: 61  VSIGPAQAQETIRTALAMGADRGIHVTTDETVEPLGVAKILKGVVEAESPELVLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SN TGQMLAALM WPQATF S ++  D+   VTRE+  G  T+  P PA++T DL L
Sbjct: 121 DDDSNATGQMLAALMGWPQATFASEVEKTDSGFKVTREIDGGLQTLAIPSPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K I+ K   D+ +D++PRL+V++  E      G+++ +  +L++
Sbjct: 181 NEPRYASLPNIMKAKRKPIDAKTPDDYGVDISPRLEVVKVSEPPKREAGVKVETVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAGVI 249


>gi|295699089|ref|YP_003606982.1| electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           CCGE1002]
 gi|295438302|gb|ADG17471.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           CCGE1002]
          Length = 249

 Score =  275 bits (703), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 131/249 (52%), Positives = 181/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           M++LV +K V++YN KVR K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MRVLVAVKRVVDYNVKVRAKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR ILIESNE L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSAGVAQSQETLRTALAIGADRAILIESNEELQPLAVAKLLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V+REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALANLPQATFASKVIVADGKATVSREVDGGAETLSLTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+TPRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETIKPEDLGVDVTPRLKTLKVAEPPKRSAGVKVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|317405948|gb|EFV86226.1| electron transfer flavoprotein [Achromobacter xylosoxidans C54]
          Length = 249

 Score =  275 bits (702), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 180/245 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+ +L+EKG   EV+ 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDQTGVDIANVKMSMNPFDEIAVEEATRLKEKGTVAEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRG+L++++  L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGVLVQTDAELQPLAVAKLLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ WPQATF S +++ D    VTREV  G  T+   LPA++T DL L
Sbjct: 121 DDDANQTGQMLAALLDWPQATFASKVEVADGKVTVTREVDGGLETLSLKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++     D  +D  PRLK L+  E  A + G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDAVTPQDLGVDPAPRLKTLKVSEPPARKAGIKVADVAALVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|119897990|ref|YP_933203.1| electron transfer flavoprotein subunit beta [Azoarcus sp. BH72]
 gi|119670403|emb|CAL94316.1| electron transfer flavoprotein, beta subunit [Azoarcus sp. BH72]
          Length = 249

 Score =  275 bits (702), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G+ATEV+ 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAVRLKEAGVATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G    +E L+ ++A+GADRGIL+E++  L+PL++AK+L+ +  KE P +VI GKQ  
Sbjct: 61  VSCGVVACQETLRAAMAIGADRGILVETDVELQPLAVAKLLKALADKEEPTLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL  WPQATF S + + D  A VTRE+  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALKGWPQATFASKLTLADGKATVTREIDGGLETVAISLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +LPNI+KA+KK ++  K  D  +D+ PRL  L+  E      G+R+    +L++
Sbjct: 181 NEPRYATLPNIMKAKKKPLDTVKPADLGVDVAPRLATLKVTEPPKRSAGVRVADVAQLVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAKVL 249


>gi|187929710|ref|YP_001900197.1| electron transfer flavoprotein alpha/beta-subunit [Ralstonia
           pickettii 12J]
 gi|187726600|gb|ACD27765.1| Electron transfer flavoprotein alpha/beta-subunit [Ralstonia
           pickettii 12J]
          Length = 249

 Score =  275 bits (702), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D SG++  N K+SMNPFDEIA+EE+++LREKG ATE++ 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGSGVDIANVKMSMNPFDEIAVEEAVRLREKGAATEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+E+NE L+PL++AK+L+ ++ KE P +VI GKQ  
Sbjct: 61  VSCGVSQCQETLRTAMAIGADRGILVETNEELQPLAVAKLLKALIDKEQPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL   PQATF S +++  + A VTREV  G  T+   LPAVIT DL L
Sbjct: 121 DDDCNQTGQMLAALAGLPQATFASKVELASDKAAVTREVDGGLETLSLTLPAVITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++  K  D  + + PRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLDTIKPEDLGVQVAPRLKTLKVTEPAKRGAGVKVADVAALVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|86361135|ref|YP_473022.1| electron transport flavoprotein, beta subunit [Rhizobium etli CFN
           42]
 gi|86285237|gb|ABC94295.1| electron transport flavoprotein, beta subunit [Rhizobium etli CFN
           42]
          Length = 249

 Score =  275 bits (702), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 139/249 (55%), Positives = 188/249 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K D +G+E  N K+SMNPFDEI++EE+L+L+E G A EV+V
Sbjct: 1   MKILVPVKRVVDYNVKIRVKPDGTGVELANVKMSMNPFDEISVEEALRLKEAGKAEEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+++ +EPL++AKIL+ +   E P ++I+GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILVETDDQVEPLAVAKILKGVADAEQPGLIISGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+   QATF S I+I D  A VTREV  G  T+E  LPAVIT DL L
Sbjct: 121 DDDSNQTGQMLAALLGSAQATFASKIEIGDGKAQVTREVDGGLQTIEIKLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +D TPRLKVL+ EE    + G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKTPADFGVDTTPRLKVLKTEEPSGRKAGVKVKSVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|239816347|ref|YP_002945257.1| electron transfer flavoprotein alpha/beta-subunit [Variovorax
           paradoxus S110]
 gi|239802924|gb|ACS19991.1| Electron transfer flavoprotein alpha/beta-subunit [Variovorax
           paradoxus S110]
          Length = 249

 Score =  274 bits (701), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 126/245 (51%), Positives = 182/245 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ TEVI 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEKGVVTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  K +E L+ ++A+GADRGIL+E+ E L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGDAKCQETLRTAMAIGADRGILVETTEELQPLAVAKLLKALVDKEQPQLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S +++ D  A VTREV  G  T+   LPAVIT DL L
Sbjct: 121 DDDANQTGQMLAALADLPQATFASKVEVADGKATVTREVDGGLETITLSLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  +  D  +D+ PRLK L+  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTFEPEDLGVDVKPRLKTLKVSEPPKRGAGIKVPDVATLVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|316936219|ref|YP_004111201.1| electron transfer flavoprotein subunit alpha/beta [Rhodopseudomonas
           palustris DX-1]
 gi|315603933|gb|ADU46468.1| Electron transfer flavoprotein alpha/beta-subunit [Rhodopseudomonas
           palustris DX-1]
          Length = 249

 Score =  274 bits (701), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 185/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN K+R+K+D SG+E  N K+SMNPFDEIA+EE+L+L+E G ATEV+V
Sbjct: 1   MKVLVPVKRVVDYNVKIRVKSDGSGVELANVKMSMNPFDEIAVEEALRLKEAGKATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E L+  LAMGADRGIL++++  +EPL++AKIL+ +  +E P ++I GKQ  
Sbjct: 61  VSIGPAQASETLRTGLAMGADRGILVKADGVVEPLAVAKILKGVADEEKPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W QATF S +++  +   V REV  G+ T++   PA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWAQATFASKLEVDGSDFTVAREVDGGSQTVKLKGPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I +K A D+ +D++PRL+VL+  E    + G+++    +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPIAEKTAADYGVDVSPRLEVLKTVEPGGRKAGVKVKDVAELVS 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAGVI 249


>gi|91975410|ref|YP_568069.1| electron transfer flavoprotein beta-subunit [Rhodopseudomonas
           palustris BisB5]
 gi|91681866|gb|ABE38168.1| electron transfer flavoprotein beta-subunit [Rhodopseudomonas
           palustris BisB5]
          Length = 249

 Score =  274 bits (701), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 184/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN K+R+K+D SG+E  N K+SMNPFDEIA+EE+L+L+E G ATEV+V
Sbjct: 1   MKVLVPVKRVVDYNVKIRVKSDGSGVELTNVKMSMNPFDEIAVEEALRLKEAGKATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E L+  LAMGADRGIL+++  T+EPL++AKIL+ I  +E P ++I GKQ  
Sbjct: 61  VSIGPAQASETLRTGLAMGADRGILVKAEGTVEPLAVAKILKAIADEEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W QATF S +++  +   V+REV  G+ T++   PA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWAQATFASKLEVEGSDFTVSREVDGGSQTVKLKGPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I +K A  + +DL PRL+VL+  E    + G+++    +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPIAEKTADQYGVDLAPRLEVLKTVEPSGRKAGVKVKDVAELVS 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAGVI 249


>gi|241206540|ref|YP_002977636.1| Electron transfer flavoprotein alpha/beta-subunit [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240860430|gb|ACS58097.1| Electron transfer flavoprotein alpha/beta-subunit [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 249

 Score =  274 bits (701), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 141/249 (56%), Positives = 187/249 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K D +G+E  N K+SMNPFDEI++EE+L+L+E G A EV+V
Sbjct: 1   MKILVPVKRVVDYNVKIRVKPDGTGVELANVKMSMNPFDEISVEEALRLKEAGKAEEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+++ +EPL++AKIL+ +   E P ++I GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILVETDDQIEPLTVAKILKAVADAEQPGLIIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAALM   QATF S I+I D  A VTREV  G  T+E  LPAVIT DL L
Sbjct: 121 DDDSNQTGQMLAALMGTAQATFASKIEIGDGKAQVTREVDGGLQTIEIKLPAVITSDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK  +DF I  TPRLKVL+ EE    + G+++ S  +LI+
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKTPSDFGISTTPRLKVLKTEEPSGRKAGVKVKSVAELID 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|296536766|ref|ZP_06898821.1| electron transfer flavoprotein beta subunit [Roseomonas cervicalis
           ATCC 49957]
 gi|296262898|gb|EFH09468.1| electron transfer flavoprotein beta subunit [Roseomonas cervicalis
           ATCC 49957]
          Length = 248

 Score =  274 bits (700), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 131/249 (52%), Positives = 182/249 (73%), Gaps = 1/249 (0%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K D +G+ET N K+SMNPFDEIA+EE+++L+EKG ATE++ 
Sbjct: 1   MKLLVPVKRVVDYNVKVRVKADGTGVETANVKMSMNPFDEIAVEEAVRLKEKGAATEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E L+ +LAMGADRGILIE+ E  EPL +AK+L+ +V++E P +VI GKQ  
Sbjct: 61  VSIGPAQAQEQLRTALAMGADRGILIEA-EGCEPLGVAKLLKAVVEREQPGLVIMGKQAI 119

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ N TGQ LAAL+ W Q TF S +++    A VTREV  G  T+   LPA++T DL L
Sbjct: 120 DDDMNATGQALAALLGWAQGTFASKVELDGQSAKVTREVDGGLETVSLKLPAIVTTDLRL 179

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KARKK +E  K  D  +D+TPRL VL+ EE    + G+++ S  +L+ 
Sbjct: 180 NEPRYASLPNIMKARKKPLETMKPADLGVDVTPRLTVLKVEEPPKRQAGVKVGSVAELVS 239

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 240 KLKTEAKVI 248


>gi|124266489|ref|YP_001020493.1| putative electron transfer flavoprotein (subunit beta) [Methylibium
           petroleiphilum PM1]
 gi|124259264|gb|ABM94258.1| putative electron transfer flavoprotein (beta-subunit) [Methylibium
           petroleiphilum PM1]
          Length = 249

 Score =  274 bits (700), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K+D +G++T N K+SMNPFDEIA+EE+++L+EKG  +EVI 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKSDGTGVDTANVKMSMNPFDEIAVEEAVRLKEKGAVSEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR IL+E  E L+PL++AK+L+ +  KE P +VI GKQ  
Sbjct: 61  VSCGVTQCQETLRTAMAIGADRAILVECTEELQPLAVAKLLKALADKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL  WPQATF S ++I+D  A VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDCNQTGQMLAALAGWPQATFASKVEILDGRAQVTREVDGGLETVSVALPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  ID+TPRLK L+  E      G+++     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKTLEVLKPADLGIDVTPRLKTLKVSEPPKRGAGIKVPDVATLVA 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKTEAKVI 249


>gi|296163212|ref|ZP_06845979.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           Ch1-1]
 gi|295886560|gb|EFG66411.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           Ch1-1]
          Length = 249

 Score =  274 bits (700), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+VP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKIVVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G+ + +E L+ +LA+GADR IL+ES   L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGATQSQETLRTALAIGADRAILVESAVELQPLAVAKLLKALVDKEQPSLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V+REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALANLPQATFASKVVVADGKATVSREVDGGAETLSLTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+TPRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLEVVKPEDLGVDVTPRLKTLKVAEPPKRSAGVKVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            L+++  +L
Sbjct: 241 KLRTEAKVL 249


>gi|192293590|ref|YP_001994195.1| electron transfer flavoprotein alpha/beta-subunit [Rhodopseudomonas
           palustris TIE-1]
 gi|192287339|gb|ACF03720.1| Electron transfer flavoprotein alpha/beta-subunit [Rhodopseudomonas
           palustris TIE-1]
          Length = 249

 Score =  274 bits (700), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 184/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN K+R+K+D SG+E  N K+SMNPFDEIA+EE+L+L+E G ATEV+V
Sbjct: 1   MKVLVPVKRVVDYNVKIRVKSDGSGVELANVKMSMNPFDEIAVEEALRLKEAGKATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E L+  LAMGADRGIL++ +  +EPL++AKIL+ I  +E P ++I GKQ  
Sbjct: 61  VSIGPAQASETLRTGLAMGADRGILVKVDGVVEPLAVAKILKGIADEEKPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W QATF S +++  +   V REV  G+ T++   PA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWAQATFASKLEVEGSDFTVAREVDGGSQTVKLKGPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I +K A D+ +D++PRL+VL+  E    + G+++    +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPIAEKTAADYGVDVSPRLEVLKTVEPGGRKAGVKVKDVAELVS 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|86359375|ref|YP_471267.1| electron transport flavoprotein, beta subunit [Rhizobium etli CFN
           42]
 gi|86283477|gb|ABC92540.1| electron transport flavoprotein, beta subunit [Rhizobium etli CFN
           42]
          Length = 249

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 139/249 (55%), Positives = 188/249 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K D +G+E  N K+SMNPFDEI++EE+L+L+E G A EV+V
Sbjct: 1   MKILVPVKRVVDYNVKIRVKPDGTGVELANVKMSMNPFDEISVEEALRLKEAGKAEEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+++ +EPL++AKIL+ +   E P ++I+GKQ  
Sbjct: 61  VSIGPGKAEETLRTALAMGADRAILVETDDQVEPLAVAKILKGVADAEQPGLIISGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+   QATF S I+I D  A VTREV  G  T+E  LPAVIT DL L
Sbjct: 121 DDDSNQTGQMLAALLGSAQATFASKIEIGDGKAQVTREVDGGLQTIEIKLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +D TPRLKVL+ EE    + G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKTPADFGVDTTPRLKVLKTEEPSGRKAGVKVKSVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|319791560|ref|YP_004153200.1| electron transfer flavoprotein alpha/beta-subunit [Variovorax
           paradoxus EPS]
 gi|315594023|gb|ADU35089.1| Electron transfer flavoprotein alpha/beta-subunit [Variovorax
           paradoxus EPS]
          Length = 249

 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 184/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ TEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEKGVVTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  K +E L+ ++A+GADRGIL+E+ E L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGDAKCQETLRTAMAIGADRGILVETTEELQPLAVAKLLKALVDKEQPQLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S +++  + A VTREV  G  T+   LPAVIT DL L
Sbjct: 121 DDDANQTGQMLAALADLPQATFASKVEVAGDKATVTREVDGGLETISLTLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+ PRLK L+  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDVFKPEDLGVDVKPRLKTLKVSEPPKRGAGIKVPDVATLVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|217970669|ref|YP_002355903.1| electron transfer flavoprotein alpha/beta-subunit [Thauera sp.
           MZ1T]
 gi|217507996|gb|ACK55007.1| Electron transfer flavoprotein alpha/beta-subunit [Thauera sp.
           MZ1T]
          Length = 249

 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 126/244 (51%), Positives = 175/244 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K D SG++  N K+SMNPFDEI++EE+++L+E G+ATEV+ 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKADGSGVDLANVKMSMNPFDEISVEEAVRLKEAGVATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G    +E L+ ++A+GADRGILIE++  L+PL++AK+L+ +  KE P +VI GKQ  
Sbjct: 61  VSCGVGACQETLRAAMAIGADRGILIETDVELQPLAVAKLLKAVCDKEQPQLVICGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  WPQATF S + + D  A VTRE+  G  T+   LPAV+T DL L
Sbjct: 121 DDDANQTGQMLAALAGWPQATFASKVTLADGKAAVTREIDGGLETLSVKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +LPNI+KA+KK ++  K  D  +D+ PRL  L+  E      G R+    +LI+
Sbjct: 181 NEPRYATLPNIMKAKKKPLDTVKPADLGVDVAPRLATLKVAEPPKRSAGERVADVAQLID 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKN 244


>gi|323529980|ref|YP_004232132.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           CCGE1001]
 gi|323386982|gb|ADX59072.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           CCGE1001]
          Length = 249

 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 130/249 (52%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+V +K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKIIVAVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR ILIESNE L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSAGVTQSQETLRTALAIGADRAILIESNEELQPLAVAKLLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V+REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVVVADGKATVSREVDGGAETLSLTLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+TPRL+ L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETIKPEDMGVDVTPRLQTLKVAEPPRRSAGVKVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            L+++  +L
Sbjct: 241 KLRTEARVL 249


>gi|317402918|gb|EFV83458.1| electron transfer flavoprotein [Achromobacter xylosoxidans C54]
          Length = 249

 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 181/245 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+ +L+EKG   EV+ 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDQTGVDIANVKMSMNPFDEIAVEEATRLKEKGAVAEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRG+L++++  L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGVLVQTDAELQPLAVAKLLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ WPQATF S +++ D  A VTREV  G  T+   LPA+IT DL L
Sbjct: 121 DDDANQTGQMLAALLDWPQATFASKVELADGKATVTREVDGGLETLTLKLPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++     +  +D  PRLK L+  E  A + G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTVTPEELGVDPAPRLKTLKVSEPPARKAGIKVADVAALVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|121604130|ref|YP_981459.1| electron transfer flavoprotein subunit beta [Polaromonas
           naphthalenivorans CJ2]
 gi|120593099|gb|ABM36538.1| electron transfer flavoprotein beta-subunit [Polaromonas
           naphthalenivorans CJ2]
          Length = 249

 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D SG++  N K+SMNPFDEIA+EE+++L+EKG+ TEVI 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDGSGVDIANVKMSMNPFDEIAIEEAVRLKEKGVVTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR IL+E+ E L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVLQCQETLRTAMAIGADRAILVETGEELQPLAVAKLLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL+ W QATF S +++ D  A VTREV  G  T+   LPA+IT DL L
Sbjct: 121 DDDCNQTGQMLAALLGWGQATFASKVEVADGVARVTREVDGGLETLSLTLPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PR+K L+  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKPLENVKPADLGVDVAPRIKTLKVSEPPKRSAGIKVADVAALVD 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|330816575|ref|YP_004360280.1| Electron transfer flavoprotein beta-subunit [Burkholderia gladioli
           BSR3]
 gi|327368968|gb|AEA60324.1| Electron transfer flavoprotein beta-subunit [Burkholderia gladioli
           BSR3]
          Length = 249

 Score =  273 bits (698), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 131/249 (52%), Positives = 178/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGTATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E L+ +LA+GADR IL+E+ E +EPL +AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSIGVAQAQETLRTALAIGADRAILVEAGEGVEPLGVAKILKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V REV  G+ T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVTVADGRATVAREVDGGSETLALTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+  RLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVRARLKTLKVSEPPKRAAGVKVADVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK +  +L
Sbjct: 241 KLKIEAKVL 249


>gi|116249185|ref|YP_765026.1| putative electron transfer flavoprotein beta-subunit [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115253835|emb|CAK12230.1| putative electron transfer flavoprotein beta-subunit [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 249

 Score =  273 bits (698), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 186/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K D +G+E  N K+SMNPFDEI++EE+L+L+E G A EV+V
Sbjct: 1   MKILVPVKRVVDYNVKIRVKPDGTGVELANVKMSMNPFDEISVEEALRLKEAGKAEEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+++ +EPL++AKIL+ +   E P ++I GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILVETDDQIEPLTVAKILKAVADAEQPGLIIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAALM   QATF S I+I D  A VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALMGIAQATFASKIEIGDGKAQVTREVDGGLQTIEIKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF I  TPRLKVL+ EE    + G+++ S  +LI+
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKSPDDFGISTTPRLKVLKTEEPSGRKAGVKVKSVAELID 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|300692099|ref|YP_003753094.1| electron transfer flavoprotein, beta-subunit [Ralstonia
           solanacearum PSI07]
 gi|299079159|emb|CBJ51827.1| Electron transfer flavoprotein, beta-subunit [Ralstonia
           solanacearum PSI07]
          Length = 249

 Score =  273 bits (698), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+YN KVR+K+D SG++  N K+SMNPFDEIA+EE+++L+E G+ TEVI 
Sbjct: 1   MKVLVAVKRVIDYNVKVRVKSDGSGVDLANVKMSMNPFDEIAVEEAVRLKEAGVVTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+E+NE L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGILVETNEELQPLAVAKLLKALVDKEQPQLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S ++I D  A VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDANQTGQMLAALAGLPQATFASKVQIADGRASVTREVDGGLETLSVKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++  K  D  +D+ PRLK L+  E      G+ +     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKPLDTVKPEDLGVDVAPRLKTLKVAEPPKRSAGVMVPDVATLVA 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|217968862|ref|YP_002354096.1| electron transfer flavoprotein alpha/beta-subunit [Thauera sp.
           MZ1T]
 gi|217506189|gb|ACK53200.1| Electron transfer flavoprotein alpha/beta-subunit [Thauera sp.
           MZ1T]
          Length = 249

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 125/244 (51%), Positives = 175/244 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K D SG++  N K+SMNPFDEI++EE+++L+E G+ATEV+ 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKADGSGVDLANVKMSMNPFDEISVEEAVRLKEAGVATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G    +E L+ ++A+GADRGIL+E++  L+PL++AK+L+ +  KE P +VI GKQ  
Sbjct: 61  VSCGVGACQETLRAAMAIGADRGILVETDVELQPLAVAKLLKAVCDKEQPQLVICGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  WPQATF S + + D  A VTRE+  G  T+   LPAV+T DL L
Sbjct: 121 DDDANQTGQMLAALAGWPQATFASKVTLADGKAAVTREIDGGLETLSVKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +LPNI+KA+KK ++  K  D  +D+ PRL  L+  E      G R+    +LI+
Sbjct: 181 NEPRYATLPNIMKAKKKPLDTVKPADLGVDVAPRLATLKVAEPPKRSAGERVADVAQLID 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKN 244


>gi|241662477|ref|YP_002980837.1| electron transfer flavoprotein alpha/beta-subunit [Ralstonia
           pickettii 12D]
 gi|240864504|gb|ACS62165.1| Electron transfer flavoprotein alpha/beta-subunit [Ralstonia
           pickettii 12D]
          Length = 249

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKVLVAVKRVIDYNVKVRVKTDGSGVDLANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+E+NE L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGVTQCQETLRTAMAIGADRGILVETNEELQPLAVAKLLKALVDKEQPQLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S ++I D  A VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDANQTGQMLAALAGLPQATFASKVQIADGKASVTREVDGGLETLSVKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+ P LK L+  E      G+ +     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTVKPEDLGVDVAPHLKTLKVVEPAKRSAGVMVPDVATLVS 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|319792923|ref|YP_004154563.1| electron transfer flavoprotein alpha/beta-subunit [Variovorax
           paradoxus EPS]
 gi|315595386|gb|ADU36452.1| Electron transfer flavoprotein alpha/beta-subunit [Variovorax
           paradoxus EPS]
          Length = 249

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 184/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ TEVI 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEKGVVTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  K +E L+ ++A+GADRGIL+E+ E L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGDAKCQETLRTAMAIGADRGILVETTEELQPLAVAKLLKALVDKEQPQLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S +++  + A VTREV  G  T+   LPAVIT DL L
Sbjct: 121 DDDANQTGQMLAALADLPQATFASKVEVAGDKATVTREVDGGLETISLTLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+ PRLK L+  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDVFKPEDLGVDVKPRLKTLKVSEPPKRGAGIKVPDVATLVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|227819888|ref|YP_002823859.1| electron transfer flavoprotein subunit beta [Sinorhizobium fredii
           NGR234]
 gi|227338887|gb|ACP23106.1| electron transfer flavoprotein, beta subunit [Sinorhizobium fredii
           NGR234]
          Length = 249

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 187/249 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V+++N K+R+K D +G+E  N K+SMNPFDEI++EE+L+L+E G A+EV+V
Sbjct: 1   MKILVPVKRVVDFNVKIRVKADGTGVELANVKMSMNPFDEISVEEALRLKEAGKASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+++ +EPL++AKI++ + + E P ++I GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILVETDDQVEPLTVAKIVKGVAEAEQPGLIIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQML+AL+ W Q TF S +++ D    VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLSALLGWAQGTFASKVELGDGKVNVTREVDGGLQTVELKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +D  PRLKVL+ EE    + G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKSPADFGVDTAPRLKVLKTEEPSGRKAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LKS+  +L
Sbjct: 241 KLKSEAGIL 249


>gi|187927889|ref|YP_001898376.1| electron transfer flavoprotein alpha/beta-subunit [Ralstonia
           pickettii 12J]
 gi|187724779|gb|ACD25944.1| Electron transfer flavoprotein alpha/beta-subunit [Ralstonia
           pickettii 12J]
          Length = 249

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKVLVAVKRVIDYNVKVRVKTDGSGVDLANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+E+ E L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGVTQCQETLRTAMAIGADRGILVETAEELQPLAVAKLLKALVDKEQPQLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S ++I D  A VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDANQTGQMLAALAGLPQATFASKVQIADGKASVTREVDGGLETLSVKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+ PRLK L+  E      G+ +     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTVKPEDLGVDVAPRLKTLKVVEPAKRSAGVMVPDVATLVA 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|209551137|ref|YP_002283054.1| electron transfer flavoprotein alpha/beta-subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209536893|gb|ACI56828.1| Electron transfer flavoprotein alpha/beta-subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 249

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 139/249 (55%), Positives = 186/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K D SG+E  N K+SMNPFDEI++EE+L+L+E G   EV+V
Sbjct: 1   MKILVPVKRVVDYNVKIRVKPDGSGVELANVKMSMNPFDEISVEEALRLKEAGKCEEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+++ +EPL++AKIL+ +   E P ++I GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILVETDDAVEPLTVAKILKGVADAEQPGLIIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+   QATF S I+I D  A VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALLGSAQATFASKIEIGDGKAEVTREVDGGLQTIEIKLPAVVTSDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +D TPRLKVL+ EE    + G+++ S  +LI+
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKAPADFGVDTTPRLKVLKTEEPSGRKAGVKVKSVAELID 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 RLKNEAGVL 249


>gi|27376488|ref|NP_768017.1| electron transfer flavoprotein beta subunit [Bradyrhizobium
           japonicum USDA 110]
 gi|30179274|sp|P53575|ETFB_BRAJA RecName: Full=Electron transfer flavoprotein subunit beta;
           Short=Beta-ETF; AltName: Full=Electron transfer
           flavoprotein small subunit; Short=ETFSS
 gi|27349628|dbj|BAC46642.1| electron transfer flavoprotein beta subunit [Bradyrhizobium
           japonicum USDA 110]
          Length = 249

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 184/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K D SG+E  N K+SMNPFDEIA+EE+L+L+E G ATEV+V
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKGDGSGVELANVKMSMNPFDEIAVEEALRLKEGGKATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E ++  LAMGADRGIL+++  T+EPL++AKIL+++ ++E P ++I GKQ  
Sbjct: 61  VSIGPAQASETIRTGLAMGADRGILVKAEGTVEPLAVAKILKKVAEEEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W QATF S +++  +   VTREV  G  T++   PA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWSQATFASKLEVEGSDFKVTREVDGGLQTVKLKGPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I +K   D+ +D+T RL+VL+  E    + G+++    +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPIAEKTVADYGVDVTARLEVLKTTEPAGRKAGVKVKDVAELVS 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|315497539|ref|YP_004086343.1| electron transfer flavoprotein alpha/beta-subunit [Asticcacaulis
           excentricus CB 48]
 gi|315415551|gb|ADU12192.1| Electron transfer flavoprotein alpha/beta-subunit [Asticcacaulis
           excentricus CB 48]
          Length = 248

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 124/244 (50%), Positives = 180/244 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K++MNPFDEIA+EE+++L+EKG  TE++ 
Sbjct: 1   MKVLVPVKRVLDYNVKVRVKSDQTGVDLANVKMAMNPFDEIAVEEAVRLKEKGTVTEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + E +L+ +LAMGADRG+L+E+++ LEPL++AK+L+ +V +ENP IV+ GKQ  
Sbjct: 61  VSIGVAQCEAILRTALAMGADRGLLVETDQDLEPLAVAKVLKAVVAQENPDIVLMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++N TGQML+ L+ WPQATF S ++I  + A+VTREV  G  T+   LPAVIT DL L
Sbjct: 121 DGDNNATGQMLSTLLDWPQATFASKVEISGSEALVTREVDGGLQTLGVQLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++ K   D+ +D   RL V++  E      G+++ +   LI 
Sbjct: 181 NEPRYASLPNIMKAKKKPLDTKALADYGVDAAARLTVVKVTEPAKRSAGIKVDNADGLIA 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 NLKT 244


>gi|190893628|ref|YP_001980170.1| electron transport flavoprotein, beta subunit [Rhizobium etli CIAT
           652]
 gi|190698907|gb|ACE92992.1| electron transport flavoprotein, beta subunit [Rhizobium etli CIAT
           652]
          Length = 249

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 185/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K D +G+E  N K+SMNPFDEI++EE+L+L+E G A EV+V
Sbjct: 1   MKILVPVKRVVDYNVKIRVKPDGTGVELANVKMSMNPFDEISVEEALRLKEAGKAEEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+ + +EPL++AKIL+ +   E P +VI GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILVETEDAVEPLAVAKILKAVADAEQPGLVIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+   QATF S I+I D  A VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALLGSAQATFASKIEIGDGKATVTREVDGGLQTIEIKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +  TPRLKVL+ EE    + G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKSPADFGVSTTPRLKVLKTEEPSGRKAGVKVKSVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 RLKNEAGVL 249


>gi|311108126|ref|YP_003980979.1| electron transfer flavoprotein subunit beta 2 [Achromobacter
           xylosoxidans A8]
 gi|310762815|gb|ADP18264.1| electron transfer flavoprotein subunit beta 2 [Achromobacter
           xylosoxidans A8]
          Length = 254

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 120/245 (48%), Positives = 181/245 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+ +L+EKG   EV+ 
Sbjct: 6   MKILVPVKRVVDYNVKVRVKSDQTGVDIANVKMSMNPFDEIAVEEATRLKEKGAVAEVVA 65

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRG+L++++  L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 66  VSCGVAQCQETLRTAMAIGADRGVLVQTDAELQPLAVAKLLKALVDKEQPQLVILGKQAI 125

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ WPQATF S +++ D   +VTREV  G  T+   LPA++T DL L
Sbjct: 126 DDDANQTGQMLAALLDWPQATFASKVELADGKVMVTREVDGGLETLTLKLPAIVTTDLRL 185

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++     +  +D  PRLK L+  E  A + G+++     L++
Sbjct: 186 NEPRYVTLPNIMKAKKKQLDTVTPEELGVDAAPRLKTLKVSEPPARKAGIKVSDVAALVD 245

Query: 241 ILKSK 245
            LK++
Sbjct: 246 KLKNE 250


>gi|33592118|ref|NP_879762.1| electron transfer flavoprotein beta-subunit [Bordetella pertussis
           Tohama I]
 gi|33571762|emb|CAE41263.1| electron transfer flavoprotein beta-subunit [Bordetella pertussis
           Tohama I]
 gi|332381534|gb|AEE66381.1| electron transfer flavoprotein beta-subunit [Bordetella pertussis
           CS]
          Length = 249

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 180/245 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+ +L+EKG  TEV+ 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDQTGVDIANVKMSMNPFDEIAVEEATRLKEKGAVTEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G+ + +E L+ ++A+GADR +L++++  L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGAAQCQETLRTAMAIGADRAVLVQTDAELQPLAVAKLLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ WPQATF S +++ D    VTREV  G  T+   LPA++T DL L
Sbjct: 121 DDDANQTGQMLAALLDWPQATFASKVELGDGQVTVTREVDGGLETLSLNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E     D  +D  PRLK L+  E  A + G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVSPQDLGVDPAPRLKTLKVSEPPARQAGIKVPDVATLVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|257093916|ref|YP_003167557.1| Electron transfer flavoprotein alpha/beta-subunit [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257046440|gb|ACV35628.1| Electron transfer flavoprotein alpha/beta-subunit [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 249

 Score =  272 bits (696), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 178/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D S ++  N K+SMNPFDEIA+EE+++LRE G+ATEV+V
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDASDVDLANVKMSMNPFDEIAVEEAVRLREAGVATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G    +E L+ ++A+GADRGILI+++  L+PL++AK+L+ +  KE P IVI GKQ  
Sbjct: 61  VSAGVANCQETLRTAMAIGADRGILIQTDGELQPLAVAKLLKAVCDKEQPQIVICGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L+  PQATF S I +    A VTRE+  G  T+E PLPAV+T DL L
Sbjct: 121 DDDANQTGQMLAGLLNRPQATFASKIVVAGTQATVTREIDGGLETIEVPLPAVLTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +LPNI+KA+KK +E        +D+TPRLK L+  E      G+++     L+ 
Sbjct: 181 NEPRYATLPNIMKAKKKPLETTNPAALGVDVTPRLKTLKVAEPAKRTAGIKVADAADLVM 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKTEAKVI 249


>gi|332528787|ref|ZP_08404764.1| electron transfer flavoprotein alpha/beta-subunit [Hylemonella
           gracilis ATCC 19624]
 gi|332041853|gb|EGI78202.1| electron transfer flavoprotein alpha/beta-subunit [Hylemonella
           gracilis ATCC 19624]
          Length = 249

 Score =  272 bits (696), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K D +G++  N K+SMNPFDEIA+EE+++L+EKG+ATEVI 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKADSTGVDIANVKMSMNPFDEIAVEEAVRLKEKGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR IL+E++E L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVTQCQETLRTAMAIGADRAILVETSEELQPLAVAKLLKALVDKEQPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S +++ D  A VTREV  G  T+   LPA+IT DL L
Sbjct: 121 DDDANQTGQMLAALADLPQATFASKVEVADGKAKVTREVDGGLETLSITLPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+ PRLK L+  E      G+++     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTLKPEDLGVDVKPRLKTLKVSEPPKRGAGVKVPDVATLVA 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|190894922|ref|YP_001985215.1| electron transport flavoprotein, subunit beta [Rhizobium etli CIAT
           652]
 gi|190700583|gb|ACE94665.1| electron transport flavoprotein, beta subunit [Rhizobium etli CIAT
           652]
          Length = 249

 Score =  272 bits (696), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 186/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K D +G+E  N K+SMNPFDEI++EE+L+L+E G A EV+V
Sbjct: 1   MKILVPVKRVVDYNVKIRVKPDGTGVELANVKMSMNPFDEISVEEALRLKEAGKAEEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+++ +EPL++AKIL+ +   E P ++I GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILVETDDQVEPLAVAKILKAVADAEQPGLIIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+   QATF S I+I D  A VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALLGSAQATFASKIEIGDGRATVTREVDGGLQTIEIKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +  TPRLKVL+ EE    + G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKSPADFGVSTTPRLKVLKTEEPSGRKAGVKVKSVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 RLKNEAGVL 249


>gi|1209054|gb|AAB00906.1| EtfS [Bradyrhizobium japonicum]
          Length = 249

 Score =  272 bits (696), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 184/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K D SG+E  N K+SMNPFDEIA+EE+L+L+E G ATEV+V
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKADGSGVELANVKMSMNPFDEIAVEEALRLKEGGKATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E ++  LAMGADRGIL+++  T+EPL++AKIL+++ ++E P ++I GKQ  
Sbjct: 61  VSIGPAQASETIRTGLAMGADRGILVKAEGTVEPLAVAKILKKVAEEEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W QATF S +++  +   VTREV  G  T++   PA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWSQATFASKLEVEGSDFKVTREVDGGLQTVKLKGPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I +K   D+ +D+T RL+VL+  E    + G+++    +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPIAEKTVADYGVDVTARLEVLKTTEPAGRKAGVKVKDVAELVS 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|17545642|ref|NP_519044.1| electron transfer flavoprotein subunit beta [Ralstonia solanacearum
           GMI1000]
 gi|17427935|emb|CAD14625.1| probable electron transfer flavoprotein (beta-subunit) [Ralstonia
           solanacearum GMI1000]
          Length = 249

 Score =  272 bits (695), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKVLVAVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+E+ E L+PL++AK+L+ ++ KE P ++I GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGILVETGEELQPLAVAKLLKALIDKEQPQLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S ++I D  A VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDANQTGQMLAALAGLPQATFASKVQIDDGRASVTREVDGGLETLSVKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+ PRLK L+  E      G+ +     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTVKPEDLGVDVAPRLKTLKVAEPPKRSAGVMVPDVATLVA 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|323135804|ref|ZP_08070887.1| Electron transfer flavoprotein alpha/beta-subunit [Methylocystis
           sp. ATCC 49242]
 gi|322398895|gb|EFY01414.1| Electron transfer flavoprotein alpha/beta-subunit [Methylocystis
           sp. ATCC 49242]
          Length = 248

 Score =  272 bits (695), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 181/243 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K D SG++  N K+SMNPFDEIA+EE+L+L+E G ATEV+V
Sbjct: 1   MKILVPVKRVVDYNVKIRVKPDGSGVDLANVKMSMNPFDEIAVEEALRLKEAGKATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K +E L+  LAMGADRGIL++++ET+EPL++AKIL +IV +E P +VI GKQ  
Sbjct: 61  VSIGPAKADETLRTGLAMGADRGILVKTDETVEPLAVAKILAKIVAEEQPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W Q TF S +++ D    VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWGQGTFASKVELADGSVDVTREIDGGLQTVSLKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNIIKA+KK +  K   D+ +D+TPRL+VL+  E      G+++ S  +L+ 
Sbjct: 181 NEPRYASLPNIIKAKKKEVAVKAPADYGVDITPRLEVLKTAEPATRSAGVKVGSVAELVS 240

Query: 241 ILK 243
            LK
Sbjct: 241 KLK 243


>gi|171057545|ref|YP_001789894.1| electron transfer flavoprotein alpha/beta-subunit [Leptothrix
           cholodnii SP-6]
 gi|170774990|gb|ACB33129.1| Electron transfer flavoprotein alpha/beta-subunit [Leptothrix
           cholodnii SP-6]
          Length = 249

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 181/245 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ TEVI 
Sbjct: 1   MKALVPVKRVVDYNVKVRVKSDGTGVDLANVKMSMNPFDEIAIEEAVRLKEKGVLTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR IL+E++  L+PL++AK+L+ +V++E P ++I GKQ  
Sbjct: 61  VSCGLTQCQETLRTALAIGADRAILVETDAELQPLAVAKLLKALVEREQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL + PQATF S +++ D  A VTRE+  G  T+   LPAVIT DL L
Sbjct: 121 DDDCNQTGQMLAALAKLPQATFASKVEVADGKATVTREIDGGLETLSLTLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++K    D  +D+TPRL+ L   E    + G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKPLDKVTPADLGVDVTPRLRTLSVAEPAGRKAGIKVADVAALVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|71906850|ref|YP_284437.1| electron transfer flavoprotein subunit beta [Dechloromonas
           aromatica RCB]
 gi|71846471|gb|AAZ45967.1| Electron transfer flavoprotein beta-subunit [Dechloromonas
           aromatica RCB]
          Length = 249

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 178/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKADGSGVDLANVKMSMNPFDEIAIEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G    +E L+ ++A+GADRGIL+E++  L+PL++AK+L+ +  KE P +VI GKQ  
Sbjct: 61  VSCGVAACQETLRTAMAIGADRGILVETDVELQPLAVAKLLKALCDKEQPQLVICGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  WPQATF S + + D  A VTRE+  G  T+   LPAV++ DL L
Sbjct: 121 DDDANQTGQMLAALQNWPQATFASKVVVADGKATVTREIDGGLETLAISLPAVVSTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +LPNI+KA+KK ++  K  D  +D+ PRL  L+  E      G+++    +L+ 
Sbjct: 181 NEPRYATLPNIMKAKKKPLDTVKPADLGVDVAPRLTTLKVSEPAKRSAGVKVADVAELVN 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|222087343|ref|YP_002545880.1| electron transport flavoprotein [Agrobacterium radiobacter K84]
 gi|222102166|ref|YP_002546756.1| electron transfer flavoprotein beta-subunit beta-etf flavoprotein
           small subunit [Agrobacterium radiobacter K84]
 gi|221724791|gb|ACM27947.1| electron transport flavoprotein [Agrobacterium radiobacter K84]
 gi|221728283|gb|ACM31292.1| electron transfer flavoprotein beta-subunit beta-etf flavoprotein
           small subunit [Agrobacterium radiobacter K84]
          Length = 249

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 185/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K D +G+E  N K+SMNPFDEI++EE+L+L+E G A EV+V
Sbjct: 1   MKILVPVKRVVDYNVKIRVKPDGTGVELANVKMSMNPFDEISVEEALRLKEAGKAEEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+++ +EPL++AKIL+ +   E P ++I GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILVETDDAVEPLAVAKILKGVADAEQPGLIIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+   QATF S I+I D  A VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALLGSAQATFASKIEIGDGKATVTREVDGGLQTIEIKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +   PRLKVL+ EE    + G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKSPADFGVSTEPRLKVLKTEEPSGRKAGIKVGSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAGVL 249


>gi|86747945|ref|YP_484441.1| electron transfer flavoprotein subunit beta [Rhodopseudomonas
           palustris HaA2]
 gi|86570973|gb|ABD05530.1| Electron transfer flavoprotein beta-subunit [Rhodopseudomonas
           palustris HaA2]
          Length = 249

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 184/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN K+R+K+D SG+E  N K+SMNPFDEIA+EE+L+L+E G ATE++V
Sbjct: 1   MKVLVPVKRVVDYNVKIRVKSDGSGVELANVKMSMNPFDEIAVEEALRLKEAGKATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E L+  LAMGADRGIL+++  ++EPL++AKIL+ I  +E P ++I GKQ  
Sbjct: 61  VSIGPAQASETLRTGLAMGADRGILVKAEGSVEPLAVAKILKAIADEEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W QATF S +++  +   V+REV  G+ T++   PA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWSQATFASKLEVDGSDFQVSREVDGGSQTVKLKGPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I +K A  + +DL PRL+VL+  E    + G+++    +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPIAEKTADQYGVDLAPRLEVLKTVEPSGRKAGVKVKDVAELVS 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAGVI 249


>gi|260222966|emb|CBA33061.1| Electron transfer flavoprotein subunit beta [Curvibacter putative
           symbiont of Hydra magnipapillata]
          Length = 249

 Score =  271 bits (694), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 124/244 (50%), Positives = 180/244 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ TEVI 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEKGVVTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+E+ E L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGILVETTEELQPLAVAKLLKALVDKEQPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL   PQATF S ++++D  A VTREV  G  T+   LPA+IT DL L
Sbjct: 121 DDDCNQTGQMLAALADLPQATFASKVEVVDGKAHVTREVDGGLETLAVSLPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +++ PR+K L   E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTFKPEDLGVNVAPRIKTLSVAEPAKRSAGIKVPDVATLVD 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKN 244


>gi|311104929|ref|YP_003977782.1| electron transfer flavoprotein subunit beta 1 [Achromobacter
           xylosoxidans A8]
 gi|310759618|gb|ADP15067.1| electron transfer flavoprotein subunit beta 1 [Achromobacter
           xylosoxidans A8]
          Length = 249

 Score =  271 bits (694), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 180/245 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+ +L+EKG   EV+ 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDQTGVDIANVKMSMNPFDEIAVEEATRLKEKGAVAEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRG+L++++  L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGVLVQTDAELQPLAVAKLLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ WPQATF S +++ D    VTREV  G  T+   LPA++T DL L
Sbjct: 121 DDDANQTGQMLAALLDWPQATFASKVELADGKVTVTREVDGGLETLTLKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++     +  +D  PRLK L+  E  A + G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTVTPEELGVDAAPRLKTLKVSEPPARKAGIKVADVAALVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|295691010|ref|YP_003594703.1| electron transfer flavoprotein alpha/beta-subunit [Caulobacter
           segnis ATCC 21756]
 gi|295432913|gb|ADG12085.1| Electron transfer flavoprotein alpha/beta-subunit [Caulobacter
           segnis ATCC 21756]
          Length = 248

 Score =  271 bits (694), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 124/244 (50%), Positives = 177/244 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN K R+K D +G++  N K+SMNPF EIA+EE+++L+EKG+ATEV++
Sbjct: 1   MKVLVPVKRVIDYNVKARVKADQTGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEVVI 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E ++ +LAMG DRGILI S+  LEPL++AK+L  +V +ENP +V+ GKQ  
Sbjct: 61  VSIGPAQAQETIRTALAMGGDRGILITSDADLEPLAVAKLLAAVVAEENPNLVVMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++N  GQML+AL+ WPQAT+ S +++  + A VTREV  G  T++  LPAV+T DL L
Sbjct: 121 DGDNNAVGQMLSALLGWPQATYASALEVSGSTAKVTREVDGGLQTLDVDLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I  K   D+ +D+ PRLKVL+  E      G+++ +   L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKEIASKTVADYGVDVAPRLKVLKVTEPAKRSAGVKVETAADLVS 240

Query: 241 ILKS 244
            L +
Sbjct: 241 KLNT 244


>gi|56695623|ref|YP_165974.1| electron transfer flavoprotein, beta subunit [Ruegeria pomeroyi
           DSS-3]
 gi|56677360|gb|AAV94026.1| electron transfer flavoprotein, beta subunit [Ruegeria pomeroyi
           DSS-3]
          Length = 252

 Score =  271 bits (694), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 186/247 (75%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A E++V
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKAEEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + ++ +EPL++AKIL +IV++E P IV+AG
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVVAADDVHQDIEPLAVAKILAKIVEEEQPGIVLAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W Q TF S + +  +HA+VTREV  G  T++  +PA+ITV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQGTFASELNVEGDHALVTREVDGGLQTIKVKMPAIITV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D++PRL++++ EE  A   G+ + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVSPRLEIVKTEEPPARAAGIVVGSVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVAKLK 247


>gi|103485674|ref|YP_615235.1| electron transfer flavoprotein beta-subunit [Sphingopyxis
           alaskensis RB2256]
 gi|98975751|gb|ABF51902.1| electron transfer flavoprotein beta-subunit [Sphingopyxis
           alaskensis RB2256]
          Length = 249

 Score =  271 bits (694), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 124/244 (50%), Positives = 178/244 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K R+K D +G++  N K+SMNPFDEIA+EE+++L+EKG+ATE++ 
Sbjct: 1   MKILVPVKRVLDYNVKPRVKADGTGVDLANVKMSMNPFDEIAVEEAIRLKEKGVATEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K +E L+ +LAMGADR IL+++++ +EPL++AKIL+ I   E P +VI GKQ  
Sbjct: 61  VSIGPAKAQETLRTALAMGADRAILVQTDDAVEPLAVAKILKSIADAEQPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  W Q TF S + +  +H  VTREV  G  T++  LPA++T DL L
Sbjct: 121 DDDNNQTGQMLAALTGWAQGTFASAVNVEGDHVSVTREVDGGLETVKLKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+ K ++ K  TD+ +D TPR+K L+  E    + G+++    +L+ 
Sbjct: 181 NEPRYASLPNIMKAKSKPLDVKAPTDYGVDTTPRVKTLKVSEPPVRQAGIKVADVDELVA 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKA 244


>gi|312795469|ref|YP_004028391.1| Electron transfer flavoprotein beta-subunit [Burkholderia
           rhizoxinica HKI 454]
 gi|312167244|emb|CBW74247.1| Electron transfer flavoprotein beta-subunit [Burkholderia
           rhizoxinica HKI 454]
          Length = 253

 Score =  271 bits (693), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 177/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 5   MKVLVPVKRVVDYNVKVRVKSDGTGVDVANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 64

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G+   +E L+ +LA+GADR ILIE+ E L+PL++AK+L  +V +E P +VI GKQ  
Sbjct: 65  VSAGAVACQETLRTALAIGADRAILIEAQEELQPLAVAKLLNALVAREQPQLVILGKQAI 124

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL  WPQATF S + +    A V REV  G  T+   LPAV+T DL L
Sbjct: 125 DDDSNQTGQMLAALAGWPQATFASKVTVEGGRATVAREVDGGAETLSLTLPAVVTTDLRL 184

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E       ++D+ PRLK L+  E      G+++     L++
Sbjct: 185 NEPRYVTLPNIMKAKKKPLETVTPQALSVDVAPRLKTLKVAEPPKRSAGVKVPDVATLVD 244

Query: 241 ILKSKHDLL 249
            LK +  +L
Sbjct: 245 KLKGEAKVL 253


>gi|227823220|ref|YP_002827192.1| electron transfer flavoprotein beta-subunit [Sinorhizobium fredii
           NGR234]
 gi|227342221|gb|ACP26439.1| electron transfer flavoprotein beta-subunit [Sinorhizobium fredii
           NGR234]
          Length = 249

 Score =  271 bits (693), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 186/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V+++N K+R+K D +G+E  N K+SMNPFDEI++EE+L+L+E G A+EV+V
Sbjct: 1   MKILVTVKRVVDFNVKIRVKADGTGVELANVKMSMNPFDEISVEEALRLKEAGKASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E++E +EPL++AKI++ + + E P ++I GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILVETDEQVEPLTVAKIVKGVAEAEQPGLIIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQML+AL+ W Q TF S ++I D    VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLSALLGWAQGTFASKVEIGDGKVNVTREVDGGLQTVELKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +D  PRLKVL+ EE    + G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKSPADFGVDTAPRLKVLKTEEPSGRKAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LKS+  +L
Sbjct: 241 KLKSEAGVL 249


>gi|186473639|ref|YP_001860981.1| electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           phymatum STM815]
 gi|184195971|gb|ACC73935.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           phymatum STM815]
          Length = 249

 Score =  271 bits (693), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV  K V++YN  VR+ +D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKVLVATKRVVDYNVTVRVNSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR ILIESNE L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSAGVTQCQETLRTALAIGADRAILIESNEDLQPLAVAKLLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V+REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALANLPQATFASKVVVADGKATVSREVDGGAETLSLTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +++TPRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVKPEDLGVNVTPRLKTLKVSEPPKRSAGVKVADVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|33603732|ref|NP_891292.1| electron transfer flavoprotein beta-subunit [Bordetella
           bronchiseptica RB50]
 gi|33577857|emb|CAE35122.1| electron transfer flavoprotein beta-subunit [Bordetella
           bronchiseptica RB50]
          Length = 249

 Score =  271 bits (693), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 179/245 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+ +L+EKG   EV+ 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDQTGVDIANVKMSMNPFDEIAVEEATRLKEKGAVAEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G+ + +E L+ ++A+GADR +L++++  L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGAAQCQETLRTAMAIGADRAVLVQTDAELQPLAVAKLLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ WPQATF S +++ D    VTREV  G  T+   LPA++T DL L
Sbjct: 121 DDDANQTGQMLAALLDWPQATFASKVELGDGQVTVTREVDGGLETLSLNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E     D  +D  PRLK L+  E  A + G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVSPQDLGVDPAPRLKTLKVSEPPARQAGIKVPDVATLVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|182680174|ref|YP_001834320.1| electron transfer flavoprotein alpha/beta-subunit [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182636057|gb|ACB96831.1| Electron transfer flavoprotein alpha/beta-subunit [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 249

 Score =  271 bits (693), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 126/244 (51%), Positives = 181/244 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVPIK VI+ N + R+K D +G++  N K+S+NPF EIA+EE+L+L+EKG A+E+++
Sbjct: 2   MKILVPIKQVIDANVRPRVKADGTGVDLSNVKLSINPFCEIAVEEALRLKEKGKASEIVI 61

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K +E ++++ +MGADRGI +E+++ +EPL++AK+L+ I+ +E P +VI GKQ  
Sbjct: 62  VSIGPAKAQEAVRSAYSMGADRGIFVETDQRVEPLAVAKLLKAIIDQEQPSLVILGKQAI 121

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLA L  WPQATF S +++      VTREV  G  T+   LPA++T DL L
Sbjct: 122 DDDSNQTGQMLAGLTNWPQATFASKVEVDAGKVDVTREVDGGLQTLSLTLPAIVTTDLRL 181

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PRY +LPNI+KA+KK I+ KK  DF +D+TPRLKVL+  E  A + G+++ S   L++
Sbjct: 182 NNPRYPTLPNIMKAKKKAIDVKKPEDFGVDITPRLKVLKVTEPPARKPGIKVASAEDLVK 241

Query: 241 ILKS 244
            LKS
Sbjct: 242 DLKS 245


>gi|239834744|ref|ZP_04683072.1| Electron transfer flavoprotein subunit beta [Ochrobactrum
           intermedium LMG 3301]
 gi|239822807|gb|EEQ94376.1| Electron transfer flavoprotein subunit beta [Ochrobactrum
           intermedium LMG 3301]
          Length = 269

 Score =  271 bits (693), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 121/233 (51%), Positives = 175/233 (75%)

Query: 12  NYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEV 71
           +YN K+R+K D SG+E  N K+SMNPFDEIA+EE+++L+E G  TE++ VS+G  + +E 
Sbjct: 33  DYNVKIRVKGDGSGVELSNVKMSMNPFDEIAVEEAIRLKEAGKVTEIVAVSVGPAQAQET 92

Query: 72  LKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQML 131
           L+ +LAMGADR IL++++ET+EPL +AK+L+ +V+ E P +V  GKQ  D++SNQTGQML
Sbjct: 93  LRTALAMGADRAILVKTDETVEPLGVAKVLKGVVEAEKPDLVFLGKQAIDDDSNQTGQML 152

Query: 132 AALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNI 191
           +AL+ W QATF S +++ D  A VTREV  G  T++  LPA++TVDL LN+PRY SLPNI
Sbjct: 153 SALLSWSQATFASKVELGDGSAKVTREVDGGLQTIDVKLPAIVTVDLRLNQPRYASLPNI 212

Query: 192 IKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIEILKS 244
           +KA+KK +++K   DF  D+ PRLKVL+ EE    + G+++ S  +L+E LK+
Sbjct: 213 MKAKKKPLDEKSPADFGADIAPRLKVLKTEEPGGRKAGVKVGSVAELVEKLKA 265


>gi|115526837|ref|YP_783748.1| electron transfer flavoprotein beta-subunit [Rhodopseudomonas
           palustris BisA53]
 gi|115520784|gb|ABJ08768.1| electron transfer flavoprotein beta-subunit [Rhodopseudomonas
           palustris BisA53]
          Length = 249

 Score =  271 bits (693), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN K+R+K+D SG+E  N K+SMNPFDEIA+EE+L+L+E G A+EV+V
Sbjct: 1   MKVLVPVKRVVDYNVKIRVKSDGSGVELANIKMSMNPFDEIAVEEALRLKEAGKASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E ++  LAMGADRGIL++ +  +EPL++AKIL+ +  +E P +VI GKQ  
Sbjct: 61  VSIGPAQASETIRTGLAMGADRGILVKVDGNVEPLAVAKILKAVADEEKPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W QATF S +++      VTRE+  G  T++   PA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWGQATFASKLEVEGTDFKVTREIDGGLQTIQVKGPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I +K A D+ +DLTPRL++L+  E    + G+++    +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPIAEKTAADYGVDLTPRLEILKTVEPGGRKAGVKVKDVAELVS 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAGVI 249


>gi|13473012|ref|NP_104579.1| electron transfer flavoprotein beta chain, (ETFSS) [Mesorhizobium
           loti MAFF303099]
 gi|14023760|dbj|BAB50365.1| electron transfer flavoprotein beta chain [Mesorhizobium loti
           MAFF303099]
          Length = 249

 Score =  271 bits (693), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++ N KVR+K D S +E  N K++MNPFDEIA+EE+++L+E G A E+IV
Sbjct: 1   MKILVPVKRVVDANVKVRVKADGSAVELANVKMAMNPFDEIAVEEAIRLKEAGKAEEIIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E L+ +LAMGADR IL++++E  EPL +AK+L+ +V  E P +VI GKQ  
Sbjct: 61  VSIGPQQAQETLRTALAMGADRAILVKTDEQTEPLGVAKVLKGVVDAEQPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W Q TF S + +  + A VTREV  G  T+E  +PA+IT DL L
Sbjct: 121 DDDSNQTGQMLAALLGWAQGTFASKVVLDGDKAKVTREVDGGLQTVELKMPAIITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N+PRY SLPNI+KA+KK++++K   D+  D+ PRLKV++ EE    + G+++ S  +L++
Sbjct: 181 NQPRYASLPNIMKAKKKQLDEKTPADYGADVKPRLKVIKTEEPGGRKAGVKVKSVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|330991359|ref|ZP_08315310.1| Electron transfer flavoprotein subunit beta [Gluconacetobacter sp.
           SXCC-1]
 gi|329761378|gb|EGG77871.1| Electron transfer flavoprotein subunit beta [Gluconacetobacter sp.
           SXCC-1]
          Length = 249

 Score =  271 bits (692), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN K R+K D SG+ET   K+SMNPFDEIA+EE+++L+EKG+ +E+I 
Sbjct: 1   MKVLVPVKRVIDYNIKPRVKADGSGVETAGVKMSMNPFDEIAVEEAVRLKEKGVVSEIIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K ++ L+ ++AMGADR IL+E++   EPL++AK+L+ +V+KE P +VI GKQ  
Sbjct: 61  VSIGEAKAQDTLRTAMAMGADRSILVETDVVTEPLAVAKVLKALVEKEKPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ N TGQMLA L+  PQATF S + + D    VTRE+  G  T++  LPA+IT DL L
Sbjct: 121 DDDMNATGQMLAGLLDRPQATFASKVDVADGAVTVTREIDGGAQTIKLALPAIITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KARKK +EK    D  +D+TPRL V+   E    + G++L S  +L+ 
Sbjct: 181 NEPRYASLPNIMKARKKPMEKITPADLGVDMTPRLSVISVAEPPERKAGIKLDSAAELVS 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 RLRNEAKVI 249


>gi|148259168|ref|YP_001233295.1| electron transfer flavoprotein beta-subunit [Acidiphilium cryptum
           JF-5]
 gi|326402321|ref|YP_004282402.1| electron transfer flavoprotein beta subunit [Acidiphilium
           multivorum AIU301]
 gi|146400849|gb|ABQ29376.1| electron transfer flavoprotein beta-subunit [Acidiphilium cryptum
           JF-5]
 gi|325049182|dbj|BAJ79520.1| electron transfer flavoprotein beta subunit [Acidiphilium
           multivorum AIU301]
          Length = 249

 Score =  271 bits (692), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 178/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D SG+E    K+SMNPFDEIA+EE+++L+EKG+ATE++ 
Sbjct: 1   MKLLVPVKRVVDYNVKVRVKSDGSGVELAGVKMSMNPFDEIAVEEAVRLKEKGVATEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G    +E ++ +LAMGADRGIL+E+   L+PL++AK+L+ +V +E   +VI GKQ  
Sbjct: 61  VSMGVSACQETIRTALAMGADRGILVETEAELQPLAVAKMLKALVTREQADLVIMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ N TGQMLAAL+ WPQ TF S + I D    VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDMNATGQMLAALLGWPQGTFASKVAIADGTVTVTREVDGGLETVALKLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KARKK IE  K  D  +D  PRL  L+  E    + G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKARKKPIETVKPEDLGVDPAPRLTTLKVAEPPQRKAGVKVGSVAELVE 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|187477862|ref|YP_785886.1| electron transfer flavoprotein subunit beta [Bordetella avium 197N]
 gi|115422448|emb|CAJ48973.1| electron transfer flavoprotein beta-subunit [Bordetella avium 197N]
          Length = 249

 Score =  271 bits (692), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 179/245 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D S ++  N K+SMNPFDEIA+EE+ +L+EKG   EVI 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDQSDVDIANVKMSMNPFDEIAVEEATRLKEKGSIAEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRG+L++++  L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGVLVQTDAELQPLAVAKLLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ WPQATF S +++ D +  VTREV  G  T+   LPA+IT DL L
Sbjct: 121 DDDANQTGQMLAALLDWPQATFASKVELGDGNVTVTREVDGGLETLTLKLPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++     D  +D  PRLK L+  E  A + G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLDTVTPQDLGVDAAPRLKTLKVTEPAARKAGIKVADVAALVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|326389074|ref|ZP_08210656.1| electron transfer flavoprotein subunit beta [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326206674|gb|EGD57509.1| electron transfer flavoprotein subunit beta [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 248

 Score =  271 bits (692), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 183/249 (73%), Gaps = 1/249 (0%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN K R+K D SG++  N K+SMNPFDEIA+EE+++L+E+G+ATEV+V
Sbjct: 1   MKVLVPVKRVIDYNVKARVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKERGVATEVLV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+ + +E L+ +LAMGADR ILIE+++ +EPL++AK+L ++V +E P +V+ GKQ  
Sbjct: 61  VSIGAKQAQETLRTALAMGADRAILIETDD-VEPLAVAKLLAKVVAEEEPGLVLTGKQAI 119

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           DN+ N TGQMLAAL+ WPQATF S + +  +   VTREV  G  T+   LPAV+T DL L
Sbjct: 120 DNDMNATGQMLAALLGWPQATFASAVTVEGDGVTVTREVDGGLQTIRLRLPAVVTADLRL 179

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+ K +  +   DF +D+TPRL V+   E  A + G+++ S  +L+ 
Sbjct: 180 NEPRYASLPNIMKAKSKPLATRVPADFGVDITPRLTVVDTREPAARKAGIKVGSVEELVA 239

Query: 241 ILKSKHDLL 249
            L+ +  +L
Sbjct: 240 KLRDEAGVL 248


>gi|293604187|ref|ZP_06686595.1| electron transfer flavoprotein beta subunit [Achromobacter
           piechaudii ATCC 43553]
 gi|292817412|gb|EFF76485.1| electron transfer flavoprotein beta subunit [Achromobacter
           piechaudii ATCC 43553]
          Length = 249

 Score =  271 bits (692), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 180/245 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+ +L+EKG   EV+ 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDQTGVDIANVKMSMNPFDEIAVEEATRLKEKGAVAEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRG+L++++  L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGVLVQTDAELQPLAVAKLLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ WPQATF S +++ D    VTREV  G  T+   LPA++T DL L
Sbjct: 121 DDDANQTGQMLAALLDWPQATFASKVELADGKVTVTREVDGGLETLTLKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++     +  +D  PRLK L+  E  A + G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTVTPEELGVDPAPRLKTLKVSEPPARKAGIKVADVAALVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|91789003|ref|YP_549955.1| electron transfer flavoprotein subunit beta [Polaromonas sp. JS666]
 gi|91698228|gb|ABE45057.1| electron transfer flavoprotein beta-subunit [Polaromonas sp. JS666]
          Length = 249

 Score =  271 bits (692), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+ +L+EKG+ TEVI 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAIEEATRLKEKGVVTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR IL+E+ E L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVLQCQETLRTAMAIGADRAILVETAEELQPLAVAKLLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL+ WPQATF S +++    A VTREV  G  T+   LPA+IT DL L
Sbjct: 121 DDDCNQTGQMLAALLGWPQATFASKVEVEGGQAKVTREVDGGLETLALTLPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+ PR+K L+  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDNVKPEDLGVDVKPRIKTLKVSEPPKRSAGVKVADVAALVD 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|206563456|ref|YP_002234219.1| electron transfer flavoprotein subunit beta [Burkholderia
           cenocepacia J2315]
 gi|198039496|emb|CAR55463.1| electron transfer flavoprotein, beta subunit [Burkholderia
           cenocepacia J2315]
          Length = 249

 Score =  271 bits (692), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++ N KV +K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEV+ 
Sbjct: 1   MKVLVAVKRVVDANVKVGVKSDRTGVDIANAKMSMNPFDEIAVEEAVRLKEAGVATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+ESNE +EPL +AK+L+ +V +E P +VI GKQ  
Sbjct: 61  VSVGVAQAQETLRTALAIGADRAILVESNEGVEPLGVAKVLKALVDREQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S + I D HA V REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDANQTGQMLAALAGLPQATFASKVVIADGHATVAREVDGGAQTLSLRLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PR+KVL+  E      G+++     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVKPDDLGVDVLPRVKVLKVSEPPKRAAGVKVPDVQTLVG 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|187918909|ref|YP_001887940.1| electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           phytofirmans PsJN]
 gi|187717347|gb|ACD18570.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           phytofirmans PsJN]
          Length = 249

 Score =  271 bits (692), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 181/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR ILIES++ L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSAGVTQSQETLRTALAIGADRAILIESSQELQPLAVAKLLKALVDKEQPSLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V+REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVVVADGKATVSREVDGGAETLSLKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+TPRL  L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLEVLKPEDLGVDVTPRLTTLKVVEPPKRSAGVKVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|222083305|ref|YP_002542708.1| electron transfer flavoprotein beta subunit [Agrobacterium vitis
           S4]
 gi|221738685|gb|ACM39523.1| electron transfer flavoprotein beta subunit [Agrobacterium vitis
           S4]
          Length = 249

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 186/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++YN K+R+K D +G+E  N K+SMNPFDEI++EE+L+LRE G ATEV+V
Sbjct: 1   MKILVSVKRVVDYNVKIRVKPDGTGVELANVKMSMNPFDEISVEEALRLREAGKATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+++ +EPL++AKI + + + E P ++I GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILVETDDAVEPLTVAKIFKGVAEAEQPGLIIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAALM   QATF S I++ D  A VTREV  G  T++  LPAVIT DL L
Sbjct: 121 DDDSNQTGQMLAALMGIAQATFASKIELGDGKATVTREVDGGLQTIDITLPAVITSDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +  TPRLKVL+ EE    + G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKTPADFGVSTTPRLKVLKTEEPGGRKAGVKVGSVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|307316075|ref|ZP_07595532.1| Electron transfer flavoprotein alpha/beta-subunit [Sinorhizobium
           meliloti BL225C]
 gi|306898277|gb|EFN29006.1| Electron transfer flavoprotein alpha/beta-subunit [Sinorhizobium
           meliloti BL225C]
          Length = 251

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 186/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++YN K+R+K D SG+E  N K+SMNPFDEI++EE+L+L+E G A+EV+V
Sbjct: 3   MKILVTVKRVVDYNVKIRVKADGSGVELANVKMSMNPFDEISVEEALRLKEAGKASEVVV 62

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+ + +EPL++AKI++ + + E P ++I GKQ  
Sbjct: 63  VSIGPAKAEETLRTALAMGADRAILVETEDQVEPLAVAKIVKGVAEAEQPGLIIVGKQAI 122

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQML+AL+ W Q TF S ++I D    VTREV  G  T+E  LPAV+T DL L
Sbjct: 123 DDDSNQTGQMLSALLGWAQGTFASKVEIGDGKVNVTREVDGGLQTVELKLPAVVTTDLRL 182

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +D +PRLKVL+ EE    + G+++ +  +L+E
Sbjct: 183 NEPRYASLPNIMKAKKKPLDKKTPADFGVDTSPRLKVLKTEEPSGRKAGVKVKTVAELVE 242

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 243 KLKTEAGVL 251


>gi|171059221|ref|YP_001791570.1| electron transfer flavoprotein alpha/beta-subunit [Leptothrix
           cholodnii SP-6]
 gi|170776666|gb|ACB34805.1| Electron transfer flavoprotein alpha/beta-subunit [Leptothrix
           cholodnii SP-6]
          Length = 249

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++LREKG+ TEVI 
Sbjct: 1   MKALVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAIEEAVRLREKGVLTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G+ + +E L+ ++A+GADR IL+E+ E L+PL++AK+L+ +V +E P +++ GKQ  
Sbjct: 61  VSCGAAQCQETLRTAMAIGADRAILVETAEELQPLAVAKLLKALVDREQPGLILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S + +ID  A VTRE+  G  T+   LPAVIT DL L
Sbjct: 121 DDDNNQTGQMLAALADLPQATFASKVDVIDGRARVTREIDGGLETISLSLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D++PRLK L+  E      G+++     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETIKPADLGVDVSPRLKTLKVSEPPKRGAGIKVPDVATLVA 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|33597651|ref|NP_885294.1| electron transfer flavoprotein beta-subunit [Bordetella
           parapertussis 12822]
 gi|33602430|ref|NP_889990.1| electron transfer flavoprotein beta-subunit [Bordetella
           bronchiseptica RB50]
 gi|33574079|emb|CAE38403.1| electron transfer flavoprotein beta-subunit [Bordetella
           parapertussis]
 gi|33576869|emb|CAE33949.1| electron transfer flavoprotein beta-subunit [Bordetella
           bronchiseptica RB50]
          Length = 266

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 120/245 (48%), Positives = 179/245 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+ +L+EKG   EV+ 
Sbjct: 18  MKVLVPVKRVVDYNVKVRVKSDQTGVDIANVKMSMNPFDEIAVEEATRLKEKGAVAEVVA 77

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G+ + +E L+ ++A+GADR +L++++  L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 78  VSCGAAQCQETLRTAMAIGADRAVLVQTDAELQPLAVAKLLKALVDKEQPQLVILGKQAI 137

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ WPQATF S +++ D    VTREV  G  T+   LPA++T DL L
Sbjct: 138 DDDANQTGQMLAALLDWPQATFASKVELGDGQVTVTREVDGGLETLSLNLPAIVTTDLRL 197

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E     D  +D  PRLK L+  E  A + G+++     L++
Sbjct: 198 NEPRYVTLPNIMKAKKKPLETVSPQDLGVDPAPRLKTLKVSEPPARQAGIKVPDVATLVD 257

Query: 241 ILKSK 245
            LK++
Sbjct: 258 KLKNE 262


>gi|260466706|ref|ZP_05812893.1| Electron transfer flavoprotein alpha/beta-subunit [Mesorhizobium
           opportunistum WSM2075]
 gi|259029569|gb|EEW30858.1| Electron transfer flavoprotein alpha/beta-subunit [Mesorhizobium
           opportunistum WSM2075]
          Length = 249

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++ N KVR+K D S +E  N K++MNPFDEIA+EE+++L+E G A E+IV
Sbjct: 1   MKILVPVKRVVDANVKVRVKADGSAVELANVKMAMNPFDEIAVEEAIRLKEAGKAEEIIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E L+ +LAMGADR IL++++E  EPL +AK+L+ +V+ E P +VI GKQ  
Sbjct: 61  VSIGPQQAQETLRTALAMGADRAILVKTDEQTEPLGVAKVLKGVVEAEQPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W Q TF S + +  + A VTREV  G  T+E  +PA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWAQGTFASKVVLDGDKAKVTREVDGGLQTVELKMPAIVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N+PRY SLPNI+KA+KK +++K   D+  D+ PRLKV++ EE    + G+++ S  +L++
Sbjct: 181 NQPRYASLPNIMKAKKKPLDEKSPADYGADVKPRLKVIKTEEPSGRKAGVKVKSVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|163759911|ref|ZP_02166995.1| electron transport flavoprotein, beta subunit [Hoeflea
           phototrophica DFL-43]
 gi|162282869|gb|EDQ33156.1| electron transport flavoprotein, beta subunit [Hoeflea
           phototrophica DFL-43]
          Length = 249

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 188/249 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K D SG++  N K+SMNPFDEIA+EE+L+L+E G ATEV+ 
Sbjct: 1   MKILVPVKRVVDYNVKIRVKPDGSGVDLANVKMSMNPFDEIAIEEALRLKEAGKATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+ K EE L+ +LAMGADR IL+E    +EPLS+AKIL+ I  +ENP ++I GKQ  
Sbjct: 61  VSIGAAKSEETLRTALAMGADRAILVEVEGIVEPLSVAKILKGIASEENPDLMILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQML+AL+ W QATF S ++I D  A VTREV  G  T+   LPA++T DL L
Sbjct: 121 DDDANQTGQMLSALLGWSQATFASKVEIGDGSADVTREVDGGLQTISVKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   D+ +D+ PRL+V++ EE    + G+++ S ++L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKTPGDYGVDVAPRLEVIKTEEPGGRKAGVKVGSVSELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|300024916|ref|YP_003757527.1| electron transfer flavoprotein alpha/beta-subunit [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526737|gb|ADJ25206.1| Electron transfer flavoprotein alpha/beta-subunit [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 251

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 131/251 (52%), Positives = 185/251 (73%), Gaps = 2/251 (0%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+VP+K V++YN K+R+K D SGI+  N K+SMNPFDEIA+EE+++L+EK  A EV+V
Sbjct: 1   MKIVVPVKRVVDYNVKIRVKPDGSGIDLANVKMSMNPFDEIAVEEAVRLKEKSGAQEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNE--TLEPLSIAKILREIVKKENPIIVIAGKQ 118
           VSIG  K +E L+ +LA+GADR ILIE+ +   +EPL++AK+L+ +V+ E P +VI GKQ
Sbjct: 61  VSIGPAKAQETLRTALAIGADRAILIETADGTNVEPLAVAKLLKAVVEAEKPDLVILGKQ 120

Query: 119 TTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDL 178
             D++SNQTGQMLA+L+ WPQ TF S +        VTREV  G  T++  LPAV+T DL
Sbjct: 121 AIDDDSNQTGQMLASLLDWPQGTFASKVVTDAGSVTVTREVDGGLETIKLKLPAVVTTDL 180

Query: 179 NLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKL 238
            LNEPRY SLPNI+KA+KK ++ KK  DF +D++PRLKVL+  E    + G+++ S  +L
Sbjct: 181 RLNEPRYPSLPNIMKAKKKPLDVKKPEDFGVDVSPRLKVLKTTEPPTRKAGVKVGSVAEL 240

Query: 239 IEILKSKHDLL 249
           ++ LK++  +L
Sbjct: 241 VQKLKTEAGIL 251


>gi|299066890|emb|CBJ38085.1| Electron transfer flavoprotein, beta-subunit [Ralstonia
           solanacearum CMR15]
          Length = 249

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+YN KVR+K+D SG++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKVLVAVKRVIDYNVKVRVKSDGSGVDLANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+E+ E L+PL++AK+L+ ++ KE P ++I GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGILVETGEELQPLAVAKLLKALIDKEQPQLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S ++I +  A VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDANQTGQMLAALAGLPQATFASKVQIAEGKASVTREVDGGLETLSVKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++  K  D  +D+ PRLK L+  E      G+ +     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKPLDTVKPEDLGVDVAPRLKTLKVAEPPKRSAGVMVPDVATLVA 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|171057879|ref|YP_001790228.1| electron transfer flavoprotein alpha/beta-subunit [Leptothrix
           cholodnii SP-6]
 gi|170775324|gb|ACB33463.1| Electron transfer flavoprotein alpha/beta-subunit [Leptothrix
           cholodnii SP-6]
          Length = 249

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ TEVI 
Sbjct: 1   MKALVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAIEEAVRLKEKGVVTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+E+ E L+PL++AK+L+ +V +E P ++I GKQ  
Sbjct: 61  VSCGVTQCQETLRTAMAIGADRGILVETTEELQPLAVAKLLKALVDREQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S +++ID  A VTRE+  G  T+   LPAVIT DL L
Sbjct: 121 DDDNNQTGQMLAALTDLPQATFASKVEVIDGRANVTREIDGGLETISLSLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D++PRLK L+  E      G+++     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKPLEIIKPADLGVDVSPRLKTLKVSEPPKRGAGIKVPDVATLVA 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|241763342|ref|ZP_04761398.1| Electron transfer flavoprotein alpha/beta-subunit [Acidovorax
           delafieldii 2AN]
 gi|241367494|gb|EER61793.1| Electron transfer flavoprotein alpha/beta-subunit [Acidovorax
           delafieldii 2AN]
          Length = 249

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D SG++  N K+SMNPFDEIA+EE+++L+EKG+ TEVI 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDGSGVDIANVKMSMNPFDEIAVEEAVRLKEKGVVTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+E+ E L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGILVETTEELQPLAVAKLLKALVDKEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S +++  +   VTREV  G  T++   PAV+T DL L
Sbjct: 121 DDDANQTGQMLAALADLPQATFASKLEVAGDKVSVTREVDGGLETLQLTTPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++  KA D  +D+ PRLK L+  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKPLDTVKAEDLGVDVAPRLKTLKVTEPPKRGAGIKVPDVATLVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|319781308|ref|YP_004140784.1| electron transfer flavoprotein alpha/beta-subunit [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317167196|gb|ADV10734.1| Electron transfer flavoprotein alpha/beta-subunit [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 249

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++ N KVR+K D S +E  N K++MNPFDEIA+EE+++L+E G A E+IV
Sbjct: 1   MKILVPVKRVVDANVKVRVKADGSAVELANVKMAMNPFDEIAVEEAIRLKEAGKAEEIIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E L+ +LAMGADR IL++++E  EPL +AK+L+ +V  E P +VI GKQ  
Sbjct: 61  VSIGPQQAQETLRTALAMGADRAILVKTDEQTEPLGVAKVLKGVVDAEQPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W Q TF S I +  + A VTREV  G  T+E  +P ++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWAQGTFASKIVLDGDKAKVTREVDGGLQTVELKMPVIVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N+PRY SLPNI+KA+KK++++K   D+  D+ PRLKV++ EE    + G+++ S  +L++
Sbjct: 181 NQPRYASLPNIMKAKKKQLDEKSPADYGADVKPRLKVIKTEEPSGRKAGVKVKSVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|84515180|ref|ZP_01002543.1| electron transfer flavoprotein, beta subunit [Loktanella
           vestfoldensis SKA53]
 gi|84511339|gb|EAQ07793.1| electron transfer flavoprotein, beta subunit [Loktanella
           vestfoldensis SKA53]
          Length = 252

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 180/247 (72%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++LRE G   EV+ 
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLREAGTVEEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNET----LEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+ ++E     +EPL++AKIL  IVK+ENP +VI G
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVVASEDVHQDIEPLAVAKILAAIVKEENPGLVICG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W QATF S + I  +HA VTREV  G  T++  +P +I+V
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQATFASEVSIDGDHATVTREVDGGLQTIKVKMPTIISV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K   D+ +D+TPRL V++  E    + G+ + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTPADYGVDVTPRLSVVKTVEPGTRKAGIIVKSVD 240

Query: 237 KLIEILK 243
           +L+E LK
Sbjct: 241 ELVEKLK 247


>gi|150397730|ref|YP_001328197.1| electron transfer flavoprotein alpha/beta-subunit [Sinorhizobium
           medicae WSM419]
 gi|150029245|gb|ABR61362.1| Electron transfer flavoprotein alpha/beta-subunit [Sinorhizobium
           medicae WSM419]
          Length = 249

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 186/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++YN K+R+K D SG+E  N K+SMNPFDEI++EE+L+L+E G A+EVIV
Sbjct: 1   MKILVTVKRVVDYNVKIRVKADGSGVELANVKMSMNPFDEISVEEALRLKEAGKASEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+ + +EPL++AKI++ + + E P ++I GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILVETEDQVEPLAVAKIVKGVAEAEQPGLIIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQML+AL+ W Q TF S ++I D    VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLSALLGWAQGTFASKVEIGDGKVNVTREVDGGLQTVELKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +D +PRLKVL+ EE    + G+++ +  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKSPADFGVDTSPRLKVLKTEEPSGRKAGVKVKTVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|160896849|ref|YP_001562431.1| electron transfer flavoprotein subunit alpha/beta [Delftia
           acidovorans SPH-1]
 gi|160362433|gb|ABX34046.1| Electron transfer flavoprotein alpha/beta-subunit [Delftia
           acidovorans SPH-1]
          Length = 249

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEKGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+E+ E L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGILVETTEELQPLAVAKLLKALVDKEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S +++  +   VTREV  G  T+   LPAVIT DL L
Sbjct: 121 DDDANQTGQMLAALADLPQATFASKVEVAGDKVNVTREVDGGLETLALSLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  +  +D+ PRLK L+  E      G+++     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTVKPEELGVDVAPRLKTLKVAEPAKRGAGVKVPDVATLVS 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|260429718|ref|ZP_05783694.1| electron transfer flavoprotein subunit beta [Citreicella sp. SE45]
 gi|260419201|gb|EEX12455.1| electron transfer flavoprotein subunit beta [Citreicella sp. SE45]
          Length = 249

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 181/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V+++N K+R+K D SG+E  N K+SMNPFDEIA+EE+++L+E G A+EVI 
Sbjct: 1   MKVLVPVKRVVDHNVKIRVKADGSGVELANVKMSMNPFDEIAVEEAIRLKEAGKASEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LAMGADR ILI + + +EPLS+AK+L+ +V+ E P +VI GKQ  
Sbjct: 61  VSVGPAQAQETLRTALAMGADRAILITAEDAVEPLSVAKLLKGVVEAEEPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQML+AL+ W Q TF S +++ +  A VTREV  G   +E  LPA++T DL L
Sbjct: 121 DDDCNQTGQMLSALLGWSQGTFASALELGETKAKVTREVDGGLQAIEIALPAIVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E +   D+ + +  RL VLR EE  A   G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLETRSPQDYGVTVARRLTVLRVEEPAARAAGVKVASVAELLD 240

Query: 241 ILKSKHDLL 249
            LKS+  +L
Sbjct: 241 KLKSESGVL 249


>gi|121605032|ref|YP_982361.1| electron transfer flavoprotein subunit beta [Polaromonas
           naphthalenivorans CJ2]
 gi|120594001|gb|ABM37440.1| electron transfer flavoprotein beta-subunit [Polaromonas
           naphthalenivorans CJ2]
          Length = 249

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 181/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D SG++  N K+SMNPFDEIA+EE+++L+EKG+ TEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGSGVDIANVKMSMNPFDEIAIEEAVRLKEKGVVTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR IL+E+ E L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVLQCQETLRTAMAIGADRAILVETGEELQPLAVAKLLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL+ W QATF S +++    A VTREV  G  T+   LPA+IT DL L
Sbjct: 121 DDDCNQTGQMLAALLGWGQATFASKVEVEGGVARVTREVDGGLETLSLTLPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PR+K L+  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKPLENVKPADLGVDVAPRIKTLKVSEPPKRSAGIKVLDVAALVD 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|15966396|ref|NP_386749.1| putative electron transfer flavoprotein BETA-subunit BETA-ETF
           flavoprotein small subunit [Sinorhizobium meliloti 1021]
 gi|307318176|ref|ZP_07597612.1| Electron transfer flavoprotein alpha/beta-subunit [Sinorhizobium
           meliloti AK83]
 gi|307321023|ref|ZP_07600429.1| Electron transfer flavoprotein alpha/beta-subunit [Sinorhizobium
           meliloti AK83]
 gi|15075667|emb|CAC47222.1| Putative electron transfer flavoprotein beta-subunit beta-ETF
           flavoprotein small subunit [Sinorhizobium meliloti 1021]
 gi|306893298|gb|EFN24078.1| Electron transfer flavoprotein alpha/beta-subunit [Sinorhizobium
           meliloti AK83]
 gi|306896217|gb|EFN26967.1| Electron transfer flavoprotein alpha/beta-subunit [Sinorhizobium
           meliloti AK83]
          Length = 249

 Score =  269 bits (688), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 186/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++YN K+R+K D SG+E  N K+SMNPFDEI++EE+L+L+E G A+EV+V
Sbjct: 1   MKILVTVKRVVDYNVKIRVKADGSGVELANVKMSMNPFDEISVEEALRLKEAGKASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+ + +EPL++AKI++ + + E P ++I GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILVETEDQVEPLAVAKIVKGVAEAEQPGLIIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQML+AL+ W Q TF S ++I D    VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLSALLGWAQGTFASKVEIGDGKVNVTREVDGGLQTVELKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +D +PRLKVL+ EE    + G+++ +  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKTPADFGVDTSPRLKVLKTEEPSGRKAGVKVKTVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAGVL 249


>gi|160897831|ref|YP_001563413.1| electron transfer flavoprotein subunit alpha/beta [Delftia
           acidovorans SPH-1]
 gi|160363415|gb|ABX35028.1| Electron transfer flavoprotein alpha/beta-subunit [Delftia
           acidovorans SPH-1]
          Length = 249

 Score =  269 bits (688), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ATEVI 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEKGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+E+ E L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGILVETTEELQPLAVAKLLKALVDKEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S +++  +   VTREV  G  T+   LPAVIT DL L
Sbjct: 121 DDDANQTGQMLAALADLPQATFASKVEVAGDKVNVTREVDGGLETLALSLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  +  +D+ PRLK L+  E      G+++     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTVKPEELGVDVAPRLKTLKVAEPAKRGAGVKVPDVATLVS 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|221065504|ref|ZP_03541609.1| Electron transfer flavoprotein alpha/beta-subunit [Comamonas
           testosteroni KF-1]
 gi|264678063|ref|YP_003277970.1| electron transfer flavoprotein beta-subunit [Comamonas testosteroni
           CNB-2]
 gi|264679887|ref|YP_003279796.1| electron transfer flavoprotein beta-subunit [Comamonas testosteroni
           CNB-2]
 gi|220710527|gb|EED65895.1| Electron transfer flavoprotein alpha/beta-subunit [Comamonas
           testosteroni KF-1]
 gi|262208576|gb|ACY32674.1| electron transfer flavoprotein beta-subunit [Comamonas testosteroni
           CNB-2]
 gi|262210402|gb|ACY34500.1| electron transfer flavoprotein beta-subunit [Comamonas testosteroni
           CNB-2]
          Length = 249

 Score =  269 bits (688), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ TEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEKGVVTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+E++  L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGILVETDVELQPLAVAKLLKALVDKEQPGLVICGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S +++  +   VTREV  G  T+    PAVIT DL L
Sbjct: 121 DDDANQTGQMLAALADLPQATFASKVEVAGDKVNVTREVDGGLETVALSTPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+TPRLK ++  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTFKPEDLGVDVTPRLKTVKVSEPAKRGAGVKVADVAALVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|227822587|ref|YP_002826559.1| electron transfer flavoprotein, beta subunit [Sinorhizobium fredii
           NGR234]
 gi|227341588|gb|ACP25806.1| electron transfer flavoprotein, beta subunit [Sinorhizobium fredii
           NGR234]
          Length = 248

 Score =  269 bits (687), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 131/244 (53%), Positives = 182/244 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+VP+K V++YN K+R+K D SG+E  N K+SMNPFDEI++EE+L+L+E G A+EV+V
Sbjct: 1   MKIIVPVKRVVDYNVKIRVKADGSGVELANVKMSMNPFDEISVEEALRLKEAGKASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+ + +EPL++AKI++ + + E P ++I GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILVETEDQVEPLTVAKIVKGVAEAEQPGLIIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQML+AL+ W Q TF S +++ D    VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLSALLGWAQGTFASKVELGDGKVNVTREVDGGLQTVELKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +D  PRLKVL+ EE    + G+++ S  +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKSPADFGVDTAPRLKVLKTEEPSGRKAGIKVKSVAELVS 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 SLKT 244


>gi|159042773|ref|YP_001531567.1| electron transfer flavoprotein subunit beta [Dinoroseobacter shibae
           DFL 12]
 gi|157910533|gb|ABV91966.1| electron transfer flavoprotein beta subunit [Dinoroseobacter shibae
           DFL 12]
          Length = 252

 Score =  269 bits (687), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 128/247 (51%), Positives = 181/247 (73%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G+ATE++ 
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGVATEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNET----LEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR ILI + +     +EPL++AK+L  +V++E P +V+ G
Sbjct: 61  VSIGVKQSQETLRTALAMGADRAILIVATDDVHTDIEPLAVAKLLAAVVREEEPGLVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W QATF S +KI   HA VTREV  G  T++  LPA+++V
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQATFASEVKIDGAHAHVTREVDGGLQTIKVKLPAIVSV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K   D+ +D+TPRL VL+  E      G+++ S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTPADYGVDITPRLSVLKTAEPAERAAGIKVGSVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVAKLK 247


>gi|120612943|ref|YP_972621.1| electron transfer flavoprotein subunit beta [Acidovorax citrulli
           AAC00-1]
 gi|120591407|gb|ABM34847.1| electron transfer flavoprotein beta-subunit [Acidovorax citrulli
           AAC00-1]
          Length = 249

 Score =  269 bits (687), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEKGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR IL+E+ E L+PL++AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVTQCQETLRTAMAIGADRAILVETAEELQPLAVAKILKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S +++  +   VTREV  G  T+   LPA++T DL L
Sbjct: 121 DDDSNQTGQMLAALADLPQATFASKVEVNGDKVNVTREVDGGLETLALALPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+ PRLK L+  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTVKPEDLGVDVAPRLKTLKVTEPPKRGAGVKVPDVATLVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|288962755|ref|YP_003453049.1| electron transfer flavoprotein beta subunit [Azospirillum sp. B510]
 gi|288915021|dbj|BAI76505.1| electron transfer flavoprotein beta subunit [Azospirillum sp. B510]
          Length = 249

 Score =  269 bits (687), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 126/245 (51%), Positives = 176/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN K+R+K D SG+ET N K+SMNPFDEIA+EE+++L+E G ATE++V
Sbjct: 1   MKVLVPVKRVVDYNVKIRVKADGSGVETANVKMSMNPFDEIAVEEAVRLKEAGKATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LAMGADR IL++++   EPL++AK+L+ +V+KE P +VI GKQ  
Sbjct: 61  VSVGPTQAQETLRTALAMGADRAILVQTDVATEPLAVAKVLKALVEKEGPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL+ W Q TF S I   D    VTRE+  G  T+E  LPAV+T DL L
Sbjct: 121 DDDCNQTGQMLAALLGWGQGTFASKIAAGDGTVAVTREIDGGLETVELKLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +D+TPRLK L+  E    + G+++     L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPLETVTPDALGVDVTPRLKTLKVAEPAKRQAGVKVPDVATLVT 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKTE 245


>gi|332284728|ref|YP_004416639.1| electron transfer flavoprotein beta-subunit [Pusillimonas sp. T7-7]
 gi|330428681|gb|AEC20015.1| electron transfer flavoprotein beta-subunit [Pusillimonas sp. T7-7]
          Length = 249

 Score =  269 bits (687), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 177/245 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D S ++  N K+SMNPFDEIA+EE+ +L+EKG+ATEV+ 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDQSAVDIANVKMSMNPFDEIAIEEATRLKEKGVATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR  L++++  L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRAALVQTDAELQPLAVAKLLKALVDKEQPELVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ WPQATF S +++ D    VTREV  G  T+   LPA++T DL L
Sbjct: 121 DDDANQTGQMLAALLNWPQATFASKVEVADGKVTVTREVDGGLETLSLKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E     D  +D+ PRLK L+  E      G+ +     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKPLEVVTPEDLGVDVAPRLKTLKVSEPPTRSAGIVVPDVATLVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|90420253|ref|ZP_01228161.1| electron transfer flavoprotein beta-subunit [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90335587|gb|EAS49337.1| electron transfer flavoprotein beta-subunit [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 249

 Score =  269 bits (687), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 185/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN K+R+K D +G++  N K+SMNPFDEIA+EE+++L+E G  TE++ 
Sbjct: 1   MKVLVAVKRVVDYNVKIRVKPDGTGVDLANVKMSMNPFDEIAVEEAIRLKEAGTVTEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E ++ +LAMGADRGIL+++++  EPL++AKIL+ +V+ E+P +VI GKQ  
Sbjct: 61  VSVGPQQAQETIRTALAMGADRGILVKTDQPTEPLAVAKILKGVVEAESPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL+ W Q TF + I++ D  A VTREV  G  T+   +PA++T DL L
Sbjct: 121 DDDCNQTGQMLAALLGWSQGTFANKIELTDGKATVTREVDGGLQTVALKMPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E+K   D+ +D+TPRL++L+  E      G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLEEKSPDDYGVDITPRLEILKTAEPGKREAGVKVASVDELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|16263215|ref|NP_436008.1| EtfB2 electron transport flavoprotein, beta subunit [Sinorhizobium
           meliloti 1021]
 gi|14523885|gb|AAK65420.1| EtfB2 electron transport flavoprotein, beta subunit [Sinorhizobium
           meliloti 1021]
          Length = 249

 Score =  268 bits (686), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 186/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++YN K+R+K D SG+E  N K+SMNPFDEI++EE+L+L+E G A+EV+V
Sbjct: 1   MKILVTVKRVVDYNVKIRVKADGSGVELANVKMSMNPFDEISVEEALRLKEAGKASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+ + +EPL++AKI++ + + E P ++I GKQ  
Sbjct: 61  VSIGPGKAEETLRTALAMGADRAILVETEDQVEPLAVAKIVKGVAEAEQPGLIIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQML+AL+ W Q TF S ++I D    VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLSALLGWAQGTFASKVEIGDGKVNVTREVDGGLQTVELKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +D +PRLKVL+ EE    + G+++ +  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKTPADFGVDTSPRLKVLKTEEPSGRKAGVKVKTVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAGVL 249


>gi|264679573|ref|YP_003279480.1| electron transfer flavoprotein beta-subunit [Comamonas testosteroni
           CNB-2]
 gi|262210086|gb|ACY34184.1| electron transfer flavoprotein beta-subunit [Comamonas testosteroni
           CNB-2]
          Length = 249

 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ TEVI 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEKGVVTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+E++  L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGILVETDVELQPLAVAKLLKALVDKEQPGLVICGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S +++  +   VTREV  G  T+    PAVIT DL L
Sbjct: 121 DDDANQTGQMLAALADLPQATFASKVEVAGDKVNVTREVDGGLETVALSTPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+TPRLK ++  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTFKPEDLGVDVTPRLKTVKVSEPAKRGAGVKVADVAALVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|302125400|gb|ADK93985.1| electron transfer flavoprotein beta subunit-like protein
           [Sphingopyxis macrogoltabida]
          Length = 249

 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 174/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K VI+YN K R+K D SG++  N K+SMNPFDEIA+EE+L+L+E G A EVI 
Sbjct: 1   MKILVPVKRVIDYNVKPRVKADGSGVDLANVKMSMNPFDEIAVEEALRLKEAGKAEEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K +E L+ +LAMGADR IL+E++E +EPL++AKIL+ I  +E P IV+ GKQ  
Sbjct: 61  VSVGPAKAQETLRTALAMGADRAILVETDEAVEPLAVAKILKAIADEEAPGIVMLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAALM  PQ TF S +++  +   VTREV  G  T++  LPA++T DL L
Sbjct: 121 DDDSNQTGQMLAALMGRPQGTFASKVEVEGDAVTVTREVDGGLETVKLTLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++ K   DF +D+ PRL VL+  E    + G +      L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPLDVKTPGDFGVDIAPRLTVLKVVEPPVRQAGEKFADVDALLA 240

Query: 241 ILKSK 245
            LK K
Sbjct: 241 KLKEK 245


>gi|134293270|ref|YP_001117006.1| electron transfer flavoprotein beta-subunit [Burkholderia
           vietnamiensis G4]
 gi|134136427|gb|ABO57541.1| electron transfer flavoprotein beta-subunit [Burkholderia
           vietnamiensis G4]
          Length = 261

 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           +KILV +K V++ N KV +K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEV+ 
Sbjct: 13  LKILVAVKRVVDANVKVGVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVVA 72

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+ES + +EPL++AKIL+ +V KE P +VI GKQ  
Sbjct: 73  VSVGVTQAQETLRTALAIGADRAILVESTDGVEPLAVAKILKALVDKEQPQLVILGKQAI 132

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V REV  G  T+   LPAV+T DL L
Sbjct: 133 DDDSNQTGQMLAALAGLPQATFASKVTVADGKATVAREVDGGAETLSLTLPAVVTTDLRL 192

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+TPRLK L+  E      G+++     L+E
Sbjct: 193 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVTPRLKTLKVAEPPKRAAGVKVPDVKTLVE 252

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 253 KLKTEAKVL 261


>gi|222112181|ref|YP_002554445.1| electron transfer flavoprotein alpha/beta-subunit [Acidovorax
           ebreus TPSY]
 gi|221731625|gb|ACM34445.1| Electron transfer flavoprotein alpha/beta-subunit [Acidovorax
           ebreus TPSY]
          Length = 249

 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEKGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+E++  L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGILVETDAELQPLAVAKLLKALVDKEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S +++  +   VTREV  G  T++   PAVIT DL L
Sbjct: 121 DDDANQTGQMLAALADLPQATFASKVEVAGDKVSVTREVDGGLETLQLTTPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++  K  D  +D+ PRLK L+  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKPLDTVKPEDLGVDVAPRLKTLKVAEPPKRGAGVKVPDVATLVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|121596020|ref|YP_987916.1| electron transfer flavoprotein subunit beta [Acidovorax sp. JS42]
 gi|120608100|gb|ABM43840.1| electron transfer flavoprotein beta-subunit [Acidovorax sp. JS42]
          Length = 249

 Score =  268 bits (685), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEKGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+E++  L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGILVETDAELQPLAVAKLLKALVDKEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S +++  +   VTREV  G  T++   PAVIT DL L
Sbjct: 121 DDDANQTGQMLAALADLPQATFASKVEVAGDKVSVTREVDGGLETLQLTTPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++  K  D  +D+ PRLK L+  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKPLDTIKPEDLGVDVAPRLKTLKVAEPPKRGAGVKVPDVATLVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|84503301|ref|ZP_01001379.1| electron transfer flavoprotein, beta subunit [Oceanicola batsensis
           HTCC2597]
 gi|84388355|gb|EAQ01305.1| electron transfer flavoprotein, beta subunit [Oceanicola batsensis
           HTCC2597]
          Length = 252

 Score =  268 bits (685), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 130/249 (52%), Positives = 179/249 (71%), Gaps = 4/249 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+ PIK +I+YN KVR+K D SG+   N K+SMNPFDEIA+EE+++L+E G A E++V
Sbjct: 1   MKIIAPIKHLIDYNVKVRVKADGSGVGLANVKMSMNPFDEIAVEEAIRLKEAGKADELVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + ++ +EPL++AKIL+ ++  E P +VIAG
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVVAADDVHQDIEPLAVAKILKAVIDAEAPGLVIAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQMLAAL+ W QAT+ S + I   HA+VTREV  G  T++  LPA++T 
Sbjct: 121 KQAIDNDMNATGQMLAALLGWGQATYASEVAIEGEHAVVTREVDGGLQTIKVKLPAIVTA 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A DF +D+TPRL V++  E  A   G  + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADFGVDVTPRLTVVKTAEPAARSAGEMVGSVD 240

Query: 237 KLIEILKSK 245
           +L+  LK K
Sbjct: 241 ELVSKLKEK 249


>gi|240850513|ref|YP_002971912.1| electron transfer flavoprotein beta subunit [Bartonella grahamii
           as4aup]
 gi|240267636|gb|ACS51224.1| electron transfer flavoprotein beta subunit [Bartonella grahamii
           as4aup]
          Length = 248

 Score =  268 bits (685), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 127/246 (51%), Positives = 180/246 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+V +K V++YN K+R+K D +G++  + K+SMNPFDEIA+EE+++ +E G  +EV++
Sbjct: 1   MKIIVAVKRVVDYNIKIRVKPDSTGVDLSHVKMSMNPFDEIAVEEAIRQKESGKISEVLL 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+  LAMGADR +L+ +++TLEPL+IAK+L+ IV +E P +V  GKQ  
Sbjct: 61  VSIGPEAAQETLRTGLAMGADRALLVTTDQTLEPLAIAKVLKAIVDEEKPDMVFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W QATF S++ I + HA VTREV +GT T+  PLP V+T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWGQATFASHLNIENGHATVTREVDNGTQTLCLPLPMVMTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK IE+K   D  ID   RL +L  EE +  + G+++ +  +L+ 
Sbjct: 181 NEPRYTSLPNIMKAKKKNIEQKSLADLGIDTEARLTILSVEEPKPRQSGIKVANVVELVS 240

Query: 241 ILKSKH 246
            LK K+
Sbjct: 241 ALKQKN 246


>gi|237745663|ref|ZP_04576143.1| electron transfer flavoprotein alpha/beta-subunit [Oxalobacter
           formigenes HOxBLS]
 gi|229377014|gb|EEO27105.1| electron transfer flavoprotein alpha/beta-subunit [Oxalobacter
           formigenes HOxBLS]
          Length = 249

 Score =  268 bits (685), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 130/250 (52%), Positives = 188/250 (75%), Gaps = 2/250 (0%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K D SGIET+N K+SMNPFDEIA+EE+++ +E G+ATEV+ 
Sbjct: 1   MKILVPVKRVVDYNVKIRVKPDGSGIETDNVKMSMNPFDEIAVEEAVRQKEAGVATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  K ++ L+ ++A+GADR IL+++  +L+PL++AK+L++IV+KE P +VI GKQ T
Sbjct: 61  VSCGVEKSQDTLRTAMAIGADRSILVKTEASLQPLAVAKMLKKIVEKEQPDVVILGKQAT 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ WPQAT VS + I +  AIVTRE+  G  T+   LPAV+TVDL L
Sbjct: 121 DDDANQTGQMLAALLDWPQATSVSKLVIENGKAIVTREIDEGQETLALQLPAVVTVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYST-TKLI 239
           NEPRY++LPN++KARKK IE     +  + +  RLK+L+  E  A R  +R+ S    L+
Sbjct: 181 NEPRYVTLPNMMKARKKTIESTTPDELGVSVESRLKILKVAEP-AARSEVRMVSDIATLV 239

Query: 240 EILKSKHDLL 249
            +LK++  ++
Sbjct: 240 SLLKNEAKVI 249


>gi|221065861|ref|ZP_03541966.1| Electron transfer flavoprotein alpha/beta-subunit [Comamonas
           testosteroni KF-1]
 gi|220710884|gb|EED66252.1| Electron transfer flavoprotein alpha/beta-subunit [Comamonas
           testosteroni KF-1]
          Length = 249

 Score =  268 bits (685), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ TEVI 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEKGVVTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+E++  L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGILVETDVELQPLAVAKLLKALVDKEQPGLIICGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S +++  +   VTREV  G  T+    PAVIT DL L
Sbjct: 121 DDDANQTGQMLAALADLPQATFASKVEVAGDKVNVTREVDGGLETVALATPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+TPRLK ++  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTFKPEDLGVDVTPRLKTVKVSEPAKRGAGVKVADVAALVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|209546972|ref|YP_002278890.1| electron transfer flavoprotein alpha/beta-subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209538216|gb|ACI58150.1| Electron transfer flavoprotein alpha/beta-subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 249

 Score =  268 bits (685), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 185/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+ +K D SG+E  N K+SMNPFDEI++EE+L+L+E G   EV+V
Sbjct: 1   MKILVPVKRVVDYNVKILVKPDGSGVELANVKMSMNPFDEISVEEALRLKEAGRCEEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+++ +EPL++AKIL+ +V  E P ++I GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILVETDDQVEPLTVAKILKGVVDAEQPGLIIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+   QATF S I+I D  A VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALLGSAQATFASKIEIGDGKAQVTREVDGGLQTIEIKLPAVVTSDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +  TPRLKVL+ EE    + G+++ S  +LI+
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKSPADFGVSTTPRLKVLKTEEPSGRKAGVKVKSVAELID 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 RLKNEAGVL 249


>gi|330824128|ref|YP_004387431.1| electron transfer flavoprotein subunit alpha/beta [Alicycliphilus
           denitrificans K601]
 gi|329309500|gb|AEB83915.1| Electron transfer flavoprotein alpha/beta-subunit [Alicycliphilus
           denitrificans K601]
          Length = 249

 Score =  268 bits (685), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 181/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEKGAATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR IL+E++  L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRAILVETDAELQPLAVAKLLKALVDKEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S ++I  + A VTRE+  G  T+   LPAV+T DL L
Sbjct: 121 DDDANQTGQMLAALADLPQATFASKVEIAGDKANVTREIDGGLETLSLGLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  + + PRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLESVKPEDLGVQVAPRLKTLKVAEPAKRGAGVKVADVAALVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|288958112|ref|YP_003448453.1| electron transfer flavoprotein beta subunit [Azospirillum sp. B510]
 gi|288910420|dbj|BAI71909.1| electron transfer flavoprotein beta subunit [Azospirillum sp. B510]
          Length = 249

 Score =  268 bits (685), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 126/245 (51%), Positives = 176/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN K+R+K D SG+ET N K+SMNPFDEIA+EE+++ +E G ATE++V
Sbjct: 1   MKLLVPVKRVVDYNVKIRVKADGSGVETANVKMSMNPFDEIAVEEAVRCKEAGNATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LAMGADR IL++++ T EPL++AK+L+ +V+KE P +VI GKQ  
Sbjct: 61  VSVGPAQAQETLRTALAMGADRAILVQTDVTTEPLAVAKVLKALVEKEAPGMVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL+ W Q TF S +   D    VTRE+  G  T+E  LPAV+T DL L
Sbjct: 121 DDDCNQTGQMLAALLGWGQGTFASKVAAGDGTVAVTREIDGGLETVELKLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        ID+TPRLK L+  E    + G+++     L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPLETVTPDALGIDVTPRLKTLKVAEPAKRQAGIKVPDVATLVT 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKTE 245


>gi|114799429|ref|YP_762143.1| electron transfer flavoprotein subunit beta [Hyphomonas neptunium
           ATCC 15444]
 gi|114739603|gb|ABI77728.1| electron transfer flavoprotein, beta subunit [Hyphomonas neptunium
           ATCC 15444]
          Length = 248

 Score =  268 bits (685), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 182/244 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D +G++  N K+SMNPFDEI++EE+++L+E G+ATE++V
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKPDQTGVDLANVKMSMNPFDEISVEEAVRLKEAGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E ++ +LAMGADRGILI+++ T+EPL++AK+L ++ ++E P +V+ GKQ  
Sbjct: 61  VSIGPQQAQETIRTALAMGADRGILIKTDATVEPLAVAKLLAKVAEEEKPDLVLVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ WPQ TF   ++   +   VTREV  G  T++  LPAV+TVDL L
Sbjct: 121 DDDSNQTGQMLAALLDWPQGTFAFKVEKDGDALKVTREVDGGLQTVKLALPAVVTVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I++K    + +D++PRL V++  E      G+++     L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPIDEKAPDAYGVDISPRLTVVKVTEPPTRSAGIKVEDVATLVS 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKT 244


>gi|121595131|ref|YP_987027.1| electron transfer flavoprotein subunit beta [Acidovorax sp. JS42]
 gi|222111473|ref|YP_002553737.1| electron transfer flavoprotein alpha/beta-subunit [Acidovorax
           ebreus TPSY]
 gi|120607211|gb|ABM42951.1| electron transfer flavoprotein beta-subunit [Acidovorax sp. JS42]
 gi|221730917|gb|ACM33737.1| Electron transfer flavoprotein alpha/beta-subunit [Acidovorax
           ebreus TPSY]
          Length = 249

 Score =  268 bits (684), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ATEVI 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEKGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+E++  L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGILVETDAELQPLAVAKLLKALVDKEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S +++  +   VTREV  G  T++   PAVIT DL L
Sbjct: 121 DDDANQTGQMLAALADLPQATFASKVEVAGDKVSVTREVDGGLETLQLTTPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++  K  D  +D+ PRLK L+  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKPLDTIKPEDLGVDVAPRLKTLKVAEPPKRGAGVKVPDVATLVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|241763988|ref|ZP_04762029.1| Electron transfer flavoprotein alpha/beta-subunit [Acidovorax
           delafieldii 2AN]
 gi|241366739|gb|EER61191.1| Electron transfer flavoprotein alpha/beta-subunit [Acidovorax
           delafieldii 2AN]
          Length = 249

 Score =  267 bits (683), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 181/245 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D SG++  N K+SMNPFDEIA+EE+++L+EKG+ +EVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGSGVDIANVKMSMNPFDEIAVEEAVRLKEKGLVSEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR IL+E++  L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRAILVETDAELQPLAVAKLLKALVDKEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S +++  +   VTRE+  G  T+   LPAVIT DL L
Sbjct: 121 DDDANQTGQMLAALADLPQATFASKVELSADKVSVTREIDGGLETLALTLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+TPRLK L+  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTVKPEDLGVDVTPRLKTLKVSEPPKRGAGVKVADVAALVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|83956176|ref|ZP_00964629.1| electron transfer flavoprotein, beta subunit [Sulfitobacter sp.
           NAS-14.1]
 gi|83839562|gb|EAP78742.1| electron transfer flavoprotein, beta subunit [Sulfitobacter sp.
           NAS-14.1]
          Length = 252

 Score =  267 bits (683), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 182/249 (73%), Gaps = 4/249 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+ PIK +I++N KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A EV+V
Sbjct: 1   MKIIAPIKRLIDHNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKADEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + ++ +EPL++AKIL+ ++  E P +VIAG
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVVAADDVHQDIEPLAVAKILKAVIDAEAPGLVIAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQMLAAL+ W QAT+ S + I  +HA+VTREV  G  T++  LPA++T 
Sbjct: 121 KQAIDNDMNATGQMLAALLGWGQATYASEVGIEGDHAVVTREVDGGLQTIKVKLPAIVTA 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D+TPRL++++  E  A   G  + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVTPRLEIVKTAEPAARSAGEMVGSVD 240

Query: 237 KLIEILKSK 245
           +L+  LK K
Sbjct: 241 ELVSKLKEK 249


>gi|23014715|ref|ZP_00054518.1| COG2086: Electron transfer flavoprotein, beta subunit
           [Magnetospirillum magnetotacticum MS-1]
          Length = 249

 Score =  267 bits (683), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV IK VI+YN K+R+K+D SG+ET+N K SMNPFDEIA+EE+++L+E G A EV+V
Sbjct: 1   MKVLVAIKRVIDYNVKIRVKSDGSGVETQNVKFSMNPFDEIAVEEAVRLKEAGKAAEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G     E L+ +LAMGADRG+L++S++ ++PL++AK+L+ +  KE P ++I GKQ  
Sbjct: 61  VSVGPAACSETLRTALAMGADRGVLVQSDDEVQPLAVAKVLKALAAKEAPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+  PQ TF S ++I  +   VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALLGQPQGTFASKLEIGADAVTVTREVDGGLETVSLKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I+     D  +D++PRL  L+ EE      G+++     L++
Sbjct: 181 NEPRYASLPNIMKAKKKPIDTVSPADLGVDVSPRLVTLKVEEPPKRSAGIKVADVAALVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|296163830|ref|ZP_06846510.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           Ch1-1]
 gi|295885924|gb|EFG65862.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           Ch1-1]
          Length = 245

 Score =  267 bits (683), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 127/245 (51%), Positives = 179/245 (73%)

Query: 5   VPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIG 64
           +P+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI VS G
Sbjct: 1   MPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIAVSAG 60

Query: 65  SCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNES 124
             + +E L+ +LA+GADR ILIES+E L+PL++AK+L+ +V +E P +VI GKQ  D++S
Sbjct: 61  VTQSQETLRTALAIGADRAILIESSEELQPLAVAKLLKALVDREQPSLVILGKQAIDDDS 120

Query: 125 NQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPR 184
           NQTGQMLAAL   PQATF S + + D  A V+REV  G  T+   LPAVIT DL LNEPR
Sbjct: 121 NQTGQMLAALAGLPQATFASKVVVADGKATVSREVDGGAETLSLTLPAVITTDLRLNEPR 180

Query: 185 YISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIEILKS 244
           Y++LPNI+KA+KK +E  +  D  +D+TPRLK L+  E      G+++     L+E LK+
Sbjct: 181 YVTLPNIMKAKKKPLETIRPEDLGVDVTPRLKTLKVVEPPRRSAGVKVPDVKTLVEKLKT 240

Query: 245 KHDLL 249
           +  +L
Sbjct: 241 EAKVL 245


>gi|319944231|ref|ZP_08018507.1| electron transfer flavoprotein beta subunit [Lautropia mirabilis
           ATCC 51599]
 gi|319742526|gb|EFV94937.1| electron transfer flavoprotein beta subunit [Lautropia mirabilis
           ATCC 51599]
          Length = 264

 Score =  267 bits (683), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++YN KVR+K+D + ++  N K+S+NPFDEIA+EE+++L+EKG+ATEV+ 
Sbjct: 16  MKILVAVKRVVDYNVKVRVKSDNTDVDIANVKMSINPFDEIAVEEAVRLKEKGVATEVVA 75

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G    +E L+ +LA+GADR I +E++  L+PL++AK+L  +  +E+  I++ GKQ  
Sbjct: 76  VSCGPTACQETLRTALAIGADRAIQVETDAQLQPLAVAKLLAAVQARESAGIILLGKQAI 135

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL++ PQ TF S I++ D  A VTRE+  G  T+  PLPAVIT DL L
Sbjct: 136 DDDANQTGQMLAALLKLPQGTFASKIEVADGQATVTREIDGGLETLRMPLPAVITADLRL 195

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +EK    D  +D  PRLKVL+  E  A + G+++ S  +L+E
Sbjct: 196 NEPRYVTLPNIMKAKKKPLEKFSPADLGVDPAPRLKVLKVTEPPARQGGVKVSSVEELVE 255

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 256 KLKNEAKVI 264


>gi|329902135|ref|ZP_08273039.1| Electron transfer flavoprotein, beta subunit [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327548858|gb|EGF33486.1| Electron transfer flavoprotein, beta subunit [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 250

 Score =  267 bits (683), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G ATEVIV
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAMRLKEAGKATEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRG+L+E++  L+PL++AK+++ +  KE P ++I GKQ  
Sbjct: 61  VSCGVVQCQETLRTAMAIGADRGVLVETDVELQPLAVAKLIKALADKEQPQLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL+ WPQATF S + +  +   VTREV  G  T+   LPA++T DL L
Sbjct: 121 DDDCNQTGQMLAALLGWPQATFASKVVVDGDKVAVTREVDGGLETLSLTLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PRLK L+  E      G+++     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKTLEIIKPADLGVDVAPRLKTLKVSEPPKRSAGIKVPDVATLVS 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|254418194|ref|ZP_05031918.1| electron transfer flavoprotein domain [Brevundimonas sp. BAL3]
 gi|196184371|gb|EDX79347.1| electron transfer flavoprotein domain [Brevundimonas sp. BAL3]
          Length = 254

 Score =  267 bits (683), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 128/250 (51%), Positives = 176/250 (70%), Gaps = 6/250 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLRE------KGI 54
           MK+LVP+K VI+YN K R+K D SG++  N K+SMNPFDEIA+EE+++L+E       G 
Sbjct: 1   MKVLVPVKRVIDYNVKARVKADQSGVDLANVKMSMNPFDEIAVEEAVRLKEGKEHHAAGT 60

Query: 55  ATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVI 114
           ATE++VVSIG  + +E ++ +LAMGADRGILI+S+  LEPL++AK+L+ +V++E P +V+
Sbjct: 61  ATEIVVVSIGVTQAQETIRTALAMGADRGILIQSDADLEPLAVAKLLKAVVEEEKPDLVL 120

Query: 115 AGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVI 174
            GKQ+ D ++N  GQMLAAL+ WPQATF   + I    A VTREV  G  T+   LPAV+
Sbjct: 121 MGKQSIDGDNNAVGQMLAALLDWPQATFAGKLVIEGGKATVTREVDGGLQTLSADLPAVV 180

Query: 175 TVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYS 234
           TVDL LN PRY SLPNI+KA+KK I  K   D+ +D+  RLKVL+  E      G+++  
Sbjct: 181 TVDLRLNTPRYASLPNIMKAKKKEIAMKAVADYGVDVADRLKVLKVTEPPKRSAGVKVAD 240

Query: 235 TTKLIEILKS 244
             +L+  LKS
Sbjct: 241 AAELVSKLKS 250


>gi|163868914|ref|YP_001610141.1| electron transfer flavoprotein beta-subunit [Bartonella tribocorum
           CIP 105476]
 gi|161018588|emb|CAK02146.1| electron transfer flavoprotein beta-subunit [Bartonella tribocorum
           CIP 105476]
          Length = 248

 Score =  267 bits (683), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 126/246 (51%), Positives = 180/246 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+V +K V++YN K+R+K D +G++  + K+SMNPFDEIA+EE+++ +E G  +EV++
Sbjct: 1   MKIIVAVKRVVDYNIKIRVKPDSTGVDLSHVKMSMNPFDEIAVEEAIRQKESGKISEVVL 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+  LAMGADR +L+ +++TLEPL+IAK+L+ IV +E P +V  GKQ  
Sbjct: 61  VSIGPEAAQETLRTGLAMGADRALLVTTDQTLEPLAIAKVLKAIVDEEKPDMVFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W QATF S+  I + HA VTRE+ +GT T+  PLP V+T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWGQATFASHFNIENRHATVTREIDNGTQTLHLPLPMVMTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK IE+K   D +ID   RL +L  EE +  + G+++ +  +L+ 
Sbjct: 181 NEPRYTSLPNIMKAKKKIIEQKALADLSIDTKARLTILSVEEPKPRQSGVKVANVAELVS 240

Query: 241 ILKSKH 246
            LK K+
Sbjct: 241 ALKQKN 246


>gi|86135749|ref|ZP_01054328.1| electron transfer flavoprotein, beta subunit [Roseobacter sp.
           MED193]
 gi|85826623|gb|EAQ46819.1| electron transfer flavoprotein, beta subunit [Roseobacter sp.
           MED193]
          Length = 252

 Score =  267 bits (683), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 180/247 (72%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A EV+ 
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKADEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + +  +EPL++AKIL+ IV +E P +V+AG
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVVAADDVHSDIEPLAVAKILKGIVDEEQPGLVLAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W Q TF S + I  + A+VTREV  G  T++  +PA++TV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQGTFASELDIDGDKAVVTREVDGGLQTIKVNMPAIVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK + +K A D+ +D+TPRL+V+   E  A   G+ + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPMAEKTAADYGVDVTPRLEVVSTSEPAARAAGIMVGSVD 240

Query: 237 KLIEILK 243
           +L+E LK
Sbjct: 241 ELVEKLK 247


>gi|113866840|ref|YP_725329.1| electron transfer flavoprotein beta-subunit [Ralstonia eutropha
           H16]
 gi|113525616|emb|CAJ91961.1| electron transfer flavoprotein beta-subunit [Ralstonia eutropha
           H16]
          Length = 249

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G+ TEVI 
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAVRLKEAGVVTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+ESNE L+PL++AK+L+ ++ KE P +VI GKQ  
Sbjct: 61  VSCGVTQCQETLRTAMAIGADRGILVESNEDLQPLAVAKLLKALIDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQM+AAL   PQATF S + + D  A VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMVAALAGLPQATFASKVVVADGKASVTREVDGGLETLSLKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+ PRL  L+  E      G+ +     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDIVKPEDLGVDVKPRLSTLKVVEPAKRSAGVMVPDVATLVQ 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|89053037|ref|YP_508488.1| electron transfer flavoprotein beta-subunit [Jannaschia sp. CCS1]
 gi|88862586|gb|ABD53463.1| electron transfer flavoprotein beta-subunit [Jannaschia sp. CCS1]
          Length = 253

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 129/253 (50%), Positives = 184/253 (72%), Gaps = 4/253 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A EVI 
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKAEEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + ++ +EPL++AKIL+ +V +E P +V+AG
Sbjct: 61  VSIGVKQNQETLRTALAMGADRAILVIAAEDVHQDIEPLAVAKILKAVVDEEKPGLVLAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQMLAAL+ W Q TF S + I  + A +TREV  G  T+E  +PA++TV
Sbjct: 121 KQAIDNDMNATGQMLAALLGWSQGTFASEVDIDGDTAKITREVDGGLQTIEVKMPAIVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D+TPRL+++   E  A   G+++ S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVTPRLEIVTTSEPEARAAGVKVASVD 240

Query: 237 KLIEILKSKHDLL 249
           +L+  LK +  +L
Sbjct: 241 ELLTKLKDEAGVL 253


>gi|16124980|ref|NP_419544.1| electron transfer flavoprotein subunit beta [Caulobacter crescentus
           CB15]
 gi|221233701|ref|YP_002516137.1| electron transfer flavoprotein subunit beta [Caulobacter crescentus
           NA1000]
 gi|13421954|gb|AAK22712.1| electron transfer flavoprotein, beta subunit [Caulobacter
           crescentus CB15]
 gi|220962873|gb|ACL94229.1| electron transfer flavoprotein beta-subunit [Caulobacter crescentus
           NA1000]
          Length = 248

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 176/244 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN K R+K D +G++  N K+SMNPF EIA+EE+++L+EKG+ATEV++
Sbjct: 1   MKVLVPVKRVIDYNVKARVKADQTGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEVVI 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E ++ +LAMG DRG+LI ++   EPL++AK+L  +V +ENP +V+ GKQ  
Sbjct: 61  VSIGPAQAQETIRTALAMGGDRGVLITTDADPEPLAVAKLLAAVVAEENPNLVLMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++N  GQML+AL+ WPQAT+ S I++    A VTREV  G  T++  LPAVIT DL L
Sbjct: 121 DGDNNAVGQMLSALLGWPQATYASAIEVSATSAKVTREVDGGLQTVDVDLPAVITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I  K   D+ +D+ PRLKVL+  E      G+++ + + L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKEIVSKTVADYGVDIAPRLKVLKVTEPAKRSAGIKVETASDLVS 240

Query: 241 ILKS 244
            L +
Sbjct: 241 KLNT 244


>gi|326317773|ref|YP_004235445.1| electron transfer flavoprotein alpha/beta-subunit [Acidovorax
           avenae subsp. avenae ATCC 19860]
 gi|323374609|gb|ADX46878.1| Electron transfer flavoprotein alpha/beta-subunit [Acidovorax
           avenae subsp. avenae ATCC 19860]
          Length = 249

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ TEVI 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEKGVVTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR IL+E++E L+PL++AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVTQCQETLRTAMAIGADRAILVETSEELQPLAVAKILKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S +++  +   VTREV  G  T+   LPA++T DL L
Sbjct: 121 DDDSNQTGQMLAALADLPQATFASKVEVSGDKVNVTREVDGGLETLALTLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+ PRLK L+  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTVKPEDLGVDVKPRLKTLKVTEPPKRGAGVKVPDVATLVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|295699693|ref|YP_003607586.1| electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           CCGE1002]
 gi|295438906|gb|ADG18075.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           CCGE1002]
          Length = 249

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 176/249 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K VI+YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKILVPVKRVIDYNVKVRVKSDNTGVDLANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           +S G  + +E L+ +LAMGADR +L+E+   L+PL++AK+L+ IV +E P +VI GKQ  
Sbjct: 61  LSCGPTQCQETLRTALAMGADRAVLVETPGELQPLAVAKLLKAIVDREKPRLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + I D  A V+REV  G  T+   LPAVIT DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVVIADGKATVSREVDGGAETLALQLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY+SLPNI+KA+KK +      +  +D+ PRLK L+  E      G+ +     L+ 
Sbjct: 181 NEPRYVSLPNIMKAKKKPLATLTPAELGVDVAPRLKTLKVSEPPKRSAGITVQDVKTLVG 240

Query: 241 ILKSKHDLL 249
            L+S+  +L
Sbjct: 241 KLRSEAKVL 249


>gi|209883901|ref|YP_002287758.1| electron transfer flavoprotein subunit beta (beta-etf) [Oligotropha
           carboxidovorans OM5]
 gi|209872097|gb|ACI91893.1| electron transfer flavoprotein subunit beta (beta-etf) [Oligotropha
           carboxidovorans OM5]
          Length = 248

 Score =  266 bits (681), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 124/244 (50%), Positives = 177/244 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN K+R+K D SG+E  N K+SMNPFDEIA+EE+L+L+E G A EV+ 
Sbjct: 1   MKVLVPVKRVIDYNVKIRVKADGSGVELNNVKMSMNPFDEIAVEEALRLKEGGKAAEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E ++ +LAMGADRG+ ++++  +EPL++AK+L+ + ++E P +VI GKQ  
Sbjct: 61  VSIGPAQATETIRTALAMGADRGVHVKTDAPVEPLAVAKLLKAVTEREQPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL+ WPQATF S +++      VTREV  G  T++   PA++T DL L
Sbjct: 121 DDDCNQTGQMLAALLGWPQATFASKLEVEGTDFKVTREVDGGLQTVKLQGPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK IE+  A    +DL PRL +L+  E  +   G+++ S T+L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPIEEMTADQLGVDLAPRLDILKTSEPSSRSAGVKVASATELVE 240

Query: 241 ILKS 244
            L +
Sbjct: 241 KLAT 244


>gi|84500156|ref|ZP_00998422.1| electron transfer flavoprotein, beta subunit [Oceanicola batsensis
           HTCC2597]
 gi|84392090|gb|EAQ04358.1| electron transfer flavoprotein, beta subunit [Oceanicola batsensis
           HTCC2597]
          Length = 252

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 181/249 (72%), Gaps = 4/249 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A EV+ 
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKAEEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR ILI    + ++ +EPL++AKIL+ ++ +E P +VIAG
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILIVAADDVHQDIEPLAVAKILKGVIDEEQPGLVIAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQMLAAL+ W QATF + + I  +HAIV REV  G  T++  +PA++T 
Sbjct: 121 KQAIDNDMNATGQMLAALLGWSQATFANELDIDGDHAIVKREVDGGLQTIKVKMPAIVTA 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D++PRL+V++  E  A + G  +    
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTADDYGVDVSPRLEVVKTSEPEARKAGEMVPDVD 240

Query: 237 KLIEILKSK 245
            L+  LK K
Sbjct: 241 TLVAKLKEK 249


>gi|49474521|ref|YP_032563.1| electron transfer flavoprotein subunit beta [Bartonella quintana
           str. Toulouse]
 gi|49240025|emb|CAF26443.1| Electron transfer flavoprotein beta-subunit [Bartonella quintana
           str. Toulouse]
          Length = 248

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 131/243 (53%), Positives = 177/243 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+V +K V++YN K+R+K D +G+   + K+SMNPFDEIA+EE+++ +E G  +EV++
Sbjct: 1   MKIIVAVKHVVDYNIKIRVKPDNTGVNLSHVKMSMNPFDEIAVEEAIRQKESGKISEVVL 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+  LAMGADR +L+ + ETLEPL+IAKIL+ IV +E P +V  GKQT 
Sbjct: 61  VSIGPEAAQETLRTGLAMGADRALLVTTQETLEPLAIAKILKVIVHEEQPDMVFLGKQTI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+ESNQTGQMLAAL+ W QATF S++ I + HAIV REV +GT T+  PLP V+T DL L
Sbjct: 121 DDESNQTGQMLAALLGWGQATFASSLDIENGHAIVIREVDNGTQTLSLPLPIVMTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNIIKA+KK IE++   D  I+   RL VL  EE +  + G+++ +  +LI 
Sbjct: 181 NEPRYTSLPNIIKAKKKPIEQRALADLGIETRARLTVLLVEEPKPRQAGVKVANVAELIS 240

Query: 241 ILK 243
            LK
Sbjct: 241 ALK 243


>gi|296448750|ref|ZP_06890605.1| Electron transfer flavoprotein alpha/beta-subunit [Methylosinus
           trichosporium OB3b]
 gi|296253740|gb|EFH00912.1| Electron transfer flavoprotein alpha/beta-subunit [Methylosinus
           trichosporium OB3b]
          Length = 248

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 181/244 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN K+R+K D SG++T N K SMNPFDEIA+EE+L+L+EKG ATEV++
Sbjct: 1   MKVLVPVKRVVDYNVKIRVKADGSGVDTANVKFSMNPFDEIAVEEALRLKEKGKATEVVL 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K ++ ++  LAMGADR I ++++ET+EPL++AKI+ +I   E P ++I GKQ  
Sbjct: 61  VSIGPAKADDTIRAGLAMGADRAIHVKTDETVEPLAVAKIIAKIAADEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQML+AL+ W Q TF S ++I D    VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLSALLGWGQGTFASKVEIADGSVDVTREVDGGLQTVSLKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNIIKA+KK +  K   D+ +D+ PRL+VL+  E  A + G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIIKAKKKEVAAKTPADYGVDVAPRLEVLKTAEPPARKAGIKVGSVPELLE 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKT 244


>gi|301631731|ref|XP_002944949.1| PREDICTED: electron transfer flavoprotein subunit beta-like
           [Xenopus (Silurana) tropicalis]
          Length = 251

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 120/245 (48%), Positives = 181/245 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+L+ +K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ATEVI 
Sbjct: 3   MKVLISVKRVVDYNVKVRVKSDSTGVDIANVKMSMNPFDEIAVEEAVRLKEKGVATEVIA 62

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR +L+E++  L+PL++AK+L+ ++ KE P ++I GKQ  
Sbjct: 63  VSCGVAQCQETLRTAMAIGADRAVLVETDAELQPLAVAKLLKALMNKEQPDLIILGKQAI 122

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S +++  + A VTREV  G  T++  LPAVIT DL L
Sbjct: 123 DDDANQTGQMLAALADLPQATFASKVELSADAATVTREVDGGLETLQLTLPAVITTDLRL 182

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++  +  D  +D+ PRLK L+  E      G+++     L+E
Sbjct: 183 NEPRYVTLPNIMKAKKKTLDTVRPADLGVDVAPRLKTLKVSEPAKRGAGVKVPDVAALVE 242

Query: 241 ILKSK 245
            LK++
Sbjct: 243 KLKNE 247


>gi|222832476|gb|EEE70953.1| predicted protein [Populus trichocarpa]
          Length = 249

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ TEVI 
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKSDGTGVDLANVKMSMNPFDEIAVEEAVRLKEAGVVTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+ESNE L+PL++AK+L+ ++ KE P +VI GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGILVESNEDLQPLAVAKLLKALIDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQM+AAL   PQATF S + + D  A VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMVAALAGMPQATFASKVVLADGKASVTREVDGGLETVSIKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PRL  ++  E      G+ +     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVKPRLSTVKVVEPAKRSAGVMVPDVATLVQ 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKTEAKVI 249


>gi|89900742|ref|YP_523213.1| electron transfer flavoprotein subunit beta [Rhodoferax
           ferrireducens T118]
 gi|89345479|gb|ABD69682.1| electron transfer flavoprotein beta-subunit [Rhodoferax
           ferrireducens T118]
          Length = 249

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ +EVI 
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKSDNTGVDVANVKMSMNPFDEIAIEEAVRLKEKGVVSEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR IL+E++  L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGVTQCQETLRTAMAIGADRAILVETSVELQPLAVAKLLKALVDKEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL   PQATF S I++++  A VTREV  G+ T+   LPAVIT DL L
Sbjct: 121 DDDCNQTGQMLAALADLPQATFASKIEVLEGKASVTREVDGGSETLSITLPAVITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+TPR+K LR  E      G+++     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDIFKPEDLGVDVTPRIKTLRVSEPPKRSAGIKVPDVATLVA 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|170740250|ref|YP_001768905.1| electron transfer flavoprotein alpha/beta-subunit [Methylobacterium
           sp. 4-46]
 gi|168194524|gb|ACA16471.1| Electron transfer flavoprotein alpha/beta-subunit [Methylobacterium
           sp. 4-46]
          Length = 249

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN K+R+K D SG+E  N K+SMNPFDEIA+EE+++L+EKG  TE++ 
Sbjct: 1   MKVLVPVKRVVDYNVKIRVKPDGSGVELANVKMSMNPFDEIAVEEAIRLKEKGKVTEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E ++ +LAMGADRGIL++++  +EPL +AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSIGPQQAQETIRTALAMGADRGILVKTDAAVEPLGVAKILKALVDKEGPSLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ WPQ TF   I+  +    VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWPQGTFAYRIEAGEGALDVTREIDGGLQTLTLQLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++  +     +D++PRLKVL+  E    + G+++ S  +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPLDTVEPEALGVDVSPRLKVLKTVEPGGRQAGVKVGSPAELVN 240

Query: 241 ILKSKHDLL 249
            LK +  +L
Sbjct: 241 KLKVEAGVL 249


>gi|188580954|ref|YP_001924399.1| electron transfer flavoprotein alpha/beta-subunit [Methylobacterium
           populi BJ001]
 gi|179344452|gb|ACB79864.1| Electron transfer flavoprotein alpha/beta-subunit [Methylobacterium
           populi BJ001]
          Length = 249

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 181/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN K+R+K D SG+E  N K+SMNPFDEIA+EE+++L+EKG  TE++ 
Sbjct: 1   MKVLVPVKRVVDYNVKIRVKADGSGVELANVKMSMNPFDEIAVEEAIRLKEKGKVTEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E L+ +LAMGADR IL++++   EPL++AK+L+ +V+KE+P +VI GKQ  
Sbjct: 61  VSIGPQQAQETLRTALAMGADRAILVKTDVNCEPLAVAKVLKAVVEKESPNLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ WPQ TF   ++  +    VTREV  G  T+   LPA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWPQGTFAFKLEFGEGAIDVTREVDGGLQTVSLKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E+       ID+TP+L VL+  E    + G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLEELSPEGLGIDVTPKLTVLKVAEPPGRQAGVKVGSAAELVQ 240

Query: 241 ILKSKHDLL 249
            LK +  +L
Sbjct: 241 KLKVEAGVL 249


>gi|254292621|ref|YP_003058644.1| electron transfer flavoprotein alpha/beta-subunit [Hirschia baltica
           ATCC 49814]
 gi|254041152|gb|ACT57947.1| Electron transfer flavoprotein alpha/beta-subunit [Hirschia baltica
           ATCC 49814]
          Length = 248

 Score =  266 bits (679), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 173/244 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN K R+K D SG++  N K+SMNPF EIA+EE+++L+EKGI TE++V
Sbjct: 1   MKVLVPVKRVIDYNVKPRVKPDQSGVDLANVKMSMNPFCEIAVEEAVRLKEKGIVTEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E L+ +LAMGADRGIL+ +   +EPL++AKIL+ I  +E P +V+ GKQ  
Sbjct: 61  VSIGVVQAQETLRTALAMGADRGILVTAEGDVEPLAVAKILKAIADEEQPGMVLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           DN++NQTGQMLAAL+ WPQ TF S + + D    VTRE+  G  T+    PAVIT DL L
Sbjct: 121 DNDNNQTGQMLAALLDWPQGTFASEVVVEDGKVNVTREIDGGLQTLALDGPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I+ K+A  F +D+ PRL V++  E      G ++     L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPIDTKEAASFGVDIAPRLTVVKVTEPAGREAGEKVEDVATLVS 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKA 244


>gi|294085437|ref|YP_003552197.1| electron transfer flavoprotein beta-subunit [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292665012|gb|ADE40113.1| Electron transfer flavoprotein beta-subunit [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 249

 Score =  266 bits (679), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 179/245 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K VI+YN KVR+K D SG+E  N K++MNPFDEIA+E++L+LRE G ATEV+ 
Sbjct: 1   MKILVPVKRVIDYNVKVRVKADQSGVELANVKMAMNPFDEIAVEQALRLREAGTATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E ++ +LAMGADRGI IE++  +EPL++AK+L+ IV KE P +V+ GKQ  
Sbjct: 61  VSIGPSQNQETIRTALAMGADRGIHIEASHDVEPLAVAKLLKAIVDKEAPELVLVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL+ W Q TFVS I++  + A + REV  G   +E  +PA++TVDL L
Sbjct: 121 DDDCNQTGQMLAALLGWAQGTFVSGIELGGDKAKIIREVDGGLEHLEIAMPAIVTVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++     +  +D++PRL  ++ EE      G+++    +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDSISVEELGVDVSPRLTTVKVEEPETRSAGIKVSDVGELVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|330824447|ref|YP_004387750.1| electron transfer flavoprotein subunit alpha/beta [Alicycliphilus
           denitrificans K601]
 gi|329309819|gb|AEB84234.1| Electron transfer flavoprotein alpha/beta-subunit [Alicycliphilus
           denitrificans K601]
          Length = 250

 Score =  266 bits (679), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 174/243 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN + R+K+D SG++  N K+SMNPFDEIA EE+++LRE G+A+EVI 
Sbjct: 1   MKVLVAVKRVLDYNVRARVKSDGSGVDLANQKMSMNPFDEIACEEAVRLREAGVASEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G    +E L++++AMGADR +L+E++E LEPL++AK++R + +KE   + I GKQ  
Sbjct: 61  VSCGPAACQETLRSAMAMGADRAVLVETSEALEPLAVAKLMRHVAQKEGVTLAIFGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++ QTGQM AALM WPQATF S ++  D    VTRE+  G  T++  LPAV+T DL L
Sbjct: 121 DGDAGQTGQMFAALMGWPQATFASKVEAADGGLAVTREIDGGLETLQLELPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I+LP+I+KA+KK +E  +A    ID+ PRLK L+  E  A + G+++     L++
Sbjct: 181 NEPRFITLPSIMKAKKKPMEVLEAAALGIDIAPRLKTLKVMEPAARKAGVQVADVNGLVK 240

Query: 241 ILK 243
            LK
Sbjct: 241 KLK 243


>gi|163850969|ref|YP_001639012.1| electron transfer flavoprotein alpha/beta-subunit [Methylobacterium
           extorquens PA1]
 gi|218529797|ref|YP_002420613.1| electron transfer flavoprotein alpha/beta-subunit [Methylobacterium
           chloromethanicum CM4]
 gi|163662574|gb|ABY29941.1| Electron transfer flavoprotein alpha/beta-subunit [Methylobacterium
           extorquens PA1]
 gi|218522100|gb|ACK82685.1| Electron transfer flavoprotein alpha/beta-subunit [Methylobacterium
           chloromethanicum CM4]
          Length = 249

 Score =  266 bits (679), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN K+R+K D SG+E  N K+SMNPFDEIA+EE+++L+EKG  TE++ 
Sbjct: 1   MKVLVPVKRVVDYNVKIRVKADGSGVELANVKMSMNPFDEIAVEEAIRLKEKGKVTEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E L+ +LAMGADR IL++++   EPL++AK+L+ IV+KE+P +VI GKQ  
Sbjct: 61  VSIGPQQAQETLRTALAMGADRAILVKTDVNCEPLAVAKVLKAIVEKESPNLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ WPQ TF   ++  D    VTREV  G  T+   LPA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWPQGTFAFKLEFGDGSIDVTREVDGGLQTVSLKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E+       ID+ P+L VL+  E    + G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLEELTPEGLGIDVAPKLTVLKVVEPSGRQAGVKVGSAAELVQ 240

Query: 241 ILKSKHDLL 249
            LK +  +L
Sbjct: 241 KLKIEAGVL 249


>gi|299132220|ref|ZP_07025415.1| Electron transfer flavoprotein alpha/beta-subunit [Afipia sp.
           1NLS2]
 gi|298592357|gb|EFI52557.1| Electron transfer flavoprotein alpha/beta-subunit [Afipia sp.
           1NLS2]
          Length = 248

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 126/239 (52%), Positives = 173/239 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN K+R+K D SG+E  N K+SMNPFDEIA+EE+L+L+E G ATEV+ 
Sbjct: 1   MKVLVPVKRVIDYNVKIRVKADGSGVELANVKMSMNPFDEIAVEEALRLKEGGKATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E ++ +LAMGADRGI I+S+  +EPL +AK+L+ I ++E P +VI GKQ  
Sbjct: 61  VSIGPAQAAETIRTALAMGADRGIHIKSDAPVEPLGVAKVLKAITEREQPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ WPQATF   ++    +  VTREV  G  T++   PA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWPQATFAFKLEADGANIQVTREVDGGLQTVKLQGPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLI 239
           NEPRY SLPNI+KA+KK IE+  A    +DL PRL++L+  E      G+++ S  +L+
Sbjct: 181 NEPRYASLPNIMKAKKKPIEEMTADQLGVDLAPRLEILKTSEPSGRSAGVKVASVAELV 239


>gi|49475943|ref|YP_033984.1| electron transfer flavoprotein subunit beta [Bartonella henselae
           str. Houston-1]
 gi|49238751|emb|CAF28011.1| Electron transfer flavoprotein beta-subunit [Bartonella henselae
           str. Houston-1]
          Length = 248

 Score =  265 bits (678), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 128/243 (52%), Positives = 178/243 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+V +K V++YN K+R+K D +G++  + K+SMNPFDEIA+EE+++ +E G  +EV++
Sbjct: 1   MKIIVAVKRVVDYNIKIRVKPDSTGVDLSHVKMSMNPFDEIAVEEAVRQKESGKISEVVL 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+  LAMGADR +L+ + ETLEPL+IAKIL+ IV++E P +V  GKQ  
Sbjct: 61  VSIGPEAAQETLRTGLAMGADRALLVTTQETLEPLAIAKILKVIVQEEKPDMVFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+ESNQTGQMLAAL+ W QATF SN+ I + HAIV REV  GT T+  PLP V+T DL L
Sbjct: 121 DDESNQTGQMLAALLGWGQATFASNLDIENGHAIVVREVDDGTQTLSLPLPIVMTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K IE+K  +D  ++   RL VL  EE +  + G+++ +  +L+ 
Sbjct: 181 NEPRYTSLPNIMKAKRKPIEQKALSDLGLETRKRLTVLSVEEPKPRQCGVKVANVAELVS 240

Query: 241 ILK 243
            LK
Sbjct: 241 ALK 243


>gi|73542235|ref|YP_296755.1| electron transfer flavoprotein subunit beta [Ralstonia eutropha
           JMP134]
 gi|72119648|gb|AAZ61911.1| Electron transfer flavoprotein beta-subunit [Ralstonia eutropha
           JMP134]
          Length = 249

 Score =  265 bits (678), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D +G++  N K+SMNPFDEIA+EE+++L+E G+ TEVI 
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADGTGVDLANVKMSMNPFDEIAVEEAVRLKEAGVVTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+ESNE L+PL++AK+L+ ++ KE P +VI GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRGILVESNEDLQPLAVAKLLKALIDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQM+AAL   PQATF S + + D  A VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMVAALAGLPQATFASKVVVADGKASVTREVDGGLETLSLKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+ PRL  ++  E      G+ +     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTVKPEDLGVDVKPRLSTVKVVEPAKRSAGVMVPDVATLVQ 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|145588699|ref|YP_001155296.1| electron transfer flavoprotein beta-subunit [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145047105|gb|ABP33732.1| electron transfer flavoprotein beta-subunit [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 249

 Score =  265 bits (678), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 181/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++YN K+R+K+D SG++  N K+SMNPFDEIA+EE+++L+E GIATEV+V
Sbjct: 1   MKILVAVKRVVDYNVKIRVKSDNSGVDIANVKMSMNPFDEIAVEEAVRLKEAGIATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+ G  + +E L+ +LA+GADRGIL+E++  L+PL++AKIL+ + +KE   I+I GKQ  
Sbjct: 61  VTAGVTQCQETLRTALAIGADRGILVETDLDLQPLAVAKILKALSEKEQAQIIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLA+L+  PQATF S + + D  A VTREV  G  T+   LPAVIT DL L
Sbjct: 121 DDDSNQTGQMLASLLDIPQATFASKVVVADGKATVTREVDGGLETIALTLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK I+  K  +  +D  PRLK L+ EE      G+ +     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKTIDIVKPEELGVDTAPRLKTLKVEEPPKRSAGVMVADVAALVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|326318987|ref|YP_004236659.1| electron transfer flavoprotein alpha/beta-subunit [Acidovorax
           avenae subsp. avenae ATCC 19860]
 gi|323375823|gb|ADX48092.1| Electron transfer flavoprotein alpha/beta-subunit [Acidovorax
           avenae subsp. avenae ATCC 19860]
          Length = 249

 Score =  265 bits (678), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 179/245 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ TEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEKGVVTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR IL+E++E L+PL++AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVTQCQETLRTAMAIGADRAILVETSEELQPLAVAKILKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S +++  +   VTREV  G  T+   LPA++T DL L
Sbjct: 121 DDDSNQTGQMLAALADLPQATFASKVEVSGDKVNVTREVDGGLETLALTLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +   K  D  +D+ PRLK L+  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKPLHTVKPEDLGVDVKPRLKTLKVTEPAKRGAGVKVPDVATLVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|171060268|ref|YP_001792617.1| electron transfer flavoprotein alpha/beta-subunit [Leptothrix
           cholodnii SP-6]
 gi|170777713|gb|ACB35852.1| Electron transfer flavoprotein alpha/beta-subunit [Leptothrix
           cholodnii SP-6]
          Length = 249

 Score =  265 bits (678), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++LREKG+ TEVI 
Sbjct: 1   MKALVSVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAIEEAVRLREKGVLTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR IL+E+++ L+PL++AK+L+ +V +E P ++I GKQ  
Sbjct: 61  VSCGVTQCQETLRTAMAIGADRAILVETSDELQPLAVAKLLKALVDREQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S +++ID  A VTRE+  G  T+   LPAVIT DL L
Sbjct: 121 DDDNNQTGQMLAALADLPQATFASKVEVIDGRANVTREIDGGLETISLSLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D++PRLK L+  E      G+++     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETIKPADLGVDVSPRLKTLKVSEPPKRGAGIKVPDVATLVA 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|84683960|ref|ZP_01011862.1| electron transfer flavoprotein, beta subunit [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667713|gb|EAQ14181.1| electron transfer flavoprotein, beta subunit [Rhodobacterales
           bacterium HTCC2654]
          Length = 252

 Score =  265 bits (678), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 180/249 (72%), Gaps = 4/249 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN K ++K+D SG++  N K+SMNPFDEIA+EE+++L+E G A EV+ 
Sbjct: 1   MKVLVPVKRVIDYNVKAKVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKAEEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + +  +EPL++AKIL+ IV +E P +VIAG
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVVAADDVHTDIEPLAVAKILKAIVDEEQPKLVIAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQMLAAL+ W QATF S + I  + A VTREV  G  T++  LPA++T 
Sbjct: 121 KQAIDNDMNATGQMLAALLGWGQATFASELDIDGDAATVTREVDGGLQTIKVGLPAIVTA 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D+ PRL+V++  E      G+++ S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVAPRLEVVKTAEPPVRSAGIKVESVD 240

Query: 237 KLIEILKSK 245
           +L+  LK K
Sbjct: 241 ELVSKLKEK 249


>gi|194288929|ref|YP_002004836.1| electron transfer flavoprotein beta-subunit [Cupriavidus
           taiwanensis LMG 19424]
 gi|193222764|emb|CAQ68767.1| ELECTRON TRANSFER FLAVOPROTEIN, BETA-SUBUNIT [Cupriavidus
           taiwanensis LMG 19424]
          Length = 249

 Score =  265 bits (678), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 178/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G+ TEV+ 
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAVRLKEAGVVTEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+ESNE L+PL++AK+L+ ++ KE P +VI GKQ  
Sbjct: 61  VSCGVTQCQETLRTAMAIGADRGILVESNEDLQPLAVAKLLKALIDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQM+AAL   PQATF S + + D  A VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMVAALAGLPQATFASKVVVADGKASVTREVDGGLETLSLKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++  K  D  +D+ PRL  L+  E      G+ +     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKPLDTVKPEDLGVDVKPRLSTLKVVEPPKRSAGVMVPDVATLVQ 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|217979878|ref|YP_002364025.1| Electron transfer flavoprotein alpha/beta-subunit [Methylocella
           silvestris BL2]
 gi|217505254|gb|ACK52663.1| Electron transfer flavoprotein alpha/beta-subunit [Methylocella
           silvestris BL2]
          Length = 249

 Score =  265 bits (677), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 178/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K VI+YN K+R+K D SG+ET N K S NPFDEIA+EE+++L+E GI +E++V
Sbjct: 1   MKALVAVKRVIDYNVKIRVKADNSGVETANVKFSANPFDEIAVEEAVRLKEAGIVSEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    ++VL+++LA+GADR ILIE+NE ++PL++AKIL+ + ++E P I I GKQ  
Sbjct: 61  VTIGPAAAQDVLRSALAIGADRAILIETNEEIQPLAVAKILKALCEREAPQIAILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQ LAAL+ WPQ TF S + I +  A VTRE+  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQALAALLGWPQGTFASKLAIANGRAEVTREIDGGLETLSLALPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++   A    +DL PRL  LR E       G+++ +  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDIIAAATLGLDLAPRLATLRVEAPPKRSAGIKVKTVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKTEAKVI 249


>gi|294339991|emb|CAZ88354.1| electron transfer flavoprotein beta-subunit (Beta-ETF) (Electron
           transfer flavoprotein small subunit) (ETFSS) [Thiomonas
           sp. 3As]
          Length = 249

 Score =  265 bits (677), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K+D SGI+T   K+SMNPFDEIA+EE+++L+EKG ATE++ 
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKSDGSGIDTAGVKMSMNPFDEIAVEEAVRLKEKGAATEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G     E L+ ++A+GADRG+L+ES   L+PL++AK+L+ +V+KE   +VI GKQ  
Sbjct: 61  VSCGVAACGETLRTAMAIGADRGVLVESEAELQPLAVAKLLKAVVEKEGAQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W QATF S +++    A VTREV  G  T+   LPAVIT DL L
Sbjct: 121 DDDSNQTGQMLAALLGWSQATFASKVELDGTQAKVTREVDGGLETIAVKLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK I+  K  +  +D++PRLK L+  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKPIDTLKPEELGVDVSPRLKTLKVAEPPKRGAGVKVPDVATLVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 RLKTEAKVI 249


>gi|209967346|ref|YP_002300261.1| electron transfer flavoprotein beta subunit [Rhodospirillum
           centenum SW]
 gi|209960812|gb|ACJ01449.1| electron transfer flavoprotein beta subunit [Rhodospirillum
           centenum SW]
          Length = 249

 Score =  265 bits (677), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 124/245 (50%), Positives = 174/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++YN K+R+K D +G+E  N K+SMNPFDEIA+EE+++L+E G ATE++V
Sbjct: 1   MKILVAVKRVVDYNVKIRVKPDNTGVELANVKMSMNPFDEIAVEEAVRLKEAGKATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+ +LAMGADRG+L++++   EPL++AK L+ I +KE P +VI GKQ  
Sbjct: 61  VSIGPAAAQETLRTALAMGADRGVLVQTDAETEPLAVAKALKAIAEKEQPGLVIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ WPQ TF S +   +    VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDANQTGQMLAALLGWPQGTFASKVVAAEGSVAVTREVDGGLETVELKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK IE        +D +PRLK L+  E    + G+++     L++
Sbjct: 181 NEPRYASLPNIMKAKKKPIETLTPDQVGVDFSPRLKTLKVTEPAKRKGGVKVADVAALVD 240

Query: 241 ILKSK 245
            L+++
Sbjct: 241 KLRNE 245


>gi|162147074|ref|YP_001601535.1| electron transfer flavoprotein subunit beta [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161785651|emb|CAP55222.1| Electron transfer flavoprotein subunit beta [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 249

 Score =  265 bits (677), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 178/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI++N K R+K D +G+ET   K+SMNPFDEIA+EE+++L+EKG+ATE++ 
Sbjct: 1   MKVLVPVKRVIDFNIKPRVKADGTGVETAGVKMSMNPFDEIAVEEAVRLKEKGVATEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + ++ L+ +LAMGADR IL+ ++  +EPL +AK+L+ +V KE+P +VI GKQ  
Sbjct: 61  VSIGVQQSQDTLRTALAMGADRAILVLTDVAVEPLGVAKVLKALVAKESPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ N TGQMLA L+ W Q TF S I+I D  A VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DDDMNATGQMLAGLLGWAQGTFASRIEIADGRAAVTREIDGGLETVSLALPAIVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KARKK +E     D  +D+TPRL ++   E  A + G+++ S   L+ 
Sbjct: 181 NEPRYASLPNIMKARKKPLETLAPADLGVDVTPRLTIVSVAEPPARKAGVKVASAEDLVA 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 RLRNEAKVI 249


>gi|120610842|ref|YP_970520.1| electron transfer flavoprotein subunit beta [Acidovorax citrulli
           AAC00-1]
 gi|120589306|gb|ABM32746.1| electron transfer flavoprotein beta-subunit [Acidovorax citrulli
           AAC00-1]
          Length = 249

 Score =  265 bits (677), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 180/245 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ATEVI 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEKGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR IL+E+ E L+PL++AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVTQCQETLRTAMAIGADRAILVETAEELQPLAVAKILKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S +++  +   VTREV  G  T+   LPA++T DL L
Sbjct: 121 DDDSNQTGQMLAALADLPQATFASKVEVSGDKVNVTREVDGGLETLALALPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+ P LK L+  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTVKPEDLGVDVKPHLKTLKVTEPPKRGAGVKVPDVATLVD 240

Query: 241 ILKSK 245
            L+++
Sbjct: 241 KLRNE 245


>gi|94309682|ref|YP_582892.1| electron transfer flavoprotein beta-subunit [Cupriavidus
           metallidurans CH34]
 gi|93353534|gb|ABF07623.1| Electron transfer flavoprotein subunit beta (Beta-ETF) (Electron
           transfer flavoprotein small subunit) (ETFSS)
           [Cupriavidus metallidurans CH34]
          Length = 267

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ TEVI 
Sbjct: 19  MKVLVAVKRVVDYNVKVRVKSDGTGVDLANVKMSMNPFDEIAVEEAVRLKEAGVVTEVIA 78

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+ESNE L+PL++AK+L+ ++ KE P +VI GKQ  
Sbjct: 79  VSCGVAQCQETLRTAMAIGADRGILVESNEDLQPLAVAKLLKALIDKEQPQLVILGKQAI 138

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQM+AAL   PQATF S + + D  A VTREV  G  T+   LPAV+T DL L
Sbjct: 139 DDDSNQTGQMVAALAGMPQATFASKVVLADGKASVTREVDGGLETVSIKLPAVVTTDLRL 198

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PRL  ++  E      G+ +     L++
Sbjct: 199 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVKPRLSTVKVVEPAKRSAGVMVPDVATLVQ 258

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 259 KLKTEAKVI 267


>gi|241765284|ref|ZP_04763264.1| Electron transfer flavoprotein alpha/beta-subunit [Acidovorax
           delafieldii 2AN]
 gi|241365040|gb|EER59937.1| Electron transfer flavoprotein alpha/beta-subunit [Acidovorax
           delafieldii 2AN]
          Length = 249

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 179/245 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+EKG+ +EVI 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKTDGSGVDIANVKMSMNPFDEIAVEEAVRLKEKGLVSEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR IL+E++  L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRAILVETDAELQPLAVAKLLKALVDKEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S +++  +   VTRE+  G  T+   LPAVIT DL L
Sbjct: 121 DDDANQTGQMLAALADLPQATFASKVELTADKVSVTREIDGGLETLALSLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+ PRLK L+  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDTLKPEDLGVDVAPRLKTLKVSEPPKRGAGVKVADIAALVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|83594407|ref|YP_428159.1| electron transfer flavoprotein subunit beta [Rhodospirillum rubrum
           ATCC 11170]
 gi|83577321|gb|ABC23872.1| Electron transfer flavoprotein beta-subunit [Rhodospirillum rubrum
           ATCC 11170]
          Length = 249

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 122/245 (49%), Positives = 177/245 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN K+R+K D +G+E  N K+SMNPFDEIA+EE+++L+E G  TEV+ 
Sbjct: 1   MKVLVAVKRVVDYNVKIRVKADNTGVELANVKMSMNPFDEIAVEEAIRLKEAGTVTEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LAMGADRGIL++S+  L+PL++AK+L+ +V+KE P +++ GKQ  
Sbjct: 61  VSLGVAQCQETLRTALAMGADRGILVQSDVELQPLAVAKMLKALVEKEAPDLILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ W Q TF+S + + +  A VTREV  G  T+   LP+V+T DL L
Sbjct: 121 DDDANQTGQMLAALLGWSQGTFLSKLTLAEGKATVTREVDGGLETLSLTLPSVLTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PRY SLPNI+KA+KK IE     D  +D  PRL  L+ EE  + + G+R+     L+E
Sbjct: 181 NTPRYASLPNIMKAKKKPIETLSPADLGVDPAPRLTTLKVEEPASRKAGVRVPDVATLVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKTE 245


>gi|260432781|ref|ZP_05786752.1| electron transfer flavoprotein subunit beta [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260416609|gb|EEX09868.1| electron transfer flavoprotein subunit beta [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 252

 Score =  265 bits (676), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 181/247 (73%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A EV+ 
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKADEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + ++ +EPL++AKIL ++V++E P +V+ G
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVVAADDVHQDIEPLAVAKILAKVVEEEQPGLVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQMLAAL+ W Q TF S + I  + A VTREV  G  T+   +PA+ITV
Sbjct: 121 KQAIDNDMNATGQMLAALLGWSQGTFASELDIEGDTAKVTREVDGGLQTISVKMPAIITV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D+TPRL+V++ EE  A   G+ + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVTPRLEVVKTEEPPARAAGIIVGSVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVGKLK 247


>gi|253995520|ref|YP_003047584.1| electron transfer flavoprotein subunits alpha/beta [Methylotenera
           mobilis JLW8]
 gi|253982199|gb|ACT47057.1| Electron transfer flavoprotein alpha/beta-subunit [Methylotenera
           mobilis JLW8]
          Length = 250

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 126/243 (51%), Positives = 180/243 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++YN KV IK D S +E +  K+S+NPFDE A+EE+L+L+EKGIA+EV+V
Sbjct: 1   MKILVAVKRVVDYNIKVHIKPDGSNVEIDGVKMSVNPFDENAIEEALKLKEKGIASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G+   ++VL+  LAMGADR +LIES E L+PL++AK+L+ + ++E P +++ GKQ  
Sbjct: 61  VSLGTAANQDVLRQGLAMGADRAVLIESEEELQPLAVAKLLKALAEREQPGLIMLGKQAV 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++ QTGQMLAAL+ +PQAT+VS I I  N  + TREV  GT T+   LPAVIT DL L
Sbjct: 121 DDDAGQTGQMLAALLNYPQATYVSAITINGNEVVATREVDGGTETISLNLPAVITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N+PR++ LPN++ ARKK IE  KA DF +D  PRL++L+  E  A + G+++ S  +L+ 
Sbjct: 181 NQPRFVKLPNLMMARKKPIEAIKAADFGVDTKPRLQLLKVSEPPARKAGIKVSSVQELLT 240

Query: 241 ILK 243
            L+
Sbjct: 241 KLR 243


>gi|197106611|ref|YP_002131988.1| electron transfer flavoprotein beta-subunit [Phenylobacterium
           zucineum HLK1]
 gi|196480031|gb|ACG79559.1| electron transfer flavoprotein beta-subunit [Phenylobacterium
           zucineum HLK1]
          Length = 249

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN K R+K D +G++  N K+SMNPF EIA+EE+++L+EKG ATEV+ 
Sbjct: 1   MKVLVPVKRVIDYNVKARVKADQTGVDLANVKMSMNPFCEIAVEEAVRLKEKGAATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           +S+G  + +E L+ +LAMGADR IL+++++ LEPL++AK+L+ IV +E+P +V+ GKQ  
Sbjct: 61  ISVGPTQAQETLRTALAMGADRAILVQTDQDLEPLAVAKVLKAIVAEESPELVVMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++N TGQMLAAL+ WPQATF S +++    A VTREV  G  T+E  LPA++T DL L
Sbjct: 121 DGDNNATGQMLAALLDWPQATFASAVEVSGGKAKVTREVDGGLQTIEVDLPAIVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++ K+     +D  P LKV++  E      G+++ +   L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPLDVKELGSLGVDTAPHLKVVKVTEPPKRAGGVKVETAADLVM 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|83949718|ref|ZP_00958451.1| electron transfer flavoprotein, beta subunit [Roseovarius
           nubinhibens ISM]
 gi|83837617|gb|EAP76913.1| electron transfer flavoprotein, beta subunit [Roseovarius
           nubinhibens ISM]
          Length = 252

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 183/247 (74%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A EV+ 
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKADEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + +  +EPL++AKIL ++V++E P +V+AG
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVVAADDVHTDIEPLAVAKILAKVVEEEQPGLVLAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W Q TF S + I  + A+VTREV  G  T++  +PA+ITV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQGTFASGLDIDGDSALVTREVDGGLQTIKVKMPAIITV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D++PRL++++ +E  A + G  + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVSPRLEIVKTDEPEARKAGEIVGSVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVAKLK 247


>gi|295700915|ref|YP_003608808.1| electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           CCGE1002]
 gi|295440128|gb|ADG19297.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           CCGE1002]
          Length = 249

 Score =  264 bits (675), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KV +K D SG++  N K+SMNPFDEIA+EE+++L+EKG+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVSVKADCSGVDIGNVKMSMNPFDEIAVEEAVRLKEKGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADRGI++E++  L+PL++AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSAGVVQCQETLRTALAIGADRGIMVETDAELQPLAVAKILKALVDKEQPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQ LAAL   PQATF S +++  +   VTREV  G  T+   +PAV+T DL L
Sbjct: 121 DDDANQTGQTLAALADLPQATFASKVEVDGDRVNVTREVDGGLETLSLSMPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KARKK +E     +  +D+ PRLK L+  E    + G+++     L++
Sbjct: 181 NEPRYVTLPNIMKARKKPLETVTPAELDVDVAPRLKTLKVTEPAGRKAGVKVADVAALVD 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|254560662|ref|YP_003067757.1| electron transfer flavoprotein subunit beta [Methylobacterium
           extorquens DM4]
 gi|254267940|emb|CAX23808.1| Electron transfer flavoprotein subunit beta (Beta-ETF) (Electron
           transfer flavoprotein small subunit) (ETFSS)
           [Methylobacterium extorquens DM4]
          Length = 249

 Score =  264 bits (675), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVPIK V++YN K+R+K D SG+E  N K+SMNPFDEIA+EE+++L+EKG  TE++ 
Sbjct: 1   MKVLVPIKRVVDYNVKIRVKADGSGVELANVKMSMNPFDEIAVEEAIRLKEKGKVTEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E L+ +LAMGADR IL++++   EPL++AK+L+ IV+KE+P +VI GKQ  
Sbjct: 61  VSIGPQQAQETLRTALAMGADRAILVKTDVNCEPLAVAKVLKAIVEKESPNLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ WPQ TF   ++  +    VTREV  G  T+   LPA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWPQGTFAFKLEFGEGAIDVTREVDGGLQTVSLKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E+       ID+ P+L VL+  E    + G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLEELTPEGLGIDVAPKLTVLKVVEPSGRQAGVKVGSAAELVQ 240

Query: 241 ILKSKHDLL 249
            LK +  +L
Sbjct: 241 KLKIEAGVL 249


>gi|89902919|ref|YP_525390.1| electron transfer flavoprotein subunit beta [Rhodoferax
           ferrireducens T118]
 gi|89347656|gb|ABD71859.1| electron transfer flavoprotein beta-subunit [Rhodoferax
           ferrireducens T118]
          Length = 249

 Score =  264 bits (675), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ +EVI 
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKSDNTGVDVANVKMSMNPFDEIAIEEAVRLKEKGVVSEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR IL+E+   L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGVTQCQETLRTAMAIGADRAILVETTVELQPLAVAKLLKALVDKEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL   PQATF S I++++  A VTREV  G+ T+   LPAVIT DL L
Sbjct: 121 DDDCNQTGQMLAALADLPQATFASKIEVLEGKASVTREVDGGSETLSITLPAVITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+++  K  D  +D+TPR+K L+  E      G+++     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKQLDIFKPEDLGVDVTPRIKTLKVSEPPKRSAGIKVPDVATLVA 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|126739703|ref|ZP_01755395.1| electron transfer flavoprotein, beta subunit [Roseobacter sp.
           SK209-2-6]
 gi|126719349|gb|EBA16059.1| electron transfer flavoprotein, beta subunit [Roseobacter sp.
           SK209-2-6]
          Length = 252

 Score =  264 bits (675), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 128/247 (51%), Positives = 180/247 (72%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A EV+ 
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKADEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + +  +EPL++AKIL ++V++E P +V+ G
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVVAADDVHTDIEPLAVAKILAKVVEEEQPGVVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W Q TF S + I    A VTREV  G  T+   +PA+ITV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQGTFASELDIEGESAKVTREVDGGLQTISVKMPAIITV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D+TPRL++++ EE  A   G+ + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVTPRLEIVKTEEPPARAAGIVVGSVD 240

Query: 237 KLIEILK 243
           +L+E LK
Sbjct: 241 ELVEKLK 247


>gi|304394214|ref|ZP_07376137.1| electron transfer flavoprotein subunit beta [Ahrensia sp. R2A130]
 gi|303293654|gb|EFL88031.1| electron transfer flavoprotein subunit beta [Ahrensia sp. R2A130]
          Length = 267

 Score =  264 bits (675), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 181/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+VP+K V++YN K+R+K D SG++  N K+SMNPFDEIA+EE+L+L+E G A EVIV
Sbjct: 19  MKIIVPVKRVVDYNVKIRVKADGSGVDLANVKMSMNPFDEIAVEEALRLKEAGKAEEVIV 78

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K  E ++  LAMGADRGIL+E ++ +EPL++AKIL+ IV +E P +VI GKQ  
Sbjct: 79  VSIGPAKAAETIRTGLAMGADRGILVEHDDIVEPLAVAKILKGIVDEEQPQLVILGKQAI 138

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQML+AL+ W QATF S ++I  N A VTREV  G  T++  +P ++T DL L
Sbjct: 139 DDDANQTGQMLSALLGWAQATFASKLEIEGNSANVTREVDGGLQTIKVDMPLIMTTDLRL 198

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++ K   D+ +D++PR++V+   E      G+ +    +L+ 
Sbjct: 199 NEPRYASLPNIMKAKKKPMDTKTPADYGVDVSPRIEVVTTVEPPKREAGIIVADVAELVS 258

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 259 KLKNEAGVL 267


>gi|259416812|ref|ZP_05740732.1| electron transfer flavoprotein subunit beta [Silicibacter sp.
           TrichCH4B]
 gi|259348251|gb|EEW60028.1| electron transfer flavoprotein subunit beta [Silicibacter sp.
           TrichCH4B]
          Length = 252

 Score =  264 bits (675), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 127/247 (51%), Positives = 181/247 (73%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A EV+ 
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKADEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + ++ +EPL++AKIL ++V++E P +V+AG
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVVAADDVHQDIEPLAVAKILAKVVEEEQPGLVLAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W QATF S + I  ++A VTREV  G  T+   +P ++TV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQATFASEVDIDGDNAKVTREVDGGLQTISVKMPTIVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D+TPRL V+  +E  A   G+ + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVTPRLTVVETKEPEARSAGIIVGSVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVAKLK 247


>gi|221213059|ref|ZP_03586035.1| electron transfer flavoprotein, beta subunit [Burkholderia
           multivorans CGD1]
 gi|221167272|gb|EED99742.1| electron transfer flavoprotein, beta subunit [Burkholderia
           multivorans CGD1]
          Length = 249

 Score =  264 bits (674), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 178/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV IK  ++ N KV++++D +G++  N K+SMNPFDEIA+EE+++L+E GIATEVI 
Sbjct: 1   MKVLVAIKRAVDANVKVQVRSDGTGVDISNVKMSMNPFDEIAVEEAVRLKEAGIATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR ILIESNE L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSAGVAQAQETLRTALAIGADRAILIESNEDLQPLAVAKLLKALVDKEQPSLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V+REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVVVADGKATVSREVDGGAETLSLKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  +  +D+TP LK L+  E      G+++     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVKPEELGVDVTPHLKTLKVVEPPKRSAGVKVPDVKTLVG 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|240138101|ref|YP_002962573.1| Electron transfer flavoprotein subunit beta (Beta-ETF) (Electron
           transfer flavoprotein small subunit) (ETFSS)
           [Methylobacterium extorquens AM1]
 gi|240008070|gb|ACS39296.1| Electron transfer flavoprotein subunit beta (Beta-ETF) (Electron
           transfer flavoprotein small subunit) (ETFSS)
           [Methylobacterium extorquens AM1]
          Length = 249

 Score =  264 bits (674), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN K+R+K D SG+E  N K+SMNPFDEIA+EE+++L+EKG  TE++ 
Sbjct: 1   MKVLVPVKRVVDYNVKIRVKADGSGVELANVKMSMNPFDEIAVEEAIRLKEKGKVTEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E L+ +LAMGADR IL++++   EPL++AK+L+ IV+KE+P +VI GKQ  
Sbjct: 61  VSIGPQQAQETLRTALAMGADRAILVKTDVNCEPLAVAKVLKAIVEKESPNLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ WPQ TF   ++  +    VTREV  G  T+   LPA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWPQGTFAFKLEFGEGAIDVTREVDGGLQTVSLKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E+       ID+ P+L VL+  E    + G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLEELTPEGLGIDVAPKLTVLKVVEPSGRQAGVKVGSAAELVQ 240

Query: 241 ILKSKHDLL 249
            LK +  +L
Sbjct: 241 KLKIEAGVL 249


>gi|319763607|ref|YP_004127544.1| electron transfer flavoprotein alpha/beta-subunit [Alicycliphilus
           denitrificans BC]
 gi|319764418|ref|YP_004128355.1| electron transfer flavoprotein alpha/beta-subunit [Alicycliphilus
           denitrificans BC]
 gi|330826639|ref|YP_004389942.1| electron transfer flavoprotein subunit alpha/beta [Alicycliphilus
           denitrificans K601]
 gi|317118168|gb|ADV00657.1| Electron transfer flavoprotein alpha/beta-subunit [Alicycliphilus
           denitrificans BC]
 gi|317118979|gb|ADV01468.1| Electron transfer flavoprotein alpha/beta-subunit [Alicycliphilus
           denitrificans BC]
 gi|329312011|gb|AEB86426.1| Electron transfer flavoprotein alpha/beta-subunit [Alicycliphilus
           denitrificans K601]
          Length = 249

 Score =  264 bits (674), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEKGAATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR IL+E++  L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRAILVETDAELQPLAVAKLLKALVDKEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S ++I  + A VTRE+  G  T+   LPAV+T DL L
Sbjct: 121 DDDANQTGQMLAALADLPQATFASKVEIAGDKANVTREIDGGLETLALSLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  + + PRLK L+  E      G+++     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKPLESVKPEDLGVQVAPRLKTLKVAEPPKRGAGIKVPDVATLVA 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|209544135|ref|YP_002276364.1| Sigma 54 interacting domain-containing protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531812|gb|ACI51749.1| Sigma 54 interacting domain protein [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 251

 Score =  264 bits (674), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 177/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI++N K R+K D  G+ET   K+SMNPFDEIA+EE+++L+EKG+ATE++ 
Sbjct: 3   MKVLVPVKRVIDFNIKPRVKADGMGVETAGVKMSMNPFDEIAVEEAVRLKEKGVATEIVA 62

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + ++ L+ +LAMGADR IL+ ++  +EPL +AK+L+ +V KE+P +VI GKQ  
Sbjct: 63  VSIGVQQSQDTLRTALAMGADRAILVLTDVAVEPLGVAKVLKALVAKESPDLVILGKQAI 122

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ N TGQMLA L+ W Q TF S I+I D  A VTRE+  G  T+   LPA++T DL L
Sbjct: 123 DDDMNATGQMLAGLLGWAQGTFASRIEIADGRAAVTREIDGGLETVSLALPAIVTADLRL 182

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KARKK +E     D  +D+TPRL ++   E  A + G+++ S   L+ 
Sbjct: 183 NEPRYASLPNIMKARKKPLETLAPADLGVDVTPRLTIVSVAEPPARKAGVKVASAEDLVA 242

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 243 RLRNEAKVI 251


>gi|220920504|ref|YP_002495805.1| electron transfer flavoprotein subunit alpha/beta [Methylobacterium
           nodulans ORS 2060]
 gi|219945110|gb|ACL55502.1| Electron transfer flavoprotein alpha/beta-subunit [Methylobacterium
           nodulans ORS 2060]
          Length = 249

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN K+R+K D SG++  N K++MNPFDEIA+EE+++L+EK   +E++ 
Sbjct: 1   MKVLVPVKRVVDYNVKIRVKPDGSGVDLANVKMAMNPFDEIAVEEAIRLKEKAKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E L+ +LAMGADRGIL+ ++  +EPL++AK+LR +V KE P +VI GKQ  
Sbjct: 61  VSIGPQQAQETLRTALAMGADRGILVRTDAPVEPLAVAKLLRALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ WPQ TF   I++ +    VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DDDANQTGQMLAALLGWPQGTFAYRIELGEGSLEVTREIDGGLQTLTLALPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++  +     +D+ PRLKVL+  E    + G+++ S  +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPLDTLEPAALGVDVAPRLKVLKTVEPGGRQAGVKVASAAELVS 240

Query: 241 ILKSKHDLL 249
            LK +  +L
Sbjct: 241 KLKGEAGVL 249


>gi|224825619|ref|ZP_03698724.1| Electron transfer flavoprotein alpha/beta-subunit [Lutiella
           nitroferrum 2002]
 gi|224602540|gb|EEG08718.1| Electron transfer flavoprotein alpha/beta-subunit [Lutiella
           nitroferrum 2002]
          Length = 249

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 176/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+VP+K VI+ N KVR+K+D S ++++N K+SMNPFDEIA+EE+++L+E G+A E++ 
Sbjct: 1   MKIVVPVKRVIDANVKVRLKSDGSAVDSDNVKMSMNPFDEIAVEEAIRLKEAGVAGEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIGS   ++VL+++LAMGADR +LI +   LEPL++AK+LRE+V +E P +VI GKQ+T
Sbjct: 61  VSIGSDACQDVLRSALAMGADRALLIRTEAVLEPLAVAKLLREVVAREQPQLVICGKQST 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQ GQMLA L+ WPQATF S + I  + A VTRE+  G   +   LPAV+T DL L
Sbjct: 121 DGDANQAGQMLAGLLGWPQATFASKLDIGADGATVTREIDGGLEIIAVTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PRY +LPNI+KA+KK ++     +F +D  PRL  L   E  A   G+R+    +L+ 
Sbjct: 181 NSPRYTTLPNIMKAKKKPLDVIALDEFGVDTRPRLTTLGLAEPAARSAGVRVADVAELLA 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|114704363|ref|ZP_01437271.1| electron transfer flavoprotein, beta subunit [Fulvimarina pelagi
           HTCC2506]
 gi|114539148|gb|EAU42268.1| electron transfer flavoprotein, beta subunit [Fulvimarina pelagi
           HTCC2506]
          Length = 249

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++YN K+R+K D SG+E  N K+SMNPFDEIA+EE+++L+E G A EV+ 
Sbjct: 1   MKILVAVKRVVDYNVKIRVKPDGSGVELANVKMSMNPFDEIAVEEAVRLKEAGTAEEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  + ++ +LAMGADRGI + ++E +EPL++AKIL+ I   E+P +V  GKQ  
Sbjct: 61  VSIGPKQAADTIRTALAMGADRGIHVATDEIVEPLAVAKILKGICDGESPDLVFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAALM W Q TF   ++  D    VTREV  G  T++  LPAV++VDL L
Sbjct: 121 DDDCNQTGQMLAALMNWGQGTFAYRVEPSDGSVKVTREVDGGLQTVDLKLPAVVSVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK IE K   DF +D+  RL++L+ EE  + + G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPIEAKTPDDFGVDIARRLEILKTEEPESRQAGVKVASVDELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|144900089|emb|CAM76953.1| Electron transfer flavoprotein, beta subunit [Magnetospirillum
           gryphiswaldense MSR-1]
 gi|144900131|emb|CAM76995.1| Electron transfer flavoprotein, beta subunit [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 248

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 178/249 (71%), Gaps = 1/249 (0%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV  K VI+YN K+R+K D SG+ET N K SMNPFDEIA+EE+++L+E G ATE++V
Sbjct: 1   MKVLVAAKRVIDYNVKIRVKADNSGVETANVKFSMNPFDEIAVEEAVRLKEAGKATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+ +LAMGADRGIL+++++ ++PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSIGPATAQETLRTALAMGADRGILVQTDDEIQPLAVAKLLKAVVDKEAPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W Q TF S I+I D    VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWSQGTFASKIEIGDKLT-VTREVDGGLETVSLALPAVVTSDLRL 179

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I+     D  +D+ PRL  L+ EE      G+++     L++
Sbjct: 180 NEPRYASLPNIMKAKKKPIDVTNPGDLGVDVAPRLVTLKVEEPPKRAAGIKVPDVATLVD 239

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 240 KLKNEAKVI 248


>gi|99082267|ref|YP_614421.1| electron transfer flavoprotein beta-subunit [Ruegeria sp. TM1040]
 gi|99038547|gb|ABF65159.1| electron transfer flavoprotein beta-subunit [Ruegeria sp. TM1040]
          Length = 252

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 127/247 (51%), Positives = 180/247 (72%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A EV+ 
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKADEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + ++ +EPL++AKIL ++V++E P +V+AG
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVVAADDVHQDIEPLAVAKILAKVVEEEQPGLVLAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W QATF S + I  + A VTREV  G  T+   +P ++TV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQATFASEVDIDGDSAKVTREVDGGLQTISVKMPTIVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D+TPRL V+  +E  A   G+ + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVTPRLTVVETKEPEARSAGVIVGSVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVAKLK 247


>gi|33599610|ref|NP_887170.1| electron transfer flavoprotein beta-subunit [Bordetella
           bronchiseptica RB50]
 gi|33567206|emb|CAE31120.1| electron transfer flavoprotein beta-subunit [Bordetella
           bronchiseptica RB50]
          Length = 251

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG A+EVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEKGAASEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR IL+E+   L+PL++AK+L+ +V +E P +VI GKQ  
Sbjct: 61  VSCGVAQCQETLRTALAIGADRAILVETAAELQPLAVAKLLKALVDREQPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S +++  +   VTREV  G  T+    PAVIT DL L
Sbjct: 121 DDDANQTGQMLAALADLPQATFASKVELAGDKVSVTREVDGGLETLSLDTPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++  K  D  +D+ PRLK L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLDTIKPEDLGVDVAPRLKTLKVSEPPQRAAGVKVPDVAALVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|154252060|ref|YP_001412884.1| electron transfer flavoprotein alpha/beta-subunit [Parvibaculum
           lavamentivorans DS-1]
 gi|154156010|gb|ABS63227.1| Electron transfer flavoprotein alpha/beta-subunit [Parvibaculum
           lavamentivorans DS-1]
          Length = 249

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 123/243 (50%), Positives = 180/243 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVPIK V++YN KVR+K+D SG++  N K+SMNPFDEIA+EE+++L+E G ATEV+ 
Sbjct: 1   MKVLVPIKRVVDYNVKVRVKSDGSGVDLANVKMSMNPFDEIAVEEAVRLKEAGKATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E ++ +LAMGADRGIL++++ET+EP+++AKIL+ + ++E P ++I GKQ  
Sbjct: 61  VSIGVQQTTETIRTALAMGADRGILVKTDETVEPINVAKILKAVAEQEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL+ W Q TF S ++I      +TRE+  G   ++  +PAVIT DL L
Sbjct: 121 DDDCNQTGQMLAALLGWAQGTFASKVEIDGETLNLTREIDGGLQVLKLKMPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I++K   D+ +D+ PRL+VL+  E      G+++ +  +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPIDEKAPGDYGVDVKPRLEVLKVSEPPQRSAGIKVETIEQLVS 240

Query: 241 ILK 243
            LK
Sbjct: 241 KLK 243


>gi|163739407|ref|ZP_02146817.1| electron transfer flavoprotein, beta subunit [Phaeobacter
           gallaeciensis BS107]
 gi|163740196|ref|ZP_02147590.1| electron transfer flavoprotein, beta subunit [Phaeobacter
           gallaeciensis 2.10]
 gi|161386054|gb|EDQ10429.1| electron transfer flavoprotein, beta subunit [Phaeobacter
           gallaeciensis 2.10]
 gi|161387160|gb|EDQ11519.1| electron transfer flavoprotein subunit beta [Phaeobacter
           gallaeciensis BS107]
          Length = 252

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 124/247 (50%), Positives = 183/247 (74%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A E++V
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKADEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNET----LEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+ + +     +EPL++AKIL ++V++E P +V+AG
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVNAADDVHTDIEPLAVAKILAKVVEEEQPGLVLAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W Q TF S + +  ++A+VTREV  G  T++  +PA++TV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQGTFASELDVDGDNAVVTREVDGGLQTIKVKMPAIVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D++PRL+++   E  A   G+ + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVSPRLEIISTTEPAARAAGIIVGSVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVGKLK 247


>gi|319763046|ref|YP_004126983.1| electron transfer flavoprotein alpha/beta-subunit [Alicycliphilus
           denitrificans BC]
 gi|330825126|ref|YP_004388429.1| electron transfer flavoprotein subunit alpha/beta [Alicycliphilus
           denitrificans K601]
 gi|317117607|gb|ADV00096.1| Electron transfer flavoprotein alpha/beta-subunit [Alicycliphilus
           denitrificans BC]
 gi|329310498|gb|AEB84913.1| Electron transfer flavoprotein alpha/beta-subunit [Alicycliphilus
           denitrificans K601]
          Length = 249

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG ATEVI 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEKGAATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR IL+E++  L+PL++AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRAILVETDAELQPLAVAKLLKALVDKEQPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQATF S ++I  + A VTRE+  G  T+   LPAV+T DL L
Sbjct: 121 DDDANQTGQMLAALADLPQATFASKVEIAGDKANVTREIDGGLETLALSLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  + + PRLK L+  E      G+++     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKPLESVKPEDLGVQVAPRLKTLKVAEPPKRGAGIKVPDVATLVA 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|83313003|ref|YP_423267.1| electron transfer flavoprotein subunit beta [Magnetospirillum
           magneticum AMB-1]
 gi|82947844|dbj|BAE52708.1| Electron transfer flavoprotein, beta subunit [Magnetospirillum
           magneticum AMB-1]
          Length = 249

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 176/249 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV IK VI+YN K+R+K+D SG+ET+N K SMNPFDEIA+EE+++L+E G ATEV+V
Sbjct: 1   MKILVAIKRVIDYNVKIRVKSDGSGVETQNVKFSMNPFDEIAVEEAVRLKEAGKATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG     E L+ +LAMGADRG+L+++++ ++PL +AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSIGPAAASETLRTALAMGADRGVLVQTDDEVQPLGVAKVLKALVAKEAPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+   Q TF S ++I  +   VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALLGCAQGTFASKVEIGADAITVTREVDGGLETVSLKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I+     D  +D+ PRL  L   E      G+++     L++
Sbjct: 181 NEPRYASLPNIMKAKKKPIDTVSPADLGVDVAPRLVTLSVAEPPKRSAGIKVADVAALVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|209519299|ref|ZP_03268099.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           H160]
 gi|209500248|gb|EEA00304.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           H160]
          Length = 249

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 126/245 (51%), Positives = 174/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVPIK V++ N KV +K+D SG++  N K++MNPFDEIA+EE+++LRE G ATEV+V
Sbjct: 1   MKILVPIKRVVDANIKVSVKSDGSGVDLANVKMAMNPFDEIAVEEAVRLREAGTATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR IL+ +NE L+PL++AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSAGVTQAQETLRTALAIGADRAILVNTNEELQPLAVAKILKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+   QAT+ S + + D  A+VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALLGVGQATYASKVVVADGRAVVTREVDGGAETLSLKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++     D  +D  PRLK L+  E      G ++     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKPLDVMSPADLGVDPAPRLKTLKVAEPAKRSAGQKVADVATLVA 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|170749367|ref|YP_001755627.1| electron transfer flavoprotein alpha/beta-subunit [Methylobacterium
           radiotolerans JCM 2831]
 gi|170655889|gb|ACB24944.1| Electron transfer flavoprotein alpha/beta-subunit [Methylobacterium
           radiotolerans JCM 2831]
          Length = 249

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 176/243 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN K+R+K D SG+E  N K+SMNPFDEIA+EE+++L+EKG  TE++ 
Sbjct: 1   MKVLVPVKRVVDYNVKIRVKADGSGVELANVKMSMNPFDEIAVEEAIRLKEKGKVTEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E L+ +LAMGADR IL++++   EPL++AK+L+ +V+KE+P +VI GKQ  
Sbjct: 61  VSIGPQQAQETLRTALAMGADRAILVKTDVNCEPLAVAKLLKAVVEKESPELVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQML AL+ WPQ TF   I+  +    VTREV  G  T+   LPA++T DL L
Sbjct: 121 DDDSNQTGQMLGALLGWPQGTFAYKIEPGEGSLDVTREVDGGLQTVSLRLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E+       +D+TPRL VL+  E      G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLEELAPDALGVDVTPRLTVLKTAEPPGRSAGVKVASAAELVQ 240

Query: 241 ILK 243
            LK
Sbjct: 241 KLK 243


>gi|134093870|ref|YP_001098945.1| electron transfer flavoprotein subunit beta [Herminiimonas
           arsenicoxydans]
 gi|133737773|emb|CAL60818.1| electron transfer flavoprotein beta-subunit (Beta-ETF) (Electron
           transfer flavoprotein small subunit) (ETFSS)
           [Herminiimonas arsenicoxydans]
          Length = 249

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D SG++  N K+SMNPFDEIA+EE+ +L+E G ATE+I 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDQSGVDIANVKMSMNPFDEIAVEEATRLKEAGKATEIIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+E++  L+PL++AK+L+ I  KE P ++I GKQ  
Sbjct: 61  VSCGILQSQETLRTAMAIGADRGILVETDVELQPLAVAKLLKAIADKEQPQLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ WPQAT+ S +++  +   VTREV  G   +   LPA+IT DL L
Sbjct: 121 DDDANQTGQMLAALLDWPQATYASKVEVDGDKVKVTREVDGGLEIVSLTLPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++  K  D  +D+TPRLK L+  E      G+ +     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKTLDNIKPADLGVDVTPRLKTLKVSEPPKRSAGIIVPDVATLVE 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|288960848|ref|YP_003451188.1| electron transfer flavoprotein beta subunit [Azospirillum sp. B510]
 gi|288913156|dbj|BAI74644.1| electron transfer flavoprotein beta subunit [Azospirillum sp. B510]
          Length = 249

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 175/249 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+ V +K V++YN K+R+K D +G+ET N K+SMNPFDEIA+EE+++L+E G ATEVI 
Sbjct: 1   MKVFVSVKRVVDYNVKIRVKADGTGVETANVKMSMNPFDEIAVEEAVRLKESGKATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LAMGADR IL++++   +PL++AKIL+ +V+KE P +VI GKQ  
Sbjct: 61  VSVGPAQAQETLRTALAMGADRAILVQTDAETQPLAVAKILKALVEKEGPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL+ W Q TF S +   D    VTRE+  G  T+E  LPAV+T DL L
Sbjct: 121 DDDCNQTGQMLAALLGWGQGTFASKVAPADGSVTVTREIDGGLETVELKLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++        +D TPRLK L+  E    + G+++     L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLDAVTPDALGVDATPRLKTLKVVEPAKRKAGVKVPDVATLVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKTEAKVI 249


>gi|254511096|ref|ZP_05123163.1| electron transfer flavoprotein, beta subunit [Rhodobacteraceae
           bacterium KLH11]
 gi|221534807|gb|EEE37795.1| electron transfer flavoprotein, beta subunit [Rhodobacteraceae
           bacterium KLH11]
          Length = 252

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 128/247 (51%), Positives = 181/247 (73%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A E++V
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKADEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + +  +EPL++AKIL ++V++E P IV+AG
Sbjct: 61  VSIGVKQSQETLRTALAMGADRAILVVAADDVHTDIEPLAVAKILAKVVEEEQPGIVLAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W Q TF S + I  + A VTREV  G  T+   +P ++TV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQGTFASELDIEGDSAKVTREVDGGLQTISVKMPTIVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D+TPRL+V++ EE  A   G+ + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVTPRLEVVKTEEPPARAAGIIVGSVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVGKLK 247


>gi|254464545|ref|ZP_05077956.1| electron transfer flavoprotein, beta subunit [Rhodobacterales
           bacterium Y4I]
 gi|206685453|gb|EDZ45935.1| electron transfer flavoprotein, beta subunit [Rhodobacterales
           bacterium Y4I]
          Length = 252

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 128/247 (51%), Positives = 180/247 (72%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A E++ 
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKADEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + +  +EPL++AKIL ++V++E P IV+ G
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVVAADDVHTDIEPLAVAKILAKVVEEEQPGIVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W Q TF S + I    A VTREV  G  T+   +PA+ITV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQGTFASELDIEGETAKVTREVDGGLQTISVKMPAIITV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D+TPRL++++ EE  A   G+ + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVTPRLEIVKTEEPPARAAGIIVGSVD 240

Query: 237 KLIEILK 243
           +L+E LK
Sbjct: 241 ELVEKLK 247


>gi|83312329|ref|YP_422593.1| electron transfer flavoprotein [Magnetospirillum magneticum AMB-1]
 gi|82947170|dbj|BAE52034.1| Electron transfer flavoprotein [Magnetospirillum magneticum AMB-1]
          Length = 249

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 176/249 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV IK VI+YN K+R+K+D SG+ET+N K SMNPFDEIA+EE+++L+E G ATEV+V
Sbjct: 1   MKVLVAIKRVIDYNVKIRVKSDGSGVETQNVKFSMNPFDEIAVEEAVRLKEAGKATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG     E L+ +LAMGADRG+L+++++ ++PL +AK+L+ +V KE P ++I GKQ  
Sbjct: 61  VSIGPAAASETLRTALAMGADRGVLVQTDDEVQPLGVAKVLKALVAKEAPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+   Q TF S ++I  +   VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALLGCAQGTFASKVEIGADAITVTREVDGGLETVSLKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I+     D  +D+ PRL  L   E      G+++     L++
Sbjct: 181 NEPRYASLPNIMKAKKKPIDTVSPADLGVDVAPRLVTLSVAEPPKRSAGIKVADVAALVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|296135826|ref|YP_003643068.1| Electron transfer flavoprotein alpha/beta-subunit [Thiomonas
           intermedia K12]
 gi|295795948|gb|ADG30738.1| Electron transfer flavoprotein alpha/beta-subunit [Thiomonas
           intermedia K12]
          Length = 249

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K+D SGI+T   K+SMNPFDEIA+EE+++L+EKG ATE++ 
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKSDGSGIDTAGVKMSMNPFDEIAVEEAVRLKEKGAATEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G     E L+ ++A+GADRG+L+ES   L+PL++AK+L+ +V+KE   +VI GKQ  
Sbjct: 61  VSCGVAACGETLRTAMAIGADRGVLVESEVELQPLAVAKLLKAVVEKEGAQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W QATF S +++    A VTREV  G  T+   LPAVIT DL L
Sbjct: 121 DDDSNQTGQMLAALLGWSQATFASKVELDGTQAKVTREVDGGLETIAVKLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK I+  K  +  +D++PRLK L+  E      G+++     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKPIDTLKPEELGVDVSPRLKTLKVAEPPKRGAGVKVPDVGTLVA 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 RLKTEAKVI 249


>gi|75674949|ref|YP_317370.1| electron transfer flavoprotein beta-subunit [Nitrobacter
           winogradskyi Nb-255]
 gi|74419819|gb|ABA04018.1| electron transfer flavoprotein beta-subunit [Nitrobacter
           winogradskyi Nb-255]
          Length = 251

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 181/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V+++N K+R+K D SG+E  N K+SMNPFDEIA+EE+L+L+E G ATEV++
Sbjct: 3   MKILVPVKRVVDFNVKIRLKGDGSGVELANVKMSMNPFDEIAVEEALRLQEAGKATEVVL 62

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E ++  L+MGADRG+LI+S   +EPL++AK+L+ +V++E P ++I GKQ  
Sbjct: 63  VSIGPAEAAETIRTGLSMGADRGLLIQSEAPVEPLAVAKLLKAVVEEEGPGLIILGKQAI 122

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLA L+ W QATF S I++ + H  VTREV  G  T+    PA++T DL L
Sbjct: 123 DDDSNQTGQMLAGLLGWAQATFASKIEVDEAHFNVTREVDGGLQTIRLKRPAIVTTDLRL 182

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I  + A  + +DL PRL++L+  E    + G+++    +L+ 
Sbjct: 183 NEPRYASLPNIMKAKKKPIVVRAANLYGVDLAPRLEILKTTEPPGRKAGVKVKDVAELVS 242

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 243 RLRNEAGVI 251


>gi|297172768|gb|ADI23733.1| electron transfer flavoprotein, beta subunit [uncultured
           Rhodospirillales bacterium HF4000_38H21]
          Length = 249

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 178/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN K+R+K D SG++  N K+SMNPFDEIA+EE+++L+E G A EV+ 
Sbjct: 1   MKVLVPVKRVVDYNVKIRVKADGSGVDLANVKMSMNPFDEIAVEEAVRLKENGQADEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E L+ +LAMGADR ILI  +  +EPLS+AKIL  +VK E P +VI GKQ  
Sbjct: 61  VSIGPVQAQETLRTALAMGADRAILITVDGPVEPLSVAKILAGVVKDEQPELVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQML+AL+ W QATF S +++    A VTREV  G   +   LPA++T DL L
Sbjct: 121 DDDANQTGQMLSALLGWSQATFASKLELNSGSAKVTREVDGGLQAINISLPAIVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++ K   DF + +  RL+V+R EE    + G+++ +  +L E
Sbjct: 181 NEPRYASLPNIMKAKKKPLDTKTPDDFGVTVASRLRVIRVEEPAVRQAGVKVANVAELTE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAGVI 249


>gi|254477404|ref|ZP_05090790.1| electron transfer flavoprotein, beta subunit [Ruegeria sp. R11]
 gi|214031647|gb|EEB72482.1| electron transfer flavoprotein, beta subunit [Ruegeria sp. R11]
          Length = 252

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/247 (50%), Positives = 183/247 (74%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A E++V
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKADEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + +  +EPL++AKIL ++V++E P +V+AG
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVVAADDVHTDIEPLAVAKILAKVVEEEQPGLVLAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W Q TF S + I  ++A+VTREV  G  T++  +PA++TV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQGTFASELDIDGDNAVVTREVDGGLQTIKVKMPAIVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D++PRL+++   E  A   G+ + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTADDYGVDVSPRLEIISTTEPAARAAGIIVGSVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVGKLK 247


>gi|149201647|ref|ZP_01878621.1| electron transfer flavoprotein beta-subunit [Roseovarius sp.
           TM1035]
 gi|149144695|gb|EDM32724.1| electron transfer flavoprotein beta-subunit [Roseovarius sp.
           TM1035]
          Length = 252

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 127/247 (51%), Positives = 181/247 (73%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A+EVI 
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKASEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + ++ +EPLS+AKIL +IV++E P +V+ G
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVVAADDVHQDIEPLSVAKILAKIVEEEAPGLVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W QATF S++ +  + A+VTREV  G  T++   P ++TV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQATFASSLDVDGDTAVVTREVDGGLQTIKVKTPTIVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D+TPRL++    E  +   G+ L S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVTPRLEITGTSEPASRAAGVILGSVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVAKLK 247


>gi|302381267|ref|YP_003817090.1| electron transfer flavoprotein alpha/beta-subunit [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302191895|gb|ADK99466.1| Electron transfer flavoprotein alpha/beta-subunit [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 254

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 174/250 (69%), Gaps = 6/250 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLRE------KGI 54
           MK+LVP+K VI+YN K R+K D +G++  N K+SMNPFDEIA+EE+++L+E       G 
Sbjct: 1   MKVLVPVKRVIDYNVKARVKADQTGVDLANVKMSMNPFDEIAVEEAVRLKEGKEHHAAGT 60

Query: 55  ATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVI 114
            TE++VVSIG  + +E ++ +LAMGADRGILI+++  LEPL++AK+L+ +V +E P +V+
Sbjct: 61  VTEIVVVSIGVTQAQETIRTALAMGADRGILIQADTDLEPLAVAKLLKAVVDEEKPDLVL 120

Query: 115 AGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVI 174
            GKQ+ D ++N  GQMLAAL+ WPQATF + I+I D  A VTREV  G  T+   LPAVI
Sbjct: 121 MGKQSIDGDNNAVGQMLAALLDWPQATFAAKIEIADGKAKVTREVDGGNQTLSAALPAVI 180

Query: 175 TVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYS 234
           TVDL LN PRY SLPNI+KA+KK I  K   D+ +D   RL VL+         G+++  
Sbjct: 181 TVDLRLNTPRYASLPNIMKAKKKEIAMKAVADYGVDTANRLTVLKVTAPPVRSAGIKVAD 240

Query: 235 TTKLIEILKS 244
             +L+  LK+
Sbjct: 241 AAELVSKLKT 250


>gi|187479735|ref|YP_787760.1| electron transfer flavoprotein subunit beta [Bordetella avium 197N]
 gi|115424322|emb|CAJ50875.1| electron transfer flavoprotein beta-subunit [Bordetella avium 197N]
          Length = 249

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 124/244 (50%), Positives = 177/244 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KV  K+D SG++  N K+S+NPFDEIA+EE+++L+EKG+ +EVI 
Sbjct: 1   MKVLVAVKRVVDYNVKVHTKSDGSGVDIGNVKMSINPFDEIAVEEAVRLKEKGVVSEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           +S G  + +E L+ ++A+GADR IL+E++ETL+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  ISCGVPQSQETLRTAMAIGADRAILVETDETLQPLAVAKLLKALVDKEQPGMVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL   PQATF S +++ +    VTREV  G  T+   LPAVIT DL L
Sbjct: 121 DDDCNQTGQMLAALADLPQATFASKVEVANGRVSVTREVDGGLETLSLSLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++  K  D  +D+TPRLK LR  E      G+++     LI+
Sbjct: 181 NEPRYVTLPNIMKAKKKPLDTVKPEDLGVDVTPRLKTLRVAEPAKRSAGIKVPDVATLID 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKN 244


>gi|288961041|ref|YP_003451380.1| electron transfer flavoprotein beta subunit [Azospirillum sp. B510]
 gi|288913349|dbj|BAI74836.1| electron transfer flavoprotein beta subunit [Azospirillum sp. B510]
          Length = 249

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 123/243 (50%), Positives = 171/243 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN K+R+K D +G+ET N K+SMNPFDEIA+EE+++L+E G ATEVI 
Sbjct: 1   MKLLVPVKRVVDYNVKIRVKADGTGVETANVKMSMNPFDEIAVEEAVRLKEAGKATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LAMGADR IL++++   +PL++AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSVGPAQAQETLRTALAMGADRAILVQTDAETQPLAVAKILKALVDKEGPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL+ W Q TF S +   D    VTRE+  G  T+   LPAV+T DL L
Sbjct: 121 DDDCNQTGQMLAALLGWGQGTFASKVAPSDGGVTVTREIDGGLETVALKLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++        +D+ PRLK L+  E    + G+++     L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLDTVTPDALGVDVMPRLKTLKVAEPARRKAGVKVPDVATLVE 240

Query: 241 ILK 243
            LK
Sbjct: 241 KLK 243


>gi|319408948|emb|CBI82605.1| electron transfer flavoprotein beta-subunit [Bartonella
           schoenbuchensis R1]
          Length = 248

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 177/243 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+V +K V++YN K+R+K D +G++  + K+SMNPFDEIA+EE+++ +E G  +EV++
Sbjct: 1   MKIIVAVKRVVDYNIKIRVKPDGTGVDLSHVKMSMNPFDEIAVEEAIRQKEAGKISEVVL 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+  LAMGADR IL+++ E LEPL+IAK L+ I+ +E P +V  GKQ  
Sbjct: 61  VSIGPEAAQETLRAGLAMGADRAILVKTEEVLEPLAIAKTLKTIILEEKPTMVFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+ESNQTGQMLAAL+ W QATF S++ I ++ AI+TREV  GT T+  PLP V+T DL L
Sbjct: 121 DDESNQTGQMLAALLGWGQATFASHLNIENHQAIITREVDGGTQTICLPLPVVMTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNIIKA+KK IE+K   D  +D   RL VL  EE ++ + G+++ +  +L+ 
Sbjct: 181 NEPRYTSLPNIIKAKKKPIEQKALADLCVDTRARLTVLNIEEPQSRQAGIKVENVAELVS 240

Query: 241 ILK 243
            LK
Sbjct: 241 ALK 243


>gi|148556099|ref|YP_001263681.1| electron transfer flavoprotein, alpha/beta-subunit-like protein
           [Sphingomonas wittichii RW1]
 gi|148501289|gb|ABQ69543.1| Electron transfer flavoprotein, alpha/beta-subunit-like protein
           [Sphingomonas wittichii RW1]
          Length = 249

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 174/244 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN K R+K D SG++  N K+SMNPFDEIA+EE+++L+EKG+ATE+I 
Sbjct: 1   MKVLVPVKRVIDYNVKPRVKMDGSGVDLANVKMSMNPFDEIAVEEAIRLKEKGVATEIIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K +E L+ +LAMGADR ILI S   +EPL +AK+L ++V++E P +VI GKQ  
Sbjct: 61  VSIGEAKAQETLRTALAMGADRAILIVSETEVEPLGVAKLLAKVVEEEAPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQ TF S +++  +   VTREV  G  T+    PA+IT DL L
Sbjct: 121 DDDSNQTGQMLAALTGRPQGTFASKVEVEGDTVKVTREVDGGLETVSLKAPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+ K + +K   D+ +D+TPRLK L+  E    + G+++    +L  
Sbjct: 181 NEPRYASLPNIMKAKSKPLAQKTPADYGVDVTPRLKTLKVSEPPKRQAGIKVADVDELAA 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKA 244


>gi|89070815|ref|ZP_01158063.1| electron transfer flavoprotein, beta subunit [Oceanicola granulosus
           HTCC2516]
 gi|89043602|gb|EAR49810.1| electron transfer flavoprotein, beta subunit [Oceanicola granulosus
           HTCC2516]
          Length = 253

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 125/247 (50%), Positives = 181/247 (73%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A EV+ 
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKADEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + +  +EPL++AKIL+ ++ +E P +V+ G
Sbjct: 61  VSIGVKQSQETLRTALAMGADRAILVVAADDVHTDIEPLAVAKILKGVIDEEQPGLVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQMLAAL+ W QATF S +++  + A VTREV  G  T++  +PA+++V
Sbjct: 121 KQAIDNDMNATGQMLAALLGWSQATFASKLELEGDSATVTREVDGGLQTIKVRMPAIVSV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K   DF +D+ PRL+++  EE  A + G+ + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTPADFGVDVAPRLEIVGTEEPAARQAGIVVGSVD 240

Query: 237 KLIEILK 243
           +L+E LK
Sbjct: 241 ELVEKLK 247


>gi|220914803|ref|YP_002490111.1| Electron transfer flavoprotein alpha/beta-subunit [Methylobacterium
           nodulans ORS 2060]
 gi|219952554|gb|ACL62944.1| Electron transfer flavoprotein alpha/beta-subunit [Methylobacterium
           nodulans ORS 2060]
          Length = 249

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 178/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           M ILVP+K V++YN K+R+K D SG++  N K++MNPFDEIA+EE+++L+EK   +E++ 
Sbjct: 1   MNILVPVKRVVDYNVKIRVKPDGSGVDLANVKMAMNPFDEIAVEEAIRLKEKAKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E L+ +LAMGADRGIL+ ++  +EPL++AK+LR +V KE P +VI GKQ  
Sbjct: 61  VSIGPQQAQETLRTALAMGADRGILVRTDAPVEPLAVAKLLRALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ WPQ TF   I++ +    VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DDDANQTGQMLAALLGWPQGTFAYRIELGEGSLEVTREIDGGLQTLTLALPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++  +     +D+ PRLKVL+  E    + G+++ S  +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPLDTLEPAALGVDVAPRLKVLKTVEPGGRQAGVKVASAAELVS 240

Query: 241 ILKSKHDLL 249
            LK +  +L
Sbjct: 241 KLKGEAGVL 249


>gi|163793826|ref|ZP_02187800.1| electron transfer flavoprotein beta-subunit [alpha proteobacterium
           BAL199]
 gi|159180937|gb|EDP65454.1| electron transfer flavoprotein beta-subunit [alpha proteobacterium
           BAL199]
          Length = 249

 Score =  261 bits (668), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 174/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG+E  N K+SMNPFDEIA+EE++++RE G A EVI 
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADQSGVELANVKMSMNPFDEIAVEEAIRMREAGKAEEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E ++ +LAMGADRGI +  +  LEPL++AK+L+ IV KE P IVI GKQ  
Sbjct: 61  VSIGPQQAQETIRTALAMGADRGIHVVHDGELEPLAVAKMLKAIVDKEQPGIVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQML+AL+ W QATF S I++ D    VTREV  G  T+    PA++T DL L
Sbjct: 121 DDDCNQTGQMLSALLGWSQATFASKIEVGDGALTVTREVDGGLETISVKTPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I+     D  +D TPRL  L+  E    + G+++    +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPIDPTTPADLGVDPTPRLTTLKVVEPPKRQGGVKVADVAELVS 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|91782264|ref|YP_557470.1| putative electron transfer flavoprotein beta- subunit [Burkholderia
           xenovorans LB400]
 gi|91686218|gb|ABE29418.1| Putative electron transfer flavoprotein beta- subunit [Burkholderia
           xenovorans LB400]
          Length = 249

 Score =  261 bits (668), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 176/242 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++ N KV+ ++D +G++T N K+SMNPFDEIA+EE+++L+E GIATEV+ 
Sbjct: 1   MKILVAVKRVVDANVKVQSRSDGTGVDTVNLKMSMNPFDEIAVEEAVRLKESGIATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR ILIESNE LEPL++AK+L+ +V+KE P +VI GKQ  
Sbjct: 61  VSAGVVQAQETLRTALAIGADRAILIESNEVLEPLAVAKLLKALVEKEQPHLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + I    A V REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALANLPQATFASKLVIAGGKATVAREVDGGAETLSLMLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LP+I+KA+KK+++  K  D  +D++PRLK L+        +G+++     L+E
Sbjct: 181 NEPRYVTLPSIMKAKKKQLDTMKPADLGVDVSPRLKTLKVVPPVRRAQGMKVPDVKTLVE 240

Query: 241 IL 242
            L
Sbjct: 241 KL 242


>gi|332185691|ref|ZP_08387438.1| electron transfer flavodomain protein [Sphingomonas sp. S17]
 gi|332014049|gb|EGI56107.1| electron transfer flavodomain protein [Sphingomonas sp. S17]
          Length = 249

 Score =  261 bits (667), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 124/244 (50%), Positives = 174/244 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+VP+K V++YN K R+K D +G++  N K+SMNPFDEIA+EE+++L+EKG A EV+V
Sbjct: 1   MKIVVPVKRVLDYNVKPRVKADGTGVDLANVKMSMNPFDEIAVEEAIRLKEKGAAAEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K  + L+ +LAMGADR ILI S++ +EPL +AK+L ++V++E P +VI GKQ  
Sbjct: 61  VSIGEPKAADTLRTALAMGADRAILITSDQPVEPLGVAKLLAKVVEEEQPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLA L+ W Q TF S ++I    A VTREV  G  T+   LPA++T DL L
Sbjct: 121 DGDNNQTGQMLAGLLGWAQGTFASKVEIDGQTANVTREVDGGLETVALTLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+ K +  K A D+ +D+ PRL +    E    + G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKSKPMATKTAADYGVDIAPRLTITHVAEPGKRQAGVKVGSVDELVE 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKA 244


>gi|259419387|ref|ZP_05743303.1| electron transfer flavoprotein subunit beta [Silicibacter sp.
           TrichCH4B]
 gi|259344628|gb|EEW56515.1| electron transfer flavoprotein subunit beta [Silicibacter sp.
           TrichCH4B]
          Length = 252

 Score =  261 bits (666), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 123/247 (49%), Positives = 182/247 (73%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+YN KVR+K+D SG++  N K+SMNPFDEIA+EE+++L+E G A E++ 
Sbjct: 1   MKVLVSVKRVIDYNVKVRVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKADEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + +  +EPL++AKIL ++V++E P +V+AG
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVVAADDVHTDIEPLAVAKILAKVVEEEQPGLVLAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W Q TF S + I  + A+VTREV  G  T++  +PA++TV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQGTFASELDIDGDSAVVTREVDGGLQTIKVRMPAIVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D+TPRL++++  E      G+++ S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVTPRLEIVKTAEPAERAAGIKVGSVG 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVAKLK 247


>gi|319763951|ref|YP_004127888.1| electron transfer flavoprotein alpha/beta-subunit [Alicycliphilus
           denitrificans BC]
 gi|317118512|gb|ADV01001.1| Electron transfer flavoprotein alpha/beta-subunit [Alicycliphilus
           denitrificans BC]
          Length = 249

 Score =  261 bits (666), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 177/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG  +EVI 
Sbjct: 1   MKALVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEKGAVSEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G    +E L+ ++A+GADR IL+E++  L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVAACQETLRTAMAIGADRAILVETDAELQPLAVAKLLKALVDKEQPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ +QTGQMLAAL   PQATF S +++  + A VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDCSQTGQMLAALADLPQATFASKVEVAGDKATVTREVDGGLETLSLGLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D  PR+K L+  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETLKPEDLGVDAAPRIKTLKVSEPSKRGAGIKVPDVATLVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|298293408|ref|YP_003695347.1| electron transfer flavoprotein alpha/beta-subunit [Starkeya novella
           DSM 506]
 gi|296929919|gb|ADH90728.1| Electron transfer flavoprotein alpha/beta-subunit [Starkeya novella
           DSM 506]
          Length = 256

 Score =  260 bits (665), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 127/251 (50%), Positives = 179/251 (71%), Gaps = 8/251 (3%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R++ D SG+E  N K+SMNPFDEIA+EE+L+L+E G A+EV+ 
Sbjct: 1   MKILVPVKRVVDYNVKIRVRPDGSGVELANIKMSMNPFDEIAVEEALRLKEAGKASEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNET-LEPLSIAKILREIVKKENPIIVIAGKQT 119
           VSIG  K +E ++ +LAMGADRGI +++ E  +EPL++AK+L+++V++E P +VI GKQ 
Sbjct: 61  VSIGPAKTDETIRTALAMGADRGIWVKTEEAGIEPLTVAKLLKKVVEEEAPGLVILGKQA 120

Query: 120 TDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAI-------VTREVGHGTMTMETPLPA 172
            D++ NQTGQMLAAL+ WPQATF S + + D           VTRE+  G  T+   LPA
Sbjct: 121 IDDDCNQTGQMLAALLGWPQATFASKVVLGDATGGDGNVTVKVTREIDGGLQTVSLDLPA 180

Query: 173 VITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRL 232
           V+T DL LNEPRY SLPNI+KA+KK I++K    + +D+ PRL+V+   E      G++L
Sbjct: 181 VLTTDLRLNEPRYASLPNIMKAKKKPIDEKSPAAYGVDVAPRLQVISTTEPAGRSAGIKL 240

Query: 233 YSTTKLIEILK 243
            S  +L+  LK
Sbjct: 241 GSPAELVAHLK 251


>gi|288960819|ref|YP_003451159.1| electron transfer flavoprotein beta subunit [Azospirillum sp. B510]
 gi|288913127|dbj|BAI74615.1| electron transfer flavoprotein beta subunit [Azospirillum sp. B510]
          Length = 249

 Score =  260 bits (665), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 122/245 (49%), Positives = 175/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK +V +K V++YN KVR+K D SG++    K+SMNPFDEIA+EE ++L+EKG+ +E++ 
Sbjct: 1   MKAMVTVKRVVDYNVKVRVKADGSGVDLGAVKMSMNPFDEIAVEEVVRLKEKGVVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR ILIE++  L+PL++AK+L+ +  +E P +++ GKQ  
Sbjct: 61  VSCGVAQCQETLRTALAIGADRAILIETDAELQPLAVAKLLKALTDRERPQLIVLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLA+L   PQATF S I+I D+ A VTRE+  G   +   LPAVIT DL L
Sbjct: 121 DDDCNQTGQMLASLADLPQATFASKIEIADDLATVTREIDGGLEVVGLTLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY+ LPNI+KA+KK +E  K TD  ID+TPRL+ LR  E    + G+R+     L++
Sbjct: 181 NEPRYVGLPNIMKAKKKPLETLKPTDLGIDVTPRLRTLRVTEPETRKAGVRVPDVATLVQ 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKTE 245


>gi|254462598|ref|ZP_05076014.1| electron transfer flavoprotein, beta subunit [Rhodobacterales
           bacterium HTCC2083]
 gi|206679187|gb|EDZ43674.1| electron transfer flavoprotein, beta subunit [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 252

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 125/247 (50%), Positives = 179/247 (72%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK++VP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+E++++L+E G A EVI 
Sbjct: 1   MKVIVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEQAIRLKEAGKADEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNET----LEPLSIAKILREIVKKENPIIVIAG 116
           VS+G  + +E L+ +LAMGADR IL+ + E     +EPL++AKIL+ +V +E P +V+ G
Sbjct: 61  VSVGVKQAQETLRTALAMGADRAILVVAAEDVHNDIEPLTVAKILKGVVDEEQPGLVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+ALM W QATF S++ I  + A VTREV  G  T++  +P V+TV
Sbjct: 121 KQAIDNDMNATGQMLSALMGWSQATFASDLDIDGDSATVTREVDGGLQTIKVNMPTVVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K   D+ +D +PRL+++   E  A   G+++ S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPMDEKTPADYGVDASPRLEIVNTVEPAARAAGIKVGSVD 240

Query: 237 KLIEILK 243
           +L+E LK
Sbjct: 241 ELVEKLK 247


>gi|149913511|ref|ZP_01902044.1| electron transfer flavoprotein, beta subunit [Roseobacter sp.
           AzwK-3b]
 gi|149812631|gb|EDM72460.1| electron transfer flavoprotein, beta subunit [Roseobacter sp.
           AzwK-3b]
          Length = 252

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 179/247 (72%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A EVI 
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKADEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + +  +EPL++AKIL ++V +E P +V+ G
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVVAADDVHTDIEPLAVAKILAKVVAEEQPGMVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W QAT+ + I +  +HA+VTREV  G  T++  +P +IT 
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQATYANQIDVEGDHAVVTREVDGGLQTVKVKMPTIITT 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D+TPRL++L   E  A + G  + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVTPRLEILETIEPPARKAGELVGSVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVSKLK 247


>gi|330823785|ref|YP_004387088.1| electron transfer flavoprotein subunit alpha/beta [Alicycliphilus
           denitrificans K601]
 gi|329309157|gb|AEB83572.1| Electron transfer flavoprotein alpha/beta-subunit [Alicycliphilus
           denitrificans K601]
          Length = 249

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 177/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG  +EVI 
Sbjct: 1   MKALVPVKRVVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEKGAVSEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G    +E L+ ++A+GADR IL+E++  L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGVAACQETLRTAMAIGADRAILVETDAELQPLAVAKLLKALVDKEQPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ +QTGQMLAAL   PQATF S +++  + A VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDCSQTGQMLAALADLPQATFASKMEVAGDKATVTREVDGGLETLSLGLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D  PR+K L+  E      G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETLKPEDLGVDAAPRIKTLKVSEPSKRGAGIKVPDVATLVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|83311731|ref|YP_421995.1| electron transfer flavoprotein [Magnetospirillum magneticum AMB-1]
 gi|82946572|dbj|BAE51436.1| Electron transfer flavoprotein [Magnetospirillum magneticum AMB-1]
          Length = 250

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 175/248 (70%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           K+LV IK VI+YN K+R+K+D SG+ET+N K SMNPFDEIA+EE+++L+E G ATEV+VV
Sbjct: 3   KVLVAIKRVIDYNVKIRVKSDGSGVETQNVKFSMNPFDEIAVEEAVRLKEAGKATEVVVV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTD 121
           SIG     E L+ +LAMGADRG+L+++++ ++PL +AK+L+ +V KE P ++I GKQ  D
Sbjct: 63  SIGPAAASETLRTALAMGADRGVLVQTDDEVQPLGVAKVLKALVAKEAPGLIILGKQAID 122

Query: 122 NESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLN 181
           ++SNQTGQMLAAL+   Q TF S ++I  +   VTREV  G  T+   LPAV+T DL LN
Sbjct: 123 DDSNQTGQMLAALLGCAQGTFASKVEIGADAITVTREVDGGLETVSLKLPAVVTTDLRLN 182

Query: 182 EPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIEI 241
           EPRY SLPNI+KA+KK I+     D  +D+ PRL  L   E      G+++     L++ 
Sbjct: 183 EPRYASLPNIMKAKKKLIDTVSPADLGVDVAPRLVTLSVAEPPKRSAGIKVADVAALVDK 242

Query: 242 LKSKHDLL 249
           LK++  ++
Sbjct: 243 LKNEAKVI 250


>gi|119385277|ref|YP_916333.1| electron transfer flavoprotein beta-subunit [Paracoccus
           denitrificans PD1222]
 gi|119375044|gb|ABL70637.1| electron transfer flavoprotein beta-subunit [Paracoccus
           denitrificans PD1222]
          Length = 252

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 125/247 (50%), Positives = 175/247 (70%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN K R+K+D SG++  N K+SMNPFDEIA+EE+++L+EKG A E+I 
Sbjct: 1   MKVLVPVKRVIDYNVKARVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEKGQAEEIIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  +  E L+ +LAMGADR IL+    +  + +EPL++AKIL  + + E   ++IAG
Sbjct: 61  VSIGVKQAAETLRTALAMGADRAILVVAADDVQQDIEPLAVAKILAAVARAEGTELIIAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQMLAA++ W QATF S ++I    A VTREV  G  T+   LPAV+T 
Sbjct: 121 KQAIDNDMNATGQMLAAILGWAQATFASKVEIEGAKAKVTREVDGGLQTIAVSLPAVVTA 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D+ PRL+V+   E    + G+++ S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVAPRLEVVSVREPEGRKAGIKVGSVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVGKLK 247


>gi|110833962|ref|YP_692821.1| electron transfer flavoprotein subunit beta [Alcanivorax
           borkumensis SK2]
 gi|110647073|emb|CAL16549.1| electron transfer flavoprotein, beta subunit [Alcanivorax
           borkumensis SK2]
          Length = 249

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 177/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVPIK V++YN KVR+K D SG++  N K++MNPF EIA+EE+++L+EKG+ TE++ 
Sbjct: 1   MKVLVPIKRVVDYNVKVRVKADNSGVDLANVKMAMNPFCEIAVEEAVRLKEKGVVTEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V++G    +E L+ ++A+GADR IL+E++E ++PL IAK L+ IV +E P +VI GKQ  
Sbjct: 61  VTVGPKAAQEQLRTAMALGADRSILVETDEEVQPLGIAKALKAIVDEEKPELVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAAL   PQ TF S + + D    VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DGDNNQTGQMLAALAGMPQGTFASEVDVADGKVKVTREVDGGLQTVELSLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++ K A D  +DLTPR+   + E     + G+ + S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLDTKTAADLGVDLTPRVTTEKVEAPAERQAGIIVGSVDELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|85706571|ref|ZP_01037664.1| electron transfer flavoprotein, beta subunit [Roseovarius sp. 217]
 gi|85668983|gb|EAQ23851.1| electron transfer flavoprotein, beta subunit [Roseovarius sp. 217]
          Length = 252

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 179/247 (72%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A E+I 
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKADEIIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + ++ +EPLS+AKIL +IV++E P +V+ G
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVIAADDVHQDIEPLSVAKILAKIVEEEQPGLVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W QATF S + +  + A+VTREV  G  T++   P ++TV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQATFASKLDLDGDTALVTREVDGGLQTIKVKTPTIVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D+TPRL++    E  +   G+ L S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVTPRLEITSTSEPASRAAGVILGSVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVAKLK 247


>gi|94314438|ref|YP_587647.1| electron transfer flavoprotein subunit beta [Cupriavidus
           metallidurans CH34]
 gi|93358290|gb|ABF12378.1| electron transfer flavoprotein beta-subunit [Cupriavidus
           metallidurans CH34]
          Length = 249

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 178/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++ N KVR+K+D +G++  N K+S+NPFDEIA+EE+++L+E G+ TEV+ 
Sbjct: 1   MKILVAVKRVVDSNVKVRVKSDGTGVDLANVKMSVNPFDEIAVEEAVRLKEAGVVTEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADRGIL+ESNE L+PL++AK+L+ ++ KE P +VI GKQ  
Sbjct: 61  VSCGGAQCQETLRTAMAIGADRGILVESNEDLQPLAVAKLLKALIDKEQPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQM+AAL   PQATF S + + D  A VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMVAALAGLPQATFASKVVLADGKASVTREVDGGLETVSVKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++  K  D  +D+ PRL  ++  E      G+ +     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKPLDTVKPEDLGVDVKPRLSTVKVIEPAKRSAGVMVPDVATLVQ 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKTEAKVI 249


>gi|91780317|ref|YP_555524.1| electron transfer flavoprotein subunit beta EtfB [Burkholderia
           xenovorans LB400]
 gi|91692977|gb|ABE36174.1| Electron transfer flavoprotein beta-subunit, EtfB [Burkholderia
           xenovorans LB400]
          Length = 249

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 171/238 (71%)

Query: 12  NYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEV 71
           +YN KVR+K D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI VS G  + +E 
Sbjct: 12  DYNVKVRVKADGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIAVSAGVTQAQET 71

Query: 72  LKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQML 131
           L+ +LA+GADR ILIESNE L+PL++AK+L+ +V +E P +VI GKQ  D++SNQTGQML
Sbjct: 72  LRTALAIGADRAILIESNEELQPLAVAKLLKALVDREQPSLVILGKQAIDDDSNQTGQML 131

Query: 132 AALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNI 191
           AAL   PQATF S + + D  A V+REV  G  T+   LPAV+T DL LNEPRY++LPNI
Sbjct: 132 AALANLPQATFASKVVVADGKATVSREVDGGAETLSLTLPAVVTTDLRLNEPRYVTLPNI 191

Query: 192 IKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIEILKSKHDLL 249
           +KA+KK +E  K  D  +D+TPRLK L+  E      G+++     L+  LK++  +L
Sbjct: 192 MKAKKKPLEVVKPEDLGVDVTPRLKTLKVVEPPKRPAGVKVPDVQTLVGKLKTEARVL 249


>gi|309783445|ref|ZP_07678150.1| electron transfer flavoprotein, beta subunit [Ralstonia sp.
           5_7_47FAA]
 gi|308917776|gb|EFP63468.1| electron transfer flavoprotein, beta subunit [Ralstonia sp.
           5_7_47FAA]
          Length = 249

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 178/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K D +G++T + K+SMNPFDEIA+EE+++L+EKG+ATEV+ 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKPDSTGVDTADVKMSMNPFDEIAVEEAVRLKEKGVATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           +S G  + +E L+ ++A+GADRGIL+E++  L+PL++AK+L+ +  +E P +++ GKQ  
Sbjct: 61  ISCGVAQCQETLRTAMAIGADRGILVETDAELQPLAVAKLLKVLASREQPTLILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQAT  S I +I     VTREV  G  T+   LPAVIT DL L
Sbjct: 121 DDDANQTGQMLAALAGLPQATCASKIDVIGGKVTVTREVDGGLETVSLTLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++  +  D  +D+  RLK L+  E      G+ +     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLDIVRPEDLGVDVASRLKTLKVSEPPKRSAGVMVADVATLVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|254427818|ref|ZP_05041525.1| electron transfer flavoprotein domain [Alcanivorax sp. DG881]
 gi|196193987|gb|EDX88946.1| electron transfer flavoprotein domain [Alcanivorax sp. DG881]
          Length = 249

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 177/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVPIK V++YN KVR+K D +G++  N K++MNPF EIA+EE+++L+EKG+ TE++ 
Sbjct: 1   MKVLVPIKRVVDYNVKVRVKADNTGVDLANVKMAMNPFCEIAVEEAVRLKEKGVVTEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+ ++A+GADR IL+E++E ++PL IAK L+ IV +E P +VI GKQ  
Sbjct: 61  VSIGPKTAQEQLRTAMALGADRSILVETDEDVQPLGIAKALKAIVDEEKPELVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAAL   PQ TF S + + D    VTRE+  G  T+E  LPAV+T DL L
Sbjct: 121 DGDNNQTGQMLAALAGMPQGTFASEVNVADGKVKVTREIDGGLQTVELSLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++ K A D  +DLTPR+   + E     + G+ + S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLDTKTAADLGVDLTPRVTTEKVEAPAERQAGIIVGSVDELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|85705049|ref|ZP_01036149.1| electron transfer flavoprotein, beta subunit [Roseovarius sp. 217]
 gi|85670371|gb|EAQ25232.1| electron transfer flavoprotein, beta subunit [Roseovarius sp. 217]
          Length = 252

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 179/247 (72%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK++VP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A EVI 
Sbjct: 1   MKVIVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKADEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + ++ +EPLS+AKIL +IV++E P +V+ G
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVIAADDVHQDIEPLSVAKILAKIVEEEQPGLVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W QATF S + +  + A+VTREV  G  T++   P ++TV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQATFASKLDLDGDTALVTREVDGGLQTIKVKTPTIVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D+TPRL++    E  +   G+ L S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVTPRLEITSTSEPASRAAGVILGSVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVAKLK 247


>gi|319779637|ref|YP_004130550.1| Electron transfer flavoprotein, beta subunit [Taylorella
           equigenitalis MCE9]
 gi|317109661|gb|ADU92407.1| Electron transfer flavoprotein, beta subunit [Taylorella
           equigenitalis MCE9]
          Length = 249

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 188/249 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V+++N KVR+K+D S ++T+N K+SMNPFDEIA+EE+ +++E G  +EV+ 
Sbjct: 1   MKVLVPVKRVVDFNIKVRVKSDNSSVDTDNLKMSMNPFDEIAVEEASRMKEAGKVSEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V++G  + ++ L++++AMGADRG+L+E+ E+++PL IAK+L+E+  KE+  +++ GKQ  
Sbjct: 61  VTVGVSQAQDQLRSAMAMGADRGVLVETTESVQPLGIAKLLKEVAIKEDAKLILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ WPQATF S I+++++ A+VTRE+  G  T+E  LPAVITVDL L
Sbjct: 121 DDDSNQTGQMLAALLDWPQATFASKIELLEDKAVVTREIDGGLETIEVSLPAVITVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+ +LP I++A+KK I+K    + ++D+TP++K ++  E      G  L     L++
Sbjct: 181 NEPRFATLPKIMQAKKKPIDKFTPEELSVDVTPKIKTIKVTEPVNRSGGEILPDVATLVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEKKVI 249


>gi|288959449|ref|YP_003449790.1| electron transfer flavoprotein beta subunit [Azospirillum sp. B510]
 gi|288911757|dbj|BAI73246.1| electron transfer flavoprotein beta subunit [Azospirillum sp. B510]
          Length = 249

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 120/245 (48%), Positives = 171/245 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKIL  +K V++YN K+R+K D SG+ET N K SMNPFDEIA+EE+++ +E G A+E++V
Sbjct: 1   MKILCAVKRVVDYNVKIRVKTDQSGVETSNVKFSMNPFDEIAVEEAVRCKEAGAASEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LAMGADR IL++++   +PL +AK+L+ +V++E P +VI GKQ  
Sbjct: 61  VSVGPAQAQETLRTALAMGADRAILVQTDAETQPLVVAKVLKALVEREAPGMVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL+ W Q TF S +   D    VTRE+  G  T+E  LPAV+T DL L
Sbjct: 121 DDDCNQTGQMLAALLGWGQGTFASKVAAGDGTVAVTREIDGGLETVELKLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +D+TPRLK L+  E    + G+++     L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPLETVTPDALGVDVTPRLKTLKVAEPAKRQAGIKVPDVATLVT 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKTE 245


>gi|297538216|ref|YP_003673985.1| electron transfer flavoprotein subunits alpha/beta [Methylotenera
           sp. 301]
 gi|297257563|gb|ADI29408.1| Electron transfer flavoprotein alpha/beta-subunit [Methylotenera
           sp. 301]
          Length = 250

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++YN KVRIK D S ++ E  K+ +NPFDE ALEE+L+L+EKGIATEV+ 
Sbjct: 1   MKILVAVKRVVDYNIKVRIKADGSDVDIEGVKMGINPFDENALEEALRLKEKGIATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G+   ++VL++SLAMGADR ILIE++  L+PL++AK+L+ IV +E P ++I GKQ  
Sbjct: 61  VSLGTSANQDVLRHSLAMGADRAILIEASADLQPLAVAKLLKSIVAREEPNLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++ QTGQMLAAL+ +PQ TF S ++I  +   VTREV  GT T+   LPAVIT DL L
Sbjct: 121 DDDAGQTGQMLAALLDYPQGTFASTLQIEGDEVTVTREVDGGTETLALALPAVITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPN++ ARKK IE   A +  ++L  RLK+++  E    + G+++ S  +L+ 
Sbjct: 181 NEPRFVKLPNLMMARKKPIETINAAELGVNLDARLKLIQVSEPAVRKAGIKVDSVEELLS 240

Query: 241 ILKSKHDLL 249
            L+S   +L
Sbjct: 241 KLRSHEGIL 249


>gi|114770115|ref|ZP_01447653.1| Electron transfer flavoprotein beta-subunit [alpha proteobacterium
           HTCC2255]
 gi|114548952|gb|EAU51835.1| Electron transfer flavoprotein beta-subunit [alpha proteobacterium
           HTCC2255]
          Length = 253

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 126/253 (49%), Positives = 181/253 (71%), Gaps = 4/253 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+E++++L+E G   E+I 
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEQAIRLKEAGKVDEIIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIES----NETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR ILIE+    +  +EPLS+AK+L+ +V +E P +V+ G
Sbjct: 61  VSIGVKQSQETLRTALAMGADRAILIEATSDVHNDIEPLSVAKLLKAVVDEEQPQLVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W QAT+ S + +  + A+VTREV  G  T++  +PAVITV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQATYASELDVDGDAAVVTREVDGGLQTIKIKMPAVITV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K  +D  +D+TPRL V+   E      G+++ S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPMDEKIPSDLGVDITPRLTVVSTSEPAERAAGVKVSSVA 240

Query: 237 KLIEILKSKHDLL 249
           +LI  LK +  ++
Sbjct: 241 ELITKLKDEAGVI 253


>gi|329113782|ref|ZP_08242553.1| Electron transfer flavoprotein subunit beta [Acetobacter pomorum
           DM001]
 gi|326696792|gb|EGE48462.1| Electron transfer flavoprotein subunit beta [Acetobacter pomorum
           DM001]
          Length = 249

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 184/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K R+K D SG++T   K+SMNPFDEIA+EE+++LREKG A+EV+V
Sbjct: 1   MKILVPVKRVVDYNIKPRVKADGSGVDTTGVKMSMNPFDEIAVEEAVRLREKGAASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K ++ L+ ++AMGADR IL+ S E+ EPL++AK+LR++V+KE P +VI GKQ  
Sbjct: 61  VSVGVQKAQDTLRTAMAMGADRAILVLSEESPEPLAVAKVLRKLVEKEEPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ N TGQMLA L+ W Q TF S ++I D HA V+RE+  GT  +   LPA+IT DL L
Sbjct: 121 DDDMNATGQMLAGLLGWGQGTFASKVEIADGHARVSREIDGGTEEVSLTLPAIITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E  +A +  +D+TPRL V+   E    + G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLETIEAAELGVDMTPRLSVVSVAEPPERKAGIKVGSVAELVE 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|90426351|ref|YP_534721.1| electron transfer flavoprotein beta-subunit [Rhodopseudomonas
           palustris BisB18]
 gi|90108365|gb|ABD90402.1| electron transfer flavoprotein beta-subunit [Rhodopseudomonas
           palustris BisB18]
          Length = 249

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 177/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN K+R+K+D SG+E  N K+SMNPFDEIA+EE+L+L+E G ATEV+V
Sbjct: 1   MKVLVPVKRVVDYNVKIRVKSDGSGVELGNVKMSMNPFDEIAVEEALRLKEAGKATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E ++  LAMGADRGIL++    +EPL++AKIL+ I  +E P ++I GKQ  
Sbjct: 61  VSIGPAQASETIRTGLAMGADRGILVKVEGNVEPLAVAKILKAIADEEKPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W QATF S +++      V REV  G+  ++   PA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWSQATFASKLEVDGADFQVAREVDGGSQIVKLKGPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I +  A  + +DL P L++L+  E    + G+++    +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPIAEATAEQYGVDLAPHLEILKTVEPGGRKAGVKVKDVAELVS 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAGVI 249


>gi|332186919|ref|ZP_08388660.1| electron transfer flavodomain protein [Sphingomonas sp. S17]
 gi|332012929|gb|EGI54993.1| electron transfer flavodomain protein [Sphingomonas sp. S17]
          Length = 249

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 174/244 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+VP+K V++YN K R+K D +G++  N K+SMNPFDEIA+EE+++L+EKG ATEV+V
Sbjct: 1   MKIVVPVKRVLDYNVKPRVKADGTGVDLANVKMSMNPFDEIAVEEAIRLKEKGAATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K  + L+ +LAMGADR ILI +++ +EPL +AK+L ++V++E P +VI GKQ  
Sbjct: 61  VSIGEPKAADTLRTALAMGADRAILITADQPVEPLGVAKLLAKVVEEEQPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLA L+ W Q TF S ++I    A VTREV  G  T+   LPA++T DL L
Sbjct: 121 DGDNNQTGQMLAGLLGWAQGTFASKVEIDGETANVTREVDGGLETVALTLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+ K +  K   D+ +D+ PRL +    E    + G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKSKPMATKTTADYGVDVAPRLTITHVAEPGKRQAGVKVGSVDELVE 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKA 244


>gi|36958747|gb|AAQ87215.1| Electron transfer flavoprotein beta-subunit [Sinorhizobium fredii
           NGR234]
          Length = 240

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 179/240 (74%)

Query: 10  VINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVE 69
           ++++N K+R+K D +G+E  N K+SMNPFDEI++EE+L+L+E G A+EV+VVSIG  K E
Sbjct: 1   MVDFNVKIRVKADGTGVELANVKMSMNPFDEISVEEALRLKEAGKASEVVVVSIGPAKAE 60

Query: 70  EVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQ 129
           E L+ +LAMGADR IL+E+++ +EPL++AKI++ + + E P ++I GKQ  D++SNQTGQ
Sbjct: 61  ETLRTALAMGADRAILVETDDQVEPLTVAKIVKGVAEAEQPGLIIVGKQAIDDDSNQTGQ 120

Query: 130 MLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLP 189
           ML+AL+ W Q TF S +++ D    VTREV  G  T+E  LPAV+T DL LNEPRY SLP
Sbjct: 121 MLSALLGWAQGTFASKVELGDGKVNVTREVDGGLQTVELKLPAVVTTDLRLNEPRYASLP 180

Query: 190 NIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIEILKSKHDLL 249
           NI+KA+KK ++KK   DF +D  PRLKVL+ EE    + G+++ S  +L+E LKS+  +L
Sbjct: 181 NIMKAKKKPLDKKSPADFGVDTAPRLKVLKTEEPSGRKAGIKVKSVAELVEKLKSEAGIL 240


>gi|84501961|ref|ZP_01000119.1| electron transfer flavoprotein, beta subunit [Oceanicola batsensis
           HTCC2597]
 gi|84389956|gb|EAQ02590.1| electron transfer flavoprotein, beta subunit [Oceanicola batsensis
           HTCC2597]
          Length = 252

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 180/249 (72%), Gaps = 4/249 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D +G++  N K+SMNPFDEIA+EE+++L+E G A EV+V
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGNGVDLANVKMSMNPFDEIAVEEAIRLKEAGNAEEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + +  +EPL++AKIL+ ++ +E P +VIAG
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVVAADDVHTDIEPLAVAKILKGVIDEEAPGLVIAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQMLAAL+ W QATF + + I  + A+V REV  G  T++  +PA++T 
Sbjct: 121 KQAIDNDMNATGQMLAALLGWSQATFANELDIDGDSAVVKREVDGGLQTIKVKMPAIVTA 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D++PRL++++  E  A + G  +    
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKSADDYGVDVSPRLEIVKTSEPEARKAGEMVPDVD 240

Query: 237 KLIEILKSK 245
            L+  LK K
Sbjct: 241 TLVAKLKEK 249


>gi|729452|sp|P38975|ETFB_PARDE RecName: Full=Electron transfer flavoprotein subunit beta;
           Short=Beta-ETF; AltName: Full=Electron transfer
           flavoprotein small subunit; Short=ETFSS
 gi|5822052|pdb|1EFP|B Chain B, Electron Transfer Flavoprotein (Etf) From Paracoccus
           Denitrificans
 gi|5822054|pdb|1EFP|D Chain D, Electron Transfer Flavoprotein (Etf) From Paracoccus
           Denitrificans
 gi|309665|gb|AAA03071.1| electron transfer flavoprotein beta-subunit [Paracoccus
           denitrificans]
          Length = 252

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 124/247 (50%), Positives = 175/247 (70%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K +I+YN K R+K+D SG++  N K+SMNPFDEIA+EE+++L+EKG A E+I 
Sbjct: 1   MKVLVPVKRLIDYNVKARVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEKGQAEEIIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  +  E L+ +LAMGADR IL+    +  + +EPL++AKIL  + + E   ++IAG
Sbjct: 61  VSIGVKQAAETLRTALAMGADRAILVVAADDVQQDIEPLAVAKILAAVARAEGTELIIAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQMLAA++ W QATF S ++I    A VTREV  G  T+   LPAV+T 
Sbjct: 121 KQAIDNDMNATGQMLAAILGWAQATFASKVEIEGAKAKVTREVDGGLQTIAVSLPAVVTA 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D+ PRL+V+   E    + G+++ S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVAPRLEVVSVREPEGRKAGIKVGSVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVGKLK 247


>gi|258541672|ref|YP_003187105.1| electron transfer flavoprotein subunit beta [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256632750|dbj|BAH98725.1| electron transfer flavoprotein beta subunit [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256635807|dbj|BAI01776.1| electron transfer flavoprotein beta subunit [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256638862|dbj|BAI04824.1| electron transfer flavoprotein beta subunit [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256641916|dbj|BAI07871.1| electron transfer flavoprotein beta subunit [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256644971|dbj|BAI10919.1| electron transfer flavoprotein beta subunit [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256648026|dbj|BAI13967.1| electron transfer flavoprotein beta subunit [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256651079|dbj|BAI17013.1| electron transfer flavoprotein beta subunit [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256654070|dbj|BAI19997.1| electron transfer flavoprotein beta subunit [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 253

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 128/253 (50%), Positives = 182/253 (71%), Gaps = 4/253 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN +VR++ D SGIET N K+SMNPFDEIALEE+++L+EKGIATEV+ 
Sbjct: 1   MKILVPVKRVVDYNVRVRVRADGSGIETGNVKMSMNPFDEIALEEAVRLKEKGIATEVLA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  +  + L+ +LAMGADR +L+    ++++ LEPL +A+IL +IV  E   +VIAG
Sbjct: 61  VSIGVPQTRDTLRTALAMGADRALLVALPQDADQDLEPLCVARILAKIVDSEKVDLVIAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQMLAA + W Q T+ S + + +   +VTREV  G  T+   +PAVIT 
Sbjct: 121 KQAIDNDMNATGQMLAAALGWGQGTYASAVDVAEGTVLVTREVDGGLQTLRLKIPAVITT 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LN+PRY++LP I+KA+KK IE+       ID+TPRL+VL+  E  A + G++++S  
Sbjct: 181 DLRLNQPRYVALPAIMKAKKKTIEEMPLEVLGIDITPRLEVLKTVEPPARQAGVKVHSVD 240

Query: 237 KLIEILKSKHDLL 249
           +L+  LK++  +L
Sbjct: 241 ELLSKLKNEAGVL 253


>gi|163858105|ref|YP_001632403.1| electron transfer flavoprotein beta-subunit [Bordetella petrii DSM
           12804]
 gi|163261833|emb|CAP44135.1| electron transfer flavoprotein beta-subunit [Bordetella petrii]
          Length = 249

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 178/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K VI+ + KV +K+D SG++T N K SMNPFDEIA+EE+++LRE    TEVI 
Sbjct: 1   MKILVPVKRVIDKDVKVHVKSDGSGVDTANIKHSMNPFDEIAVEEAVRLRENDAVTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+E+ E LEPL++AK+L+ +V KE P +V+ GKQ  
Sbjct: 61  VSVGVVQAQETLRTALAIGADRAILVETAEELEPLAVAKVLKALVDKEQPRLVLIGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           DN++NQTGQMLAAL  + QATF S +++  + A VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DNDANQTGQMLAALADFSQATFASKVQLDGDTATVTREVDSGRETLTVSLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E     D  +D++PR+KVL+  E      G+ +     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKPLESVTPFDLGVDISPRVKVLKVTEPPQRSAGITVPDVAALLD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKII 249


>gi|92118941|ref|YP_578670.1| electron transfer flavoprotein beta-subunit [Nitrobacter
           hamburgensis X14]
 gi|91801835|gb|ABE64210.1| electron transfer flavoprotein beta-subunit [Nitrobacter
           hamburgensis X14]
          Length = 249

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V+++N ++R+K D SG++    K+SMNPFDEIA+EE+++L+E G ATEV++
Sbjct: 1   MKILVPVKRVVDFNVQIRVKGDGSGVDLARVKMSMNPFDEIAIEEAVRLQEAGKATEVVL 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E ++  L+MGADRGILI S   +EPL++AK+LR +V++E P ++I GKQ  
Sbjct: 61  VSIGPAEAAETIRTGLSMGADRGILIRSEAPVEPLAVAKLLRAVVEEEGPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W QATF S +++   +  VTREV  G  T+    PA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGWAQATFASKLEVDGAYFKVTREVDGGLQTVRLKGPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +LPNI+KA+KK I ++ A  + +DL PRL+VLR  E    + G+++    +L+ 
Sbjct: 181 NEPRYATLPNIMKAKKKPIVERAADLYGVDLAPRLEVLRTTEPPGRKAGVKVKDVAELVS 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAGVI 249


>gi|296282967|ref|ZP_06860965.1| hypothetical protein CbatJ_05073 [Citromicrobium bathyomarinum
           JL354]
          Length = 248

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 174/244 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K VI+YN K R+K D SG++  N K+SMNPFDEIA+EE+++++E G A E++ 
Sbjct: 1   MKILVPVKRVIDYNVKPRVKADGSGVDLANVKMSMNPFDEIAVEEAIRIKEAGNAEEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K +E L+ +LAMGADR IL+ES+E LEPL++AKIL+ IV++E P +V+ GKQ+ 
Sbjct: 61  VSVGPAKAQETLRTALAMGADRAILVESDEDLEPLAVAKILKAIVEEEQPGLVLLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
            ++SNQTGQMLAAL+  PQ TF + I +  +   V RE+  G  T++  LPA++T DL L
Sbjct: 121 SDDSNQTGQMLAALLDRPQGTFANTITLEGDSITVKREIDGGLETVKLTLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++ K   DF +D  PRLK L+  E    + G ++     L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPLDTKSPADFGVDTAPRLKTLKVSEPPVRQAGEKVEDVDALVA 240

Query: 241 ILKS 244
            +K+
Sbjct: 241 KVKA 244


>gi|85714898|ref|ZP_01045884.1| electron transfer flavoprotein beta-subunit [Nitrobacter sp.
           Nb-311A]
 gi|85698384|gb|EAQ36255.1| electron transfer flavoprotein beta-subunit [Nitrobacter sp.
           Nb-311A]
          Length = 249

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 178/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V+++N K+R+K D SG+E  N K+SMNPFDEIA+EE+L+L+E G A EV++
Sbjct: 1   MKILVPVKRVVDFNVKIRLKGDGSGVELANVKMSMNPFDEIAVEEALRLQEAGKAAEVVL 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E ++  L+MGADRGILI+S+  +EPL++AK+L+ +V++E P ++I GKQ  
Sbjct: 61  VSIGPAEAAETIRTGLSMGADRGILIKSDSPVEPLAVAKLLKAVVEEEGPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLA L+ W QATF S +++   +  V REV  G  T+    PA++T DL L
Sbjct: 121 DDDSNQTGQMLAGLLGWAQATFASKLEVDGAYFNVVREVDGGLQTVRLKKPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I  + A  + IDL PRL++L+  E    + G+++    +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPIVVRAANQYGIDLAPRLEILKTTEPPGRKAGVKVKDVAELVS 240

Query: 241 ILKSKHDLL 249
            L+ +  ++
Sbjct: 241 KLRDEAGVI 249


>gi|121602453|ref|YP_989312.1| electron transfer flavoprotein, beta subunit [Bartonella
           bacilliformis KC583]
 gi|120614630|gb|ABM45231.1| electron transfer flavoprotein, beta subunit [Bartonella
           bacilliformis KC583]
          Length = 250

 Score =  258 bits (659), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 127/245 (51%), Positives = 177/245 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK++V +K V+++N K+R+K D  G++  + K+SMNPFDEIA+EE+++ +E G  +EVI+
Sbjct: 1   MKVIVAVKRVVDHNIKIRVKADSMGVDLSHVKMSMNPFDEIAVEEAVRQKEAGKISEVIL 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+  LAMGADR ILI++ +TLEPL+IAK L+ I+ +E P +V  GKQ  
Sbjct: 61  VSIGQDVAQETLRTGLAMGADRAILIKTEKTLEPLAIAKTLKSIILEEKPDMVFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+ W QATF S++ I +  A VTRE+  GT T+  PLP V+TVDL L
Sbjct: 121 DDDSNQTGQMLAALLGWGQATFASHLHIENGKATVTREIDGGTQTICVPLPMVMTVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK IE+K+ +   ID   RL  LR EE +    G+++ +  +L+ 
Sbjct: 181 NEPRYTSLPNIMKAKKKIIEQKEISHLGIDTQARLTTLRVEEPKPRPAGMKINNVAELVS 240

Query: 241 ILKSK 245
           ILK K
Sbjct: 241 ILKDK 245


>gi|256822730|ref|YP_003146693.1| electron transfer flavoprotein subunit alpha/beta [Kangiella
           koreensis DSM 16069]
 gi|256796269|gb|ACV26925.1| Electron transfer flavoprotein alpha/beta- subunit [Kangiella
           koreensis DSM 16069]
          Length = 249

 Score =  258 bits (658), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 184/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV IK VI+ N KVR+K D +G+E  N K+SMNPF EIA+EE+++L+E+G+A+EVIV
Sbjct: 1   MKILVAIKRVIDANVKVRVKADNTGVEMANVKMSMNPFCEIAVEEAVRLKEQGVASEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+ + +E L+ +LA+GADR IL++S + +EPL++AK+L+ +V+KE P +V+ GKQ+ 
Sbjct: 61  VSIGNQQCQESLRTALALGADRAILVKSEDDIEPLAVAKVLKTVVEKEQPEMVLLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQML AL+ W Q TF S +++ D  A VTRE+  G  T+   LPA+IT DL L
Sbjct: 121 DGDNNQTGQMLGALLGWGQGTFASKVEVADGKAQVTREIDGGLQTLSVKLPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+ SLPNI+KA++K +++    D  +D+ PR + L  E   A ++G+++ +  +L++
Sbjct: 181 NEPRFASLPNIMKAKRKPLDELAIADLGVDVAPRTETLTVENPPARKEGIKVETVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|209517746|ref|ZP_03266582.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           H160]
 gi|209501801|gb|EEA01821.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           H160]
          Length = 249

 Score =  258 bits (658), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 120/245 (48%), Positives = 175/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+V +K V++ N KVR K D SG++  N K++MNPFDEIA+EE+++L+E+GIA+EV+ 
Sbjct: 1   MKIVVAVKRVVDANVKVRAKGDGSGVDLSNVKMAMNPFDEIAVEEAVRLKEQGIASEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           +S G+   +E L+ +LA+GADR +L+E+NE L+PLS+A+++  +V +E P +VI GKQ  
Sbjct: 61  LSCGTSACQETLRTALALGADRAVLVETNEHLQPLSVARLISALVLREQPNLVICGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQM A+L+ WPQ TF S + I    A+VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDANQTGQMAASLLGWPQGTFASKLLIDGGEAMVTREVDGGLETIALKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +LPNI+KA+KK +   K  D  +D+ PRLK L+ EE  A + G  +     L++
Sbjct: 181 NEPRYTTLPNIMKAKKKPLTVLKPEDLGVDIAPRLKTLKVEEPAARKSGTLVADVATLLD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|126734745|ref|ZP_01750491.1| electron transfer flavoprotein beta-subunit [Roseobacter sp. CCS2]
 gi|126715300|gb|EBA12165.1| electron transfer flavoprotein beta-subunit [Roseobacter sp. CCS2]
          Length = 252

 Score =  257 bits (657), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 125/247 (50%), Positives = 175/247 (70%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++LRE G   EV+ 
Sbjct: 1   MKVLVSVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLREAGKVDEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNET----LEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+ + +     +EPL++AKIL  IVK+E P +V+ G
Sbjct: 61  VSIGVKQSQETLRTALAMGADRAILVVATDDVHTDIEPLAVAKILAAIVKEEEPGLVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W QATF S + I  + A VTREV  G  T++  +P ++TV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQATFASEVDIDGDSATVTREVDGGLQTIKVKMPTIVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K   D+ +D+ PRL ++   E  A + G+ + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTPADYGVDVAPRLSIVSTTEPEARKAGIMVGSVD 240

Query: 237 KLIEILK 243
           +L+E LK
Sbjct: 241 ELVEKLK 247


>gi|110635362|ref|YP_675570.1| electron transfer flavoprotein beta-subunit [Mesorhizobium sp.
           BNC1]
 gi|110286346|gb|ABG64405.1| electron transfer flavoprotein beta-subunit [Chelativorans sp.
           BNC1]
          Length = 249

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+ N K R+K D SG+E  N K++MNPFDEIA+EE+++ +E G   E++ 
Sbjct: 1   MKVLVPVKRVIDANVKPRVKADGSGVELANVKMAMNPFDEIAVEEAIRQKEAGKVEEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E L+ +LAMGADR IL++ ++ +EPL +AKIL+ I + E P ++I GKQ  
Sbjct: 61  VSIGPAQAQETLRTALAMGADRAILVKCDQAVEPLDVAKILKGIAEAEKPGMIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ W Q TF S ++I +  A +TREV  G   +E  LPA++T DL L
Sbjct: 121 DDDANQTGQMLAALLGWAQGTFASKLEISEGTAKITREVDAGLQVVELKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +++K  +D+ +++  RLKVL  EE    + G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDEKAPSDYGVEVRSRLKVLTTEEPAKRKAGIKVSSAAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 RLKNEAGVL 249


>gi|307294198|ref|ZP_07574042.1| Electron transfer flavoprotein alpha/beta-subunit [Sphingobium
           chlorophenolicum L-1]
 gi|306880349|gb|EFN11566.1| Electron transfer flavoprotein alpha/beta-subunit [Sphingobium
           chlorophenolicum L-1]
          Length = 249

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 176/244 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K VI+YN K R+K D +G++  N K+SMNPFDEIA+EE+++L+EKG+ATEV+ 
Sbjct: 1   MKILVPVKRVIDYNVKPRVKADGTGVDLANVKMSMNPFDEIAVEEAIRLKEKGVATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K +E L+ +LAMGADR ILI++++ +EPL +AK+L ++ ++E   ++I GKQ  
Sbjct: 61  VSIGVAKAQETLRTALAMGADRAILIQTDDEVEPLGVAKLLAKVQEEEGAGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+  PQ TF S +++  +   VTREV  G  T++  +PA++T DL L
Sbjct: 121 DDDSNQTGQMLAALLGLPQGTFASKVEVEGDKVSVTREVDGGLETVKLNVPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+ K +  K   D+ +D++PRL+ L   E      G+++    +L+ 
Sbjct: 181 NEPRYASLPNIMKAKSKPLATKAPADYGVDISPRLETLSVAEPAKRSAGVKVADVDELVA 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKA 244


>gi|241113182|ref|YP_002973017.1| Electron transfer flavoprotein alpha/beta-subunit [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240861390|gb|ACS59056.1| Electron transfer flavoprotein alpha/beta-subunit [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 249

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 186/249 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K D +G+E  N K+SMNPFDEI++EE+L+L+E G A EV+V
Sbjct: 1   MKILVPVKRVVDYNVKIRVKPDGTGVELANVKMSMNPFDEISVEEALRLKEAGKAEEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE L+ +LAMGADR IL+E+++ +EPL++AKIL+ +   E P ++I GKQ  
Sbjct: 61  VSIGPAKAEETLRTALAMGADRAILVETDDAVEPLTVAKILKAVADAEQPGLIIVGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+   QATF S I+I D  A VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALLGLAQATFASKIEIGDGKAQVTREVDGGLQTIEIKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +  TPRLKVL+ EE    + G+++ S  +LI+
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKTPDDFGVSTTPRLKVLKTEEPSGRKAGVKVKSVAELID 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAGVL 249


>gi|152979969|ref|YP_001352275.1| electron transfer flavoprotein beta subunit [Janthinobacterium sp.
           Marseille]
 gi|151280046|gb|ABR88456.1| electron transfer flavoprotein beta subunit [Janthinobacterium sp.
           Marseille]
          Length = 249

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 178/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V+++N KVR+K+D SG++  N K+SMNPFDEIA+EE+ +L+E G  TE+I 
Sbjct: 1   MKVLVPVKRVVDFNVKVRVKSDQSGVDIANVKMSMNPFDEIAVEEATRLKEAGKVTEIIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR +L+E++  L+PL++AK+L+ +  KE P ++I GKQ  
Sbjct: 61  VSCGILQSQETLRTAMAIGADRAVLVETDVELQPLAVAKLLKAVADKEQPQLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ WPQAT+ S ++I  +   VTREV  G   +   LPA++T DL L
Sbjct: 121 DDDANQTGQMLAALLDWPQATYASKVEIDGDKVKVTREVDGGLEVVSLTLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+TPRLK L+  E      G+ +     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKTLENFKPADLGVDVTPRLKTLKVVEPAKRSAGIIVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|126724340|ref|ZP_01740183.1| electron transfer flavoprotein beta-subunit [Rhodobacterales
           bacterium HTCC2150]
 gi|126705504|gb|EBA04594.1| electron transfer flavoprotein beta-subunit [Rhodobacterales
           bacterium HTCC2150]
          Length = 253

 Score =  256 bits (655), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 125/253 (49%), Positives = 180/253 (71%), Gaps = 4/253 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK++VP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++LRE G   E+I 
Sbjct: 1   MKVIVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLREAGKVEEIIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + +  +EPL++AKIL+ IV +E P +V+ G
Sbjct: 61  VSIGVKQNQETLRTALAMGADRAILVIAADDVHTDIEPLAVAKILKAIVDEEQPGLVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+ALM W QATF S + +  + A+VTREV  G  T++  +P V+TV
Sbjct: 121 KQAIDNDINATGQMLSALMGWSQATFTSELNVEGDSAVVTREVDGGLQTIKVKMPTVVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA++K +++K   D+ +D +PRL V++  E  A + G+ + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKRKPLDEKTPADYGVDASPRLSVVKTVEPEARKAGVMVGSVD 240

Query: 237 KLIEILKSKHDLL 249
           +LI  LK +  ++
Sbjct: 241 ELIAKLKDEAGVI 253


>gi|294675701|ref|YP_003576316.1| electron transfer flavoprotein subunit beta [Rhodobacter capsulatus
           SB 1003]
 gi|294474521|gb|ADE83909.1| electron transfer flavoprotein, beta subunit [Rhodobacter
           capsulatus SB 1003]
          Length = 252

 Score =  256 bits (655), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 180/247 (72%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+EKG ATE++V
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEKGAATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNET----LEPLSIAKILREIVKKENPIIVIAG 116
           VS+G  + +E L+ +LAMGADR IL+ + E     +EPL++AKI+ ++  +E P ++I G
Sbjct: 61  VSVGVKQAQETLRTALAMGADRAILVVAAEDVHTDIEPLAVAKIIAKVAAEEQPGLIITG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQM+AAL+ W QA+F S ++I  + A VTREV  G  T+E  LPAVIT 
Sbjct: 121 KQAIDNDMNATGQMVAALLGWAQASFASAVEIAGDAAKVTREVDGGLQTIEVKLPAVITA 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK + +K A D+ +D+TPRL V++  E      G+++ S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKELAEKTAADYGVDVTPRLTVVKTAEPAGRAAGIKVGSVD 240

Query: 237 KLIEILK 243
           +LI  LK
Sbjct: 241 ELIGKLK 247


>gi|255264595|ref|ZP_05343937.1| electron transfer flavoprotein subunit beta [Thalassiobium sp.
           R2A62]
 gi|255106930|gb|EET49604.1| electron transfer flavoprotein subunit beta [Thalassiobium sp.
           R2A62]
          Length = 252

 Score =  256 bits (655), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 124/247 (50%), Positives = 175/247 (70%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+E++++L+E G A EVI 
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEQAIRLKEAGQADEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNET----LEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR ILI + +     +EPL++AK+L+ +V +E P IV+ G
Sbjct: 61  VSIGVKQSQETLRTALAMGADRAILINAADDVHTDIEPLAVAKLLKAVVDEEQPSIVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W QATF S + I  + A VTREV  G  T++  +P ++TV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQATFASEVAIDGDSATVTREVDGGLQTIKVKMPTIVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K   D+ +D+ PRL ++   E    + G  + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTPADYGVDVAPRLAIVGTTEPETRKAGEMVGSVD 240

Query: 237 KLIEILK 243
           +L+E LK
Sbjct: 241 ELVEKLK 247


>gi|294011146|ref|YP_003544606.1| electron transfer flavoprotein beta subunit [Sphingobium japonicum
           UT26S]
 gi|292674476|dbj|BAI95994.1| electron transfer flavoprotein beta subunit [Sphingobium japonicum
           UT26S]
          Length = 249

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 121/244 (49%), Positives = 175/244 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K VI+YN K R+K D +G++  N K+SMNPFDEIA+EE+++L+EKG+ATEV+ 
Sbjct: 1   MKILVPVKRVIDYNVKPRVKADGTGVDLANVKMSMNPFDEIAVEEAIRLKEKGVATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K +E L+ +LAMGADR ILI++++ +EPL +AK+L ++ ++E   ++I GKQ  
Sbjct: 61  VSIGVAKAQETLRTALAMGADRAILIQTDDEVEPLGVAKLLAKVQEEEGAGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+  PQ TF S +++  +   VTREV  G  T++   PA+IT DL L
Sbjct: 121 DDDSNQTGQMLAALLNLPQGTFASKVEVEGDKVSVTREVDGGLETVKLNTPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+ K +  K   D+ +D++PRL+ L   E      G+++    +L+ 
Sbjct: 181 NEPRYASLPNIMKAKSKPLATKAPADYGVDISPRLETLSVAEPAKRSAGVKVADVDELVA 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKA 244


>gi|300310833|ref|YP_003774925.1| electron transfer flavoprotein subunit beta [Herbaspirillum
           seropedicae SmR1]
 gi|300073618|gb|ADJ63017.1| electron transfer flavoprotein, beta-subunit, protein
           [Herbaspirillum seropedicae SmR1]
          Length = 251

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 179/251 (71%), Gaps = 2/251 (0%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D SG++  N K+SMNPFDEIA+EE+++L+E G  TEVI 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDGSGVDIANVKMSMNPFDEIAVEEAVRLKEGGKVTEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE--SNETLEPLSIAKILREIVKKENPIIVIAGKQ 118
           VS G  + +E L+ ++A+GADRGIL E  ++  L+PL++AKIL+ + +KE P ++I GKQ
Sbjct: 61  VSAGVTQCQETLRTAMAIGADRGILAEVGADVELQPLAVAKILKALAEKEQPQLIILGKQ 120

Query: 119 TTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDL 178
             D++ NQTGQMLAAL+ WPQATF S + + +    VTREV  G  T+   LPA+IT DL
Sbjct: 121 AIDDDCNQTGQMLAALLGWPQATFASKVVLEEGKVTVTREVDGGLETLALTLPAIITTDL 180

Query: 179 NLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKL 238
            LNEPRY++LPNI+KA+KK+++  K  +  +D+ PR+K L+  E      G+++     L
Sbjct: 181 RLNEPRYVTLPNIMKAKKKQLDTVKPEELGVDVAPRVKTLKVAEPAKRSAGVKVPDVATL 240

Query: 239 IEILKSKHDLL 249
           +  LK++  ++
Sbjct: 241 VAKLKNEAKVI 251


>gi|319406789|emb|CBI80422.1| electron transfer flavoprotein beta-subunit [Bartonella sp. 1-1C]
          Length = 248

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 176/243 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+V +K VI++N K+R+K+D +G++  + K+SMNPFDEIA+EE+++ +E G  +E+I+
Sbjct: 1   MKIVVAVKRVIDHNIKIRVKSDSTGVDLSHVKMSMNPFDEIAVEEAIRQKEAGKISEIIL 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+  LAMGADR IL+++NE LEPL+IAKIL+ I+ +E P +V  GKQ  
Sbjct: 61  VSIGPEAAQETLRTGLAMGADRAILVKTNEILEPLAIAKILKVIILEEKPDMVFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+E NQTGQMLA L+ W QATF S++ I +  A +TREV +GT T+  PLP V+TVDL L
Sbjct: 121 DDECNQTGQMLAGLLGWGQATFASHLNIENGQAQITREVDNGTQTICLPLPMVMTVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNIIKA+KK IE+K      I+   RL  L  EE +  + G+++ + T+LI 
Sbjct: 181 NEPRYTSLPNIIKAKKKPIEQKDIAHLCINTQKRLTTLSVEEPKPRQAGIKVANVTELIS 240

Query: 241 ILK 243
            LK
Sbjct: 241 ALK 243


>gi|121609054|ref|YP_996861.1| electron transfer flavoprotein subunit beta [Verminephrobacter
           eiseniae EF01-2]
 gi|121553694|gb|ABM57843.1| electron transfer flavoprotein beta-subunit [Verminephrobacter
           eiseniae EF01-2]
          Length = 249

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 177/245 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK++VP+K V++YN KVR+K+D++G++  N K+SMNPFDEIA+EE+++L+EKG+ TE+I 
Sbjct: 1   MKVMVPVKRVVDYNVKVRVKSDHTGVDIANVKMSMNPFDEIAVEEAVRLKEKGLVTEIIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ ++A+GADR IL++++  L+PL++AK+L+ +V +E P ++I GKQ  
Sbjct: 61  VSCGVAQCQETLRTAMAIGADRAILVQTDVPLQPLAVAKLLQALVAREQPALIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQAT  S +++  +   VTREV  G  T+   LPAVIT DL L
Sbjct: 121 DDDANQTGQMLAALADLPQATCASKVELAPDRLEVTREVDGGLETLALTLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRYI+LPNI+KA+KK ++     D  +D+ PRL  L+  E      G+++     L+E
Sbjct: 181 NEPRYITLPNIMKAKKKPLDTVTPDDLGVDVAPRLTTLKVSEPAKRGAGVKVADVAALVE 240

Query: 241 ILKSK 245
            L+++
Sbjct: 241 KLRNE 245


>gi|149185335|ref|ZP_01863652.1| hypothetical protein ED21_19817 [Erythrobacter sp. SD-21]
 gi|148831446|gb|EDL49880.1| hypothetical protein ED21_19817 [Erythrobacter sp. SD-21]
          Length = 248

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 121/244 (49%), Positives = 172/244 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K VI+YN K R+K D SG++  N K+SMNPFDEIA+EE+++++E G A E++ 
Sbjct: 1   MKILVPVKRVIDYNVKPRVKADGSGVDLANVKMSMNPFDEIAVEEAIRIKEAGKAEEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K +E L+ +LAMGADR IL+E+++ +EPL++AKIL+ I ++E+P IV+ GKQ  
Sbjct: 61  VSIGPAKAQETLRTALAMGADRAILVETDDEVEPLAVAKILKAIAEEESPGIVMLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAALM  PQ TF + +++      V REV  G  T++  LPA++T DL L
Sbjct: 121 DDDSNQTGQMLAALMGRPQGTFANTVEVDGESVTVKREVDGGLQTVKLTLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++ K   D+ +D  PRLK     E    + G ++     L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPLDTKSPADYGVDTAPRLKTTNVSEPPVRQAGEKVEDVDALVA 240

Query: 241 ILKS 244
            +K+
Sbjct: 241 KIKA 244


>gi|258543605|ref|YP_003189038.1| electron transfer flavoprotein subunit beta [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256634683|dbj|BAI00659.1| electron transfer flavoprotein beta subunit [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256637739|dbj|BAI03708.1| electron transfer flavoprotein beta subunit [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256640793|dbj|BAI06755.1| electron transfer flavoprotein beta subunit [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256643848|dbj|BAI09803.1| electron transfer flavoprotein beta subunit [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256646903|dbj|BAI12851.1| electron transfer flavoprotein beta subunit [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256649956|dbj|BAI15897.1| electron transfer flavoprotein beta subunit [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256652946|dbj|BAI18880.1| electron transfer flavoprotein beta subunit [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256656000|dbj|BAI21927.1| electron transfer flavoprotein beta subunit [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 249

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K R+K D SG++T   K+SMNPFDEIA+EE+++LREKG A+EV+V
Sbjct: 1   MKILVPVKRVVDYNIKPRVKADGSGVDTTGVKMSMNPFDEIAVEEAVRLREKGAASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K ++ L+ ++AMGADR IL+ S E+ EPL++AK+LR++V+KE P +VI GKQ  
Sbjct: 61  VSVGVQKAQDTLRTAMAMGADRAILVLSEESPEPLAVAKVLRKLVEKEEPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ N TGQMLA L+ W Q TF S ++I D HA V+RE+  GT  +   LPA+IT DL L
Sbjct: 121 DDDMNATGQMLAGLLGWGQGTFASKVEIADGHARVSREIDGGTEEVSLTLPAIITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E  +A +  +D+ PRL V+   E    + G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLETIEAAELGVDMKPRLSVVSVAEPPERKAGIKVGSVGELVE 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|312116187|ref|YP_004013783.1| electron transfer flavoprotein alpha/beta-subunit [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311221316|gb|ADP72684.1| Electron transfer flavoprotein alpha/beta-subunit [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 250

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+VP+K V++YN K+R+K D SG++T N K+SMNPFDEIA+EE+++L+E G A EVI 
Sbjct: 1   MKIIVPVKRVVDYNVKIRVKPDGSGVDTINVKMSMNPFDEIAVEEAIRLKEAGHADEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K +E L+ +LAMGADR IL +++  +EPL++AKIL+  V+KE P +VI GKQ  
Sbjct: 61  VSIGPAKAQETLRTALAMGADRAILYKTDLPIEPLAVAKILKAAVEKEKPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+  PQATF   +        V REV  G  T+   LPA++TVDL +
Sbjct: 121 DDDSNQTGQMLAALLNRPQATFAFKVSPQGETVEVVREVDGGLQTLALRLPAIVTVDLRI 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N+PRY SLPNI+KA+KK +E+  A    ID+ P++KVL+  E    + G++L +  +L++
Sbjct: 181 NQPRYASLPNIMKAKKKPLEEIDAASLGIDIEPKVKVLKTAEPPTRKAGVKLKTAAELVD 240

Query: 241 ILKSKHDLL 249
            L+++  +L
Sbjct: 241 KLRTEAGVL 249


>gi|260429520|ref|ZP_05783497.1| electron transfer flavoprotein subunit beta [Citreicella sp. SE45]
 gi|260420143|gb|EEX13396.1| electron transfer flavoprotein subunit beta [Citreicella sp. SE45]
          Length = 252

 Score =  256 bits (653), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 127/247 (51%), Positives = 176/247 (71%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A+EVIV
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKASEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIES----NETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+  LAMGADR IL+ +    +E +EPL++AKIL  IVK+E P +VI G
Sbjct: 61  VSIGVKQAQETLRTGLAMGADRAILVTAAEDVHEDIEPLAVAKILAAIVKEEEPGLVICG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+   TGQMLAAL    QAT  + +++ D+ A V REV  G  T++  LPA++T 
Sbjct: 121 KQAIDNDLGATGQMLAALTGLAQATNANTLEVADDSATVAREVDGGLQTIKVSLPAIVTT 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K   D+ +D++PRL+V++  E  A   G  + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTPADYGVDVSPRLEVVKTAEPAARAAGTMVGSVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVAKLK 247


>gi|319405218|emb|CBI78823.1| electron transfer flavoprotein beta-subunit [Bartonella sp. AR
           15-3]
          Length = 248

 Score =  255 bits (652), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 177/243 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+V +K VI++N K+R+K+D +G++  + K+SMNPFDEIA+EE+++ +E G  +E+I+
Sbjct: 1   MKIIVAVKRVIDHNIKIRVKSDSTGVDLSHVKMSMNPFDEIAVEEAIRQKEAGKISEIIL 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+  LAMGADR IL++++E LEPL+IAK L+ I+ +E P +V  GKQ  
Sbjct: 61  VSIGPEAAQETLRTGLAMGADRAILVKTDEILEPLAIAKTLKVIILEEKPDMVFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+E NQTGQMLA L+ W QATF S + I +  A +TREV +GT T+  PLP V+TVDL L
Sbjct: 121 DDECNQTGQMLAGLLGWGQATFASCLNIENGRAQITREVDNGTQTICLPLPVVMTVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNIIKA+KK IE+K   +  +D   RL +L  EE +  + G+++ + T+LI 
Sbjct: 181 NEPRYTSLPNIIKAKKKPIEQKDIANLCVDTQKRLTMLSIEEPQPRQAGIKVANVTELIN 240

Query: 241 ILK 243
           +LK
Sbjct: 241 VLK 243


>gi|323530210|ref|YP_004232362.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           CCGE1001]
 gi|323387212|gb|ADX59302.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           CCGE1001]
          Length = 249

 Score =  255 bits (652), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 178/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+V +K V++ N KV + +D S ++  N K++MNPFDEIA+EE+++L+EKG+ATEVI 
Sbjct: 1   MKIVVAVKRVVDANVKVTVASDNSKVDLNNLKMAMNPFDEIAIEEAVRLKEKGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LAMGADR IL+E+N  L+PL++AK+L+ ++ KE P +V+ GKQ  
Sbjct: 61  VSAGVTQCQETLRTALAMGADRAILVETNVELQPLAVAKVLKALIDKEQPQLVVLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQM+AAL    QATF S + + D  A+V+REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDANQTGQMVAALAGIAQATFASKVTVEDGRAVVSREVDGGIETLSLRLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LP+I+KA+KK +E     D  ID++PRLK LR  E      G+++   T L++
Sbjct: 181 NEPRYVTLPSIMKAKKKPLESLNPEDLGIDVSPRLKTLRVNEPSKRAGGMKVADVTALVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEVKVL 249


>gi|325267240|ref|ZP_08133903.1| electron transfer flavoprotein beta subunit [Kingella denitrificans
           ATCC 33394]
 gi|324981301|gb|EGC16950.1| electron transfer flavoprotein beta subunit [Kingella denitrificans
           ATCC 33394]
          Length = 248

 Score =  254 bits (650), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 178/244 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V+++N KVR+K D S +E  N K+SMNPFDEIA+EE+++L+E G  +E++V
Sbjct: 1   MKALVAVKRVVDFNVKVRVKADGSDVEIGNVKMSMNPFDEIAVEEAVRLKEAGKISEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K E+VL+ +LAMGADR I +E++E LEPL++AKIL++I + E   + + GKQ  
Sbjct: 61  VSLGEKKCEDVLRTALAMGADRAIHVETDEKLEPLAVAKILKKIAETEQVQLCLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQT QMLAALM  PQATF S + + +   +VTRE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQTAQMLAALMNAPQATFASKVVLNEQEVVVTREIDGGLETLALKLPAVISTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPN++ A+KK +EK+   +F +D+TPRL V ++ E +A + G+++ +  +L+E
Sbjct: 181 NEPRFVKLPNLMAAKKKTLEKRSIDEFGVDITPRLSVQKYAEPKARQAGIKVANAAELVE 240

Query: 241 ILKS 244
            L +
Sbjct: 241 KLTA 244


>gi|109898463|ref|YP_661718.1| electron transfer flavoprotein beta-subunit [Pseudoalteromonas
           atlantica T6c]
 gi|109700744|gb|ABG40664.1| electron transfer flavoprotein beta-subunit [Pseudoalteromonas
           atlantica T6c]
          Length = 271

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 180/245 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K  I+YN KVR+K D+S ++  N K+S+NPF EIA+EE+++L+EKG+ATE++V
Sbjct: 23  MKILVPVKRAIDYNVKVRVKADHSAVDLTNAKMSINPFCEIAVEEAVRLKEKGVATEIVV 82

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E ++ +LA+GADRG+ I++NE L+ L IAK+L+++V++E P +VI GKQ+ 
Sbjct: 83  VSIGDKSCQEQIRTALALGADRGLQIDTNEYLDSLQIAKLLKKVVEEEAPDLVILGKQSI 142

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQ TF S + I      VTRE+  G  T+E  LPAV+T DL L
Sbjct: 143 DSDNNQTGQMLAALTGMPQGTFASEVNIDAGKVKVTREIDGGLQTVELNLPAVVTTDLRL 202

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K +E K A DF ++L+  +KVL+ E       G+++    +L++
Sbjct: 203 NEPRYASLPNIMKAKRKPLEVKVAADFGVELSSNVKVLKVEPPAQRSGGVKVADVAELVD 262

Query: 241 ILKSK 245
            LK++
Sbjct: 263 KLKNE 267


>gi|332306482|ref|YP_004434333.1| Electron transfer flavoprotein alpha/beta-subunit [Glaciecola
           agarilytica 4H-3-7+YE-5]
 gi|332173811|gb|AEE23065.1| Electron transfer flavoprotein alpha/beta-subunit [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 249

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K  I+YN KVR+K D S ++  N K+S+NPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKILVPVKRAIDYNVKVRVKADNSAVDLTNAKMSINPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E ++ +LA+GADRG+ I+++E+L+ L IAK+L+++V+ E+P +VI GKQ+ 
Sbjct: 61  VSIGDKSCQEQIRTALALGADRGLQIDTSESLDSLQIAKLLKKVVEDESPDLVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQ TF S + I      VTRE+  G  T+E  LPAV+T DL L
Sbjct: 121 DSDNNQTGQMLAALTGMPQGTFASEVNIDSGKVKVTREIDGGLQTVELNLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K ++ K A DF ++LT  +KVL+ E       G+++    +L++
Sbjct: 181 NEPRYASLPNIMKAKRKPLDVKAAADFGVELTSNVKVLKVEPPAQRSGGVKVADVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|241760636|ref|ZP_04758728.1| electron transfer flavoprotein subunit beta [Neisseria flavescens
           SK114]
 gi|241318817|gb|EER55343.1| electron transfer flavoprotein subunit beta [Neisseria flavescens
           SK114]
          Length = 249

 Score =  254 bits (649), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 117/245 (47%), Positives = 175/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR + +E++  LEPL++AK+L+ +  KENP I++ GKQ  
Sbjct: 61  VSLGEKKCEETLRTALAMGADRAVHVETDAKLEPLAVAKLLKAVADKENPQILLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TF S ++I    A+VTRE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFASKVQIEGEEALVTREIDGGEETVALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D A+D++PRL  ++F E +A + G+++    +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLSPADLAVDISPRLNTVKFAEPKARQAGVKVADVAELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|91762992|ref|ZP_01264957.1| electron transfer flavoprotein beta-chain [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|91718794|gb|EAS85444.1| electron transfer flavoprotein beta-chain [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 249

 Score =  254 bits (649), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 181/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+YN ++R+K D +GI T+N K+S NP D+ A+EE+++++E G ATE++ 
Sbjct: 1   MKILVAVKRVIDYNVQIRVKEDGTGIVTDNVKMSTNPPDDNAIEEAVKIKEAGKATEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG  K +E ++ +LA+GADRGI ++    +EPL++AKIL++IV KE P +V  GKQ  
Sbjct: 61  VTIGEEKAQETVRKALAVGADRGIHVKVEGVVEPLAVAKILQKIVDKEKPDLVFMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQML+AL+ WPQATFVS I I DN   + RE+  G  T+E  +PAV+T DL L
Sbjct: 121 DDDCNQTGQMLSALLNWPQATFVSKIDIKDNKLEIIREIDEGLETIEVNVPAVVTCDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I++  A D  +D TPR++ ++ EE    + G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPIDQMTAADLGVDATPRVQQIKVEEPPKRKAGIKVSSVAELVQ 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|163744731|ref|ZP_02152091.1| electron transfer flavoprotein, beta subunit [Oceanibulbus
           indolifex HEL-45]
 gi|161381549|gb|EDQ05958.1| electron transfer flavoprotein, beta subunit [Oceanibulbus
           indolifex HEL-45]
          Length = 252

 Score =  254 bits (649), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 123/247 (49%), Positives = 178/247 (72%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+E++++L+E G   E++ 
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEQAIRLKEAGQVEEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + ++ +EPL++AKIL+ IV +E P +V+ G
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVIASDDVHKDIEPLAVAKILKAIVDEEQPGLVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+ALM W QATF S + I  + A VTREV  G  T+E  +P V+TV
Sbjct: 121 KQAIDNDMNATGQMLSALMGWSQATFASEVTIEGDKAKVTREVDGGLQTIEVTMPTVVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D++ RL++++  E      G+++ S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAEDYGVDVSNRLEIVKTVEPAERAAGIKVGSVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVAKLK 247


>gi|254456081|ref|ZP_05069510.1| electron transfer flavoprotein beta-chain [Candidatus Pelagibacter
           sp. HTCC7211]
 gi|207083083|gb|EDZ60509.1| electron transfer flavoprotein beta-chain [Candidatus Pelagibacter
           sp. HTCC7211]
          Length = 249

 Score =  254 bits (649), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 183/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+YN ++R+K D SGI TEN K+S NP D+ A+EE+++++E G ATEVI 
Sbjct: 1   MKILVAVKRVIDYNVQIRVKEDGSGIVTENVKMSTNPPDDNAIEEAVKIKESGKATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V++G  K +E ++ +LA+GADRGI I+++  +EPL+++KIL++IV+KE P +V  GKQ  
Sbjct: 61  VTVGEEKAQETVRKALAVGADRGIHIKADNNIEPLAVSKILQKIVEKEKPDLVFMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQML+AL+ WPQATF S I + +    VTRE+  G  T+E   PA++T DL L
Sbjct: 121 DDDCNQTGQMLSALLDWPQATFASKINVEEGKLKVTREIDEGLETIEINTPAIVTCDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK IE+  A+D  ID+ PR++ ++ EE    + G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPIEQLIASDLGIDINPRVQQIKVEEPPQRKAGIKVASVAELVQ 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|114764508|ref|ZP_01443733.1| electron transfer flavoprotein, beta subunit [Pelagibaca
           bermudensis HTCC2601]
 gi|114543075|gb|EAU46094.1| electron transfer flavoprotein, beta subunit [Roseovarius sp.
           HTCC2601]
          Length = 252

 Score =  254 bits (648), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 178/249 (71%), Gaps = 4/249 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A EVIV
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKAEEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIES----NETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+  LAMGADR IL+ +    +E +EPL++AK+L  IVK+E P +VI G
Sbjct: 61  VSIGVKQAQETLRTGLAMGADRAILVTAADDVHEDIEPLAVAKLLAAIVKEEEPGLVICG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQMLAAL  + QAT  +++++  + A V REV  G  T++  LPA++T 
Sbjct: 121 KQAIDNDLNATGQMLAALTGYAQATNANSLEVDGDAATVAREVDGGLQTIKVKLPAIVTT 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K   D+ +D+ PRL++++  E      G+ + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTPADYGVDVAPRLEIVKTAEPAERAAGIMVGSVD 240

Query: 237 KLIEILKSK 245
           +L+E LK K
Sbjct: 241 ELVEKLKEK 249


>gi|94498755|ref|ZP_01305304.1| hypothetical protein SKA58_14382 [Sphingomonas sp. SKA58]
 gi|94421805|gb|EAT06857.1| hypothetical protein SKA58_14382 [Sphingomonas sp. SKA58]
          Length = 249

 Score =  254 bits (648), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 121/244 (49%), Positives = 175/244 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K VI+YN K R+K D +G++  N K+SMNPFDEIA+EE+++L+EKG A+EV+V
Sbjct: 1   MKILVPVKRVIDYNVKPRVKADGTGVDLANVKMSMNPFDEIAVEEAIRLKEKGAASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K +E L+ +LAMGADR ILI++++ +EPL +AK+L ++ ++E   ++I GKQ  
Sbjct: 61  VSIGVAKAQETLRTALAMGADRAILIQTDDEVEPLGVAKLLAKVQEEEGAGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL+  PQ TF S +++  +   VTREV  G  T++   PA+IT DL L
Sbjct: 121 DDDSNQTGQMLAALLGRPQGTFASKVEMEGDAVSVTREVDGGLETVKLTTPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+ K +  K   D+ +D++PRL+ +   E      G+++    +L+ 
Sbjct: 181 NEPRYASLPNIMKAKSKPLANKMPADYGVDISPRLETVSVAEPAKRSAGVKVADVDELVA 240

Query: 241 ILKS 244
            LKS
Sbjct: 241 KLKS 244


>gi|126732314|ref|ZP_01748114.1| electron transfer flavoprotein, beta subunit [Sagittula stellata
           E-37]
 gi|126707183|gb|EBA06249.1| electron transfer flavoprotein, beta subunit [Sagittula stellata
           E-37]
          Length = 252

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 179/249 (71%), Gaps = 4/249 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A EVI 
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKAEEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + +  +EPL++AKIL +++++E P +V+ G
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVVAADDVHTDIEPLAVAKILAKVIEEEQPGLVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+   TGQML+AL+ W QA + + + +  +HA+VTREV  G  T++  +P +I+ 
Sbjct: 121 KQAIDNDLGATGQMLSALLGWSQAMYANTVDVDGDHAVVTREVDGGLQTIKVKMPTIIST 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D  +D+TPRL++++  E  + + G  + S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTAADLGVDVTPRLEIVKTTEPESRQAGEMVGSVD 240

Query: 237 KLIEILKSK 245
           +L+  LK K
Sbjct: 241 ELVAKLKEK 249


>gi|221200866|ref|ZP_03573907.1| electron transfer flavoprotein, beta subunit [Burkholderia
           multivorans CGD2M]
 gi|221207061|ref|ZP_03580072.1| electron transfer flavoprotein, beta subunit [Burkholderia
           multivorans CGD2]
 gi|221173135|gb|EEE05571.1| electron transfer flavoprotein, beta subunit [Burkholderia
           multivorans CGD2]
 gi|221179438|gb|EEE11844.1| electron transfer flavoprotein, beta subunit [Burkholderia
           multivorans CGD2M]
          Length = 249

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 176/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK++  +K V++YN KVR+K+D++G++  N K+SMNPFDEIA+E + +L+E G ATEV+ 
Sbjct: 1   MKVIAAVKRVVDYNVKVRVKSDHTGVDIGNVKMSMNPFDEIAVEAATRLKEAGTATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+ G  + +E L+ +LA+GADRG+L+E++  L+PL++AK+L+ ++  E P +VI GKQ  
Sbjct: 61  VTCGIGQSQETLRTALAIGADRGVLVETDAELQPLAVAKLLKAVIDNEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++ QTGQ+LAAL+ WPQATF S+I+I +  A VTREV  G   +   LPA++T DL L
Sbjct: 121 DDDAGQTGQLLAALLDWPQATFASHIEIGNGVATVTREVDGGLEVIALKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++        +D +PRLK L+  E    + G+R+     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLDTVTPAALGVDPSPRLKTLKVVEPPVRKAGVRVPDVATLVE 240

Query: 241 ILKSK 245
            LKS+
Sbjct: 241 KLKSE 245


>gi|319638762|ref|ZP_07993521.1| FlaX protein [Neisseria mucosa C102]
 gi|317400003|gb|EFV80665.1| FlaX protein [Neisseria mucosa C102]
          Length = 249

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 175/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR + +E++  LEPL++AK+L+ +  KENP +++ GKQ  
Sbjct: 61  VSLGEKKCEETLRTALAMGADRAVHVETDAKLEPLAVAKLLKAVADKENPQVLLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TF S ++I    A+VTRE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFASKVQIEGEEALVTREIDGGEETVALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D A+D++PRL  ++F E +A + G+++    +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLSPADLAVDISPRLNTVKFAEPKARQAGVKVADVAELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|299529160|ref|ZP_07042606.1| electron transfer flavoprotein beta-subunit [Comamonas testosteroni
           S44]
 gi|298722852|gb|EFI63763.1| electron transfer flavoprotein beta-subunit [Comamonas testosteroni
           S44]
          Length = 239

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 116/239 (48%), Positives = 173/239 (72%)

Query: 11  INYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEE 70
           ++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+EKG+ TEVI VS G  + +E
Sbjct: 1   MDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEKGVVTEVIAVSCGVAQCQE 60

Query: 71  VLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQM 130
            L+ ++A+GADRGIL+E++  L+PL++AK+L+ +V KE P +VI GKQ  D+++NQTGQM
Sbjct: 61  TLRTAMAIGADRGILVETDVELQPLAVAKLLKALVDKEQPGLVICGKQAIDDDANQTGQM 120

Query: 131 LAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPN 190
           LAAL   PQATF S +++      VTREV  G  T+    PAVIT DL LNEPRY++LPN
Sbjct: 121 LAALADLPQATFASKVEVAGGKVNVTREVDGGLETVALATPAVITTDLRLNEPRYVTLPN 180

Query: 191 IIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIEILKSKHDLL 249
           I+KA+KK+++  K  D  +D+TPRLK ++  E      G+++     L++ LK++  ++
Sbjct: 181 IMKAKKKQLDTFKPEDLGVDVTPRLKTVKVSEPAKRGAGVKVADVAALVDKLKNEAKVI 239


>gi|319403782|emb|CBI77366.1| electron transfer flavoprotein beta-subunit [Bartonella rochalimae
           ATCC BAA-1498]
          Length = 248

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 174/243 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+V +K VI++N K+R+K+D +G++  + K+SMNPFDEIA+EE+++ +E G  +E+I+
Sbjct: 1   MKIIVAVKRVIDHNIKIRVKSDSTGVDLSHVKMSMNPFDEIAVEEAIRQKEAGKISEIIL 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+  LAMGADR IL++++E LEPL+IAK L+ I+ +E P +V  GKQ  
Sbjct: 61  VSIGPEAAQETLRTGLAMGADRAILVKTDEILEPLAIAKTLKVIILEEKPDMVFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+E NQTGQMLA L+ W QATF S + I +  A +TREV +GT T+  PLP V+TVDL L
Sbjct: 121 DDECNQTGQMLAGLLGWGQATFASYLNIENGQAQITREVDNGTQTICLPLPMVMTVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNIIKA+KK IE+K      +D   RL  L  EE +  + G+++ + T+LI 
Sbjct: 181 NEPRYTSLPNIIKAKKKPIEQKDIAHLCVDTQKRLTTLSVEEPKPRQAGIKVANVTELIS 240

Query: 241 ILK 243
            LK
Sbjct: 241 ALK 243


>gi|149927083|ref|ZP_01915341.1| electron transfer flavoprotein beta-subunit [Limnobacter sp.
           MED105]
 gi|149824304|gb|EDM83524.1| electron transfer flavoprotein beta-subunit [Limnobacter sp.
           MED105]
          Length = 249

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 174/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR K+D SG++  N K+SMNPFDEIA+EE+ +L+E G+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRCKSDGSGVDIANVKMSMNPFDEIAVEEATRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  +  E L+ + A+GADRGIL+E++  L+PL++AKIL+ IV+KE   +VI GKQ  
Sbjct: 61  VSCGVAQCVETLRTAAAIGADRGILVETDVELQPLAVAKILKAIVEKEGIDLVIMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL   PQ TF S + +      VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDCNQTGQMLAALADMPQGTFASKVVVEGGKVNVTREVDGGLETVSLSLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK+I+  K  D  +++ PR+K L+  +      G+ +     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKQIDTIKPADLGVNVDPRIKTLKVSDPPTRSAGITVPDVATLVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|91777405|ref|YP_552613.1| electron transfer flavoprotein subunit beta [Burkholderia
           xenovorans LB400]
 gi|91690065|gb|ABE33263.1| Electron transfer flavoprotein beta-subunit [Burkholderia
           xenovorans LB400]
          Length = 249

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 177/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V+++N K+R+K+D SG+E  N K+S+NPFDEIA+EE+++LREKG+ +EVI 
Sbjct: 1   MKVLVAVKRVVDFNVKIRVKSDGSGVELANVKMSINPFDEIAVEEAVRLREKGVVSEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G+   +E L+ ++A+GADRGIL+E++  L+PL++AK+L+ +V +E P +VI GKQ  
Sbjct: 61  VSCGTSASQETLRTAMAIGADRGILVETDAELQPLAVAKLLKALVDREKPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           DN+ NQTGQMLAAL    QATF S +++ ++ A VTRE+  G  T+   LPAV+T DL L
Sbjct: 121 DNDCNQTGQMLAALAGCAQATFASRVELSNDCATVTREIDGGLETLRLKLPAVVTSDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +LPNI+KA+KK ++        +D+ PRLK LR  E      G+++     L+ 
Sbjct: 181 NEPRYATLPNIMKAKKKPLDVVTPEQLGVDVAPRLKALRTIEPAGRSAGVKVPDVAALVA 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|225077328|ref|ZP_03720527.1| hypothetical protein NEIFLAOT_02387 [Neisseria flavescens
           NRL30031/H210]
 gi|224951320|gb|EEG32529.1| hypothetical protein NEIFLAOT_02387 [Neisseria flavescens
           NRL30031/H210]
          Length = 249

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 175/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR + +E++  LEPL++AK+L+ +  KENP I++ GKQ  
Sbjct: 61  VSLGGKKCEETLRTALAMGADRAVHVETDAKLEPLAVAKLLKAVADKENPQILLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TF S ++I    A+VTRE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFASKVQIEGEEALVTREIDGGEETVALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D A+D++PRL  ++F E ++ + G+++    +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLSPADLAVDISPRLNTVKFAEPKSRQAGVKVADVAELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|238022861|ref|ZP_04603287.1| hypothetical protein GCWU000324_02781 [Kingella oralis ATCC 51147]
 gi|237865669|gb|EEP66807.1| hypothetical protein GCWU000324_02781 [Kingella oralis ATCC 51147]
          Length = 248

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 116/244 (47%), Positives = 176/244 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V+++N KVR+  D SG++  N K+SMNPFDEIA+EE+++L+E G   EV+ 
Sbjct: 1   MKALVAVKRVVDFNVKVRVNADGSGVDIGNVKMSMNPFDEIAVEEAVRLKEAGKINEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K E+ L+ +LAMGADR I +E++ +LEPL++AK+L++IV KE P +V+ GKQ  
Sbjct: 61  VSLGEKKCEDTLRTALAMGADRAIHVETDASLEPLAVAKLLKKIVDKEQPSLVLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQT QMLAALM  PQ TF S + +  + A+VTR++  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQTAQMLAALMNAPQGTFASKVALSADEAVVTRDIDGGVETVALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LP +++A+KK IEK+   + A+++ PRL V  + E +A + G+++ S  +L+E
Sbjct: 181 NEPRFVKLPALMQAKKKTIEKQSVEELAVNIEPRLHVKHYAEPKARQAGVKVASVAELVE 240

Query: 241 ILKS 244
            L +
Sbjct: 241 KLAA 244


>gi|226943546|ref|YP_002798619.1| electron transfer flavoprotein subunit beta [Azotobacter vinelandii
           DJ]
 gi|226718473|gb|ACO77644.1| Electron transfer flavoprotein beta-subunit [Azotobacter vinelandii
           DJ]
          Length = 256

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 177/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKIL+ +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+E+GIA+E++ 
Sbjct: 8   MKILISLKRVVDYNVKVRVKPDQSGVDLANVKMSMNPFCEIAVEEAVRLKERGIASEIVA 67

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G    +E L+ +LA+GADR IL+E++E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 68  VSVGPAAAQEQLRTALALGADRAILVETDEELGSLAVAKLLKAVVDKEQPQLVITGKQAI 127

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  + Q TF S ++   +   VTRE+  G  T+E  LPA++T DL L
Sbjct: 128 DSDNNQTGQMLAALTGYAQGTFASKVEQAGDKLKVTREIDGGLQTLELSLPAIVTTDLRL 187

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E  K  D  + +   LKVL+ E     + G+++ S  +L+E
Sbjct: 188 NEPRYASLPNIMKAKKKPLETVKPADLGVSVASTLKVLKVEAPAERQAGIKVGSVAELVE 247

Query: 241 ILKSKHDLL 249
            LKS+  ++
Sbjct: 248 KLKSEAKVI 256


>gi|239999979|ref|ZP_04719903.1| EtfB [Neisseria gonorrhoeae 35/02]
 gi|240013073|ref|ZP_04719986.1| EtfB [Neisseria gonorrhoeae DGI18]
 gi|240017642|ref|ZP_04724182.1| EtfB [Neisseria gonorrhoeae FA6140]
 gi|240081878|ref|ZP_04726421.1| EtfB [Neisseria gonorrhoeae FA19]
 gi|240114156|ref|ZP_04728646.1| EtfB [Neisseria gonorrhoeae MS11]
 gi|240116795|ref|ZP_04730857.1| EtfB [Neisseria gonorrhoeae PID18]
 gi|240119022|ref|ZP_04733084.1| EtfB [Neisseria gonorrhoeae PID1]
 gi|240122263|ref|ZP_04735225.1| EtfB [Neisseria gonorrhoeae PID24-1]
 gi|240122440|ref|ZP_04735396.1| EtfB [Neisseria gonorrhoeae PID332]
 gi|240127153|ref|ZP_04739814.1| EtfB [Neisseria gonorrhoeae SK-93-1035]
 gi|254493451|ref|ZP_05106622.1| electron transfer flavoprotein beta-subunit [Neisseria gonorrhoeae
           1291]
 gi|260441587|ref|ZP_05795403.1| EtfB [Neisseria gonorrhoeae DGI2]
 gi|268595786|ref|ZP_06129953.1| electron transfer flavoprotein subunit beta [Neisseria gonorrhoeae
           35/02]
 gi|268597976|ref|ZP_06132143.1| electron transfer flavoprotein subunit beta [Neisseria gonorrhoeae
           FA19]
 gi|268600231|ref|ZP_06134398.1| electron transfer flavoprotein beta-subunit [Neisseria gonorrhoeae
           MS11]
 gi|268602471|ref|ZP_06136638.1| electron transfer flavoprotein beta-subunit [Neisseria gonorrhoeae
           PID18]
 gi|268604738|ref|ZP_06138905.1| electron transfer flavoprotein beta-subunit [Neisseria gonorrhoeae
           PID1]
 gi|268681027|ref|ZP_06147889.1| electron transfer flavoprotein beta-subunit [Neisseria gonorrhoeae
           PID332]
 gi|268685508|ref|ZP_06152370.1| electron transfer flavoprotein beta-subunit [Neisseria gonorrhoeae
           SK-93-1035]
 gi|291044958|ref|ZP_06570667.1| electron transfer flavoprotein subunit beta [Neisseria gonorrhoeae
           DGI2]
 gi|293398029|ref|ZP_06642235.1| electron transfer flavoprotein beta subunit [Neisseria gonorrhoeae
           F62]
 gi|226512491|gb|EEH61836.1| electron transfer flavoprotein beta-subunit [Neisseria gonorrhoeae
           1291]
 gi|268549175|gb|EEZ44593.1| electron transfer flavoprotein subunit beta [Neisseria gonorrhoeae
           35/02]
 gi|268551764|gb|EEZ46783.1| electron transfer flavoprotein subunit beta [Neisseria gonorrhoeae
           FA19]
 gi|268584362|gb|EEZ49038.1| electron transfer flavoprotein beta-subunit [Neisseria gonorrhoeae
           MS11]
 gi|268586602|gb|EEZ51278.1| electron transfer flavoprotein beta-subunit [Neisseria gonorrhoeae
           PID18]
 gi|268588869|gb|EEZ53545.1| electron transfer flavoprotein beta-subunit [Neisseria gonorrhoeae
           PID1]
 gi|268621311|gb|EEZ53711.1| electron transfer flavoprotein beta-subunit [Neisseria gonorrhoeae
           PID332]
 gi|268625792|gb|EEZ58192.1| electron transfer flavoprotein beta-subunit [Neisseria gonorrhoeae
           SK-93-1035]
 gi|291011852|gb|EFE03848.1| electron transfer flavoprotein subunit beta [Neisseria gonorrhoeae
           DGI2]
 gi|291611975|gb|EFF41044.1| electron transfer flavoprotein beta subunit [Neisseria gonorrhoeae
           F62]
 gi|317165275|gb|ADV08816.1| EtfB [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 249

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 174/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR I IE++  LEPL++AK+L+ +  KENP I   GKQ  
Sbjct: 61  VSLGEKKCEETLRTALAMGADRAIHIETDVKLEPLAVAKLLKAVADKENPQIFFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TFVS ++I  +   + RE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFVSKVQIEGDEVQIVREIDGGEETIALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK  + D A D++PRLK ++F E +A + G+++ S  +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLDSADLATDISPRLKTVKFAEPKARQAGVKVASVAELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|310814736|ref|YP_003962700.1| electron transfer flavoprotein, beta subunit [Ketogulonicigenium
           vulgare Y25]
 gi|308753471|gb|ADO41400.1| electron transfer flavoprotein, beta subunit [Ketogulonicigenium
           vulgare Y25]
          Length = 251

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 123/247 (49%), Positives = 172/247 (69%), Gaps = 3/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V+++N KVR++ D +G+E  N K+S+NPFDEIA+EE+L+L+E G+A EV+ 
Sbjct: 1   MKILVPVKRVVDHNVKVRVRPDGTGVELANLKMSINPFDEIAVEEALRLKEAGLAVEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI---ESNETLEPLSIAKILREIVKKENPIIVIAGK 117
           VS+G+   E+VL+ ++ MGADR IL+   E ++  EPL++AK+L+ +V  E   +VIAGK
Sbjct: 61  VSVGTKASEDVLRKAMGMGADRAILVQLPEGSDAPEPLAVAKLLKSVVLSEGARLVIAGK 120

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D++ N TGQMLAAL+ W Q TF S + +  + A +TREV  G  T+  PLPAV+T D
Sbjct: 121 QAIDDDMNATGQMLAALLGWGQGTFASAVAVDGDVATITREVDGGLQTVALPLPAVVTAD 180

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LNEPR+ SLPN++KA+KK IE   A    +DLTPRL VL   E  A   G  + S  +
Sbjct: 181 LRLNEPRFTSLPNMMKAKKKPIEAVDAATLGVDLTPRLSVLETREPAARAAGEIVASVDE 240

Query: 238 LIEILKS 244
           L+  LK+
Sbjct: 241 LVAKLKA 247


>gi|110678707|ref|YP_681714.1| electron transfer flavoprotein, beta subunit [Roseobacter
           denitrificans OCh 114]
 gi|109454823|gb|ABG31028.1| electron transfer flavoprotein, beta subunit [Roseobacter
           denitrificans OCh 114]
          Length = 252

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 127/247 (51%), Positives = 183/247 (74%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEI++E++++L+E G A EV+V
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEISVEQAIRLKEAGQADEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNET----LEPLSIAKILREIVKKENPIIVIAG 116
           VS+G  + +E L+ +LAMGADR IL+ + E     +EPLS+AKIL+ +V++E P +V+ G
Sbjct: 61  VSVGVKQSQETLRTALAMGADRAILVVAAEDVHNDIEPLSVAKILKAVVEEEQPGLVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQMLAAL+ W QATF S I +  + A+VTREV  G  T++  +P VITV
Sbjct: 121 KQAIDNDMNATGQMLAALLGWSQATFASEIGVEGDKAVVTREVDGGLQTIKVNMPTVITV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D++PRL++++ EE      G+++ S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPMDEKTAADYGVDVSPRLEIIKTEEPAERAAGIKVGSVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVSKLK 247


>gi|71083940|ref|YP_266660.1| electron transfer flavoprotein subunit beta [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|71063053|gb|AAZ22056.1| electron transfer flavoprotein beta-chain [Candidatus Pelagibacter
           ubique HTCC1062]
          Length = 249

 Score =  252 bits (643), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 181/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+YN ++R+K D +GI T+N K+S NP D+ A+EE+++++E G ATE++ 
Sbjct: 1   MKILVAVKRVIDYNVQIRVKEDGTGIVTDNVKMSTNPPDDNAIEEAVKIKEAGKATEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG  K +E ++ +LA+GADRGI ++ +  +EPL++AKIL++IV KE P +V  GKQ  
Sbjct: 61  VTIGEEKAQETVRKALAVGADRGIHVKVDGVVEPLAVAKILQKIVDKEKPDLVFMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQML+AL+ WPQATF S I I DN   + RE+  G  T++  +PAV+T DL L
Sbjct: 121 DDDCNQTGQMLSALLNWPQATFASKIDIKDNKLEIIREIDEGLETIKVNVPAVVTCDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I++  A D  +D TPR++ ++ EE    + G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPIDQMTAADLGVDATPRVQQIKVEEPPKRKAGIKVSSVAELVQ 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|319898454|ref|YP_004158547.1| electron transfer flavoprotein beta-subunit [Bartonella
           clarridgeiae 73]
 gi|319402418|emb|CBI75959.1| electron transfer flavoprotein beta-subunit [Bartonella
           clarridgeiae 73]
          Length = 248

 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 175/243 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+V +K V+++N K+R+K+D +G++  N ++SMNPFDEIA+EE+++ +E G  +E+I+
Sbjct: 1   MKIIVAVKRVVDHNIKIRVKSDSTGVDLSNVRMSMNPFDEIAVEEAIRQKEAGKISEIIL 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+  LAMGADR IL++++E LEPL+IAK L+ I+ +E P +V  GKQ  
Sbjct: 61  VSIGPEAAQETLRTGLAMGADRAILVKTDEILEPLTIAKTLKVIILEEKPDMVFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+E NQTGQMLA L+ W QATF S + I +  A +TRE+ +GT T+  PLP V+TVDL L
Sbjct: 121 DDECNQTGQMLAGLLSWGQATFASCLNIENGQAQITREIDNGTQTICLPLPMVMTVDLPL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNIIKA+KK IE+K   +  ++   RL +L  EE +    G+++ + T+LI 
Sbjct: 181 NEPRYTSLPNIIKAKKKPIEQKDIANLCVNTQKRLTILSVEEPKPRAAGIKVANVTELIS 240

Query: 241 ILK 243
            LK
Sbjct: 241 ALK 243


>gi|226943635|ref|YP_002798708.1| electron transfer flavoprotein subunit beta [Azotobacter vinelandii
           DJ]
 gi|226718562|gb|ACO77733.1| Electron transfer flavoprotein beta-subunit [Azotobacter vinelandii
           DJ]
          Length = 249

 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 177/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+E+GIA+E++ 
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKPDQSGVDLANVKMSMNPFCEIAVEEAVRLKERGIASEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G    +E L+ +LA+GADR IL+E++E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSVGPAAAQEQLRTALALGADRAILVETDEELGSLAVAKLLKAVVDKEQPQLVITGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  + Q TF S ++   +   VTRE+  G  T+E  LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALTGYAQGTFASKVEQAGDKLKVTREIDGGLQTLELSLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E  K  D  + +   LKVL+ E     + G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLETVKPADLGVSVASTLKVLKVEAPAERQAGIKVGSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|194099806|ref|YP_002002941.1| EtfB [Neisseria gonorrhoeae NCCP11945]
 gi|240126711|ref|ZP_04739597.1| EtfB [Neisseria gonorrhoeae SK-92-679]
 gi|268685292|ref|ZP_06152154.1| electron transfer flavoprotein beta-subunit [Neisseria gonorrhoeae
           SK-92-679]
 gi|193935096|gb|ACF30920.1| EtfB [Neisseria gonorrhoeae NCCP11945]
 gi|268625576|gb|EEZ57976.1| electron transfer flavoprotein beta-subunit [Neisseria gonorrhoeae
           SK-92-679]
          Length = 249

 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 174/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR I IE++  LEPL++AK+L+ +  KENP I   GKQ  
Sbjct: 61  VSLGEKKCEETLRTALAMGADRAIHIETDVKLEPLAVAKLLKAVADKENPQIFFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TFVS ++I  +   + RE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFVSKVQIEGDEVQIVREIDGGEETIALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK  + D A D++PRLK ++F E +A + G+++ S  +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLDSADLATDISPRLKTVKFAEPKARQTGVKVASVAELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|85709719|ref|ZP_01040784.1| hypothetical protein NAP1_12578 [Erythrobacter sp. NAP1]
 gi|85688429|gb|EAQ28433.1| hypothetical protein NAP1_12578 [Erythrobacter sp. NAP1]
          Length = 248

 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 119/243 (48%), Positives = 170/243 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K VI+YN K R+K D SG++  N K+SMNPFDEIA+EE+++++E G A E++ 
Sbjct: 1   MKILVPVKRVIDYNVKPRVKPDGSGVDLANVKMSMNPFDEIAVEEAIRIKEAGKAEEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K +E L+ +LAMGADR IL+E++E +EPL++AKIL+ I  +E P +V+ GKQ+ 
Sbjct: 61  VSIGPAKAQETLRTALAMGADRAILVETDEEVEPLAVAKILKAIADEEQPGLVLLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
            ++SNQTGQMLAALM  PQ TF + +++  +  IV REV  G  T++   PA++T DL L
Sbjct: 121 SDDSNQTGQMLAALMGRPQGTFANTVEVDGDSVIVKREVDGGLETVKLTTPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++ K   D+ +D+ PRL      E    + G ++     L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPLDTKSPADYGVDIAPRLTTTNVSEPPVRQAGEKVEDVAALVA 240

Query: 241 ILK 243
            +K
Sbjct: 241 KIK 243


>gi|237748701|ref|ZP_04579181.1| electron transfer flavoprotein alpha/beta-subunit [Oxalobacter
           formigenes OXCC13]
 gi|229380063|gb|EEO30154.1| electron transfer flavoprotein alpha/beta-subunit [Oxalobacter
           formigenes OXCC13]
          Length = 249

 Score =  251 bits (642), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 117/222 (52%), Positives = 169/222 (76%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K D SGIE +N K+SMNPFDEIA+EE+++ +E G+A+EV+ 
Sbjct: 1   MKILVPVKRVVDYNAKIRVKPDGSGIEMDNVKMSMNPFDEIAVEEAVRQKESGVASEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  K ++ L+N++A+GADRGIL++++  L+PL++AK+L ++V+KE P +VI GKQ T
Sbjct: 61  VSCGIEKSQDTLRNAMAIGADRGILVKTDAKLQPLAVAKLLVKLVEKEQPDLVILGKQAT 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ WPQAT V  + I +  AIVTRE+  G  T+   LPAVIT DL L
Sbjct: 121 DDDANQTGQMLAALLDWPQATSVFKVAIENGKAIVTREIDDGEETLALELPAVITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEE 222
           NEPRY++LPN++KA+KK I+     +  + +   LK ++  E
Sbjct: 181 NEPRYVTLPNMMKAKKKTIDMTTPDELGVSVESHLKTVKVSE 222


>gi|182678725|ref|YP_001832871.1| electron transfer flavoprotein alpha/beta-subunit [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182634608|gb|ACB95382.1| Electron transfer flavoprotein alpha/beta-subunit [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 249

 Score =  251 bits (642), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 123/243 (50%), Positives = 178/243 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVPIK V++YN K+R+K D+SG+ET N K S NPFDEIA+EE+++L+E GI +E++V
Sbjct: 1   MKVLVPIKRVVDYNVKIRVKADHSGVETANVKYSANPFDEIAVEEAVRLKEAGIVSEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+   ++VL+N+LA+GADR IL++++  ++PL++AK+L+ +  +E+P +VI GKQ  
Sbjct: 61  VSIGAAAAQDVLRNALALGADRAILVQTDHEIQPLAVAKLLKLLCLQESPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQ LAAL+ WPQ TF S + I D  A VTRE+  G   +   LPAV+T DL L
Sbjct: 121 DDDSNQTGQALAALLDWPQGTFASKLVIKDGRAEVTREIDGGLEIISLALPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY+SLPNI+KA+KK +E +    F I++ PRL  +R EE    + G+++     L+ 
Sbjct: 181 NEPRYLSLPNIMKAKKKPLEIRPVASFDINVEPRLITVRVEEPMQRQAGIKVADVATLLN 240

Query: 241 ILK 243
            LK
Sbjct: 241 KLK 243


>gi|167624029|ref|YP_001674323.1| electron transfer flavoprotein subunit alpha/beta [Shewanella
           halifaxensis HAW-EB4]
 gi|167354051|gb|ABZ76664.1| Electron transfer flavoprotein alpha/beta-subunit [Shewanella
           halifaxensis HAW-EB4]
          Length = 249

 Score =  251 bits (642), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 180/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVPIK V+++N KVRIK+D SG++  N K+S+NPFDEIA+EE+++L+E GIATEVI 
Sbjct: 1   MKILVPIKRVVDHNVKVRIKSDGSGVDFNNVKMSINPFDEIAIEEAVRLKEAGIATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G+   +E L+ +LA+GADR I ++++  LEPL++AK L+EIVK+E P +VI GKQ  
Sbjct: 61  VSCGAKVCQETLRTALAVGADRAIQVDTDAELEPLAVAKTLKEIVKREAPQLVICGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQML+AL+ W Q TF S +K+  N   VTRE+  G  T+   LPAV++ DL L
Sbjct: 121 DDDCNQTGQMLSALLGWSQGTFASELKVDGNELAVTREIDGGLETIALGLPAVVSCDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N+PRY SLPNI+KA++K +E  + ++  +++TPR+K +++    +   G+ +    +L+ 
Sbjct: 181 NQPRYASLPNIMKAKRKPLEVIEISELNVNITPRIKAIKYTLPASRSAGVMVDDVAELLS 240

Query: 241 ILKSKHDLL 249
            L+ +  +L
Sbjct: 241 KLREEARVL 249


>gi|90021643|ref|YP_527470.1| ATPase [Saccharophagus degradans 2-40]
 gi|89951243|gb|ABD81258.1| electron transfer flavoprotein beta-subunit [Saccharophagus
           degradans 2-40]
          Length = 249

 Score =  251 bits (642), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 174/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVPIK V++YN KVR   D S ++  N K+SMNPF EIA+EE+++L+E G ATEVIV
Sbjct: 1   MKILVPIKRVVDYNVKVRPNGDGSNVDLANVKMSMNPFCEIAVEEAVRLKEAGKATEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K +E ++ ++A+GADRGILIE++E+LEPL+IAK L+ +V+KE+P +VI GKQ+ 
Sbjct: 61  VSIGPAKAQEQIRAAMAIGADRGILIETDESLEPLAIAKCLKNVVEKESPEMVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAAL  W Q TF S + + D    VTRE+  G  T++  LPAV+T DL L
Sbjct: 121 DGDNNQTGQMLAALCNWGQGTFASEVVLADGKLSVTREIDGGLQTVQLALPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  LP+I+KA+KK +E     D  +D  PR ++L          G+++     LI+
Sbjct: 181 NEPRYAKLPDIMKAKKKPLETIALADLGVDTKPRTQLLGVTPPPERSGGVKVADVDALID 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|59802248|ref|YP_208960.1| EtfB [Neisseria gonorrhoeae FA 1090]
 gi|59719143|gb|AAW90548.1| putative electron transfer flavoprotein beta-subunit [Neisseria
           gonorrhoeae FA 1090]
          Length = 249

 Score =  251 bits (641), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 174/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR I IE++  LEPL++AK+L+ +  KENP I   GKQ  
Sbjct: 61  VSLGEKKCEETLRTALAMGADRAIHIETDVKLEPLAVAKLLKAVADKENPQIFFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TFVS ++I  +   + RE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFVSKVQIEGDEVQIVREIDGGEETIALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK  + D A D++PRLK ++F E +A + G+++ S  +L+E
Sbjct: 181 NEPRFVKLPNIMVAKKKPLEKLDSADLATDISPRLKTVKFAEPKARQAGVKVASVAELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|163733840|ref|ZP_02141282.1| electron transfer flavoprotein, beta subunit [Roseobacter litoralis
           Och 149]
 gi|161392951|gb|EDQ17278.1| electron transfer flavoprotein, beta subunit [Roseobacter litoralis
           Och 149]
          Length = 252

 Score =  251 bits (641), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 182/247 (73%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D SG++  N K+SMNPFDEI++E++++L+E G A EV+V
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEISVEQAIRLKEAGQADEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VS+G  + +E L+ +LAMGADR IL+    + +  +EPLS+AKIL+ +V +E P +V+ G
Sbjct: 61  VSVGVKQSQETLRTALAMGADRAILVIAADDVHNDIEPLSVAKILKAVVDEEKPGLVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQMLAAL+ W QATF S + +  + AIVTREV  G  T++  +P VITV
Sbjct: 121 KQAIDNDMNATGQMLAALLGWSQATFASEVAVEGDKAIVTREVDGGLQTIKVNMPTVITV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K A D+ +D++PRL++++ EE      G+++ S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPMDEKTAADYGVDVSPRLEIIKTEEPAERAAGIKVGSVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVSKLK 247


>gi|329888329|ref|ZP_08266927.1| electron transfer flavoprotein subunit beta [Brevundimonas diminuta
           ATCC 11568]
 gi|328846885|gb|EGF96447.1| electron transfer flavoprotein subunit beta [Brevundimonas diminuta
           ATCC 11568]
          Length = 248

 Score =  251 bits (641), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 118/243 (48%), Positives = 168/243 (69%), Gaps = 6/243 (2%)

Query: 7   IKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLRE------KGIATEVIV 60
           +K VI+ N K R+K D +G++  N K+SMNPFDEIA+EE+++L+E       G ATE++V
Sbjct: 1   MKRVIDSNVKARVKADQTGVDLANVKMSMNPFDEIAVEEAVRLKEGKEHHAAGTATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+ + +E ++ +LAMGADRG+L++S+  LEPL++AK+L+ +V +E P +V+ GKQ+ 
Sbjct: 61  VSIGATQAQETIRTALAMGADRGVLVQSDADLEPLAVAKLLKAVVDEEKPDLVLMGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++N  GQMLAAL+ WPQATF   + I D  A+VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DGDNNAVGQMLAALLDWPQATFAGKLAIEDGKAVVTREVDGGLQTVAATLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PRY SLPNI+KA+KK I  K   D+ +D   RLKVL+  E      G+++    +L+ 
Sbjct: 181 NTPRYASLPNIMKAKKKEIAVKAVADYGVDTADRLKVLKVTEPPKRSAGVKVADAAELVS 240

Query: 241 ILK 243
            LK
Sbjct: 241 KLK 243


>gi|170735354|ref|YP_001774468.1| electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           cenocepacia MC0-3]
 gi|169821392|gb|ACA95973.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           cenocepacia MC0-3]
          Length = 249

 Score =  251 bits (640), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 172/245 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+YN K R+K D SG++  N K++MNPFDEIA+EE+++L+E GIA+EV+V
Sbjct: 1   MKILVAVKRVIDYNVKPRVKADGSGVDLANVKMAMNPFDEIAVEEAVRLKEAGIASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G+ + ++VL+ +LAMGADR +L+ES   L+PL++AK+L  +  +ENP +V+ GKQ  
Sbjct: 61  VSAGTAQSQDVLRTALAMGADRAVLVESEAELQPLAVAKLLCAVAARENPQLVLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           DN++ QTGQ LAAL+ WPQATF    ++     +VTRE+  G   +   LPAV+T DL L
Sbjct: 121 DNDAGQTGQKLAALLDWPQATFAFKTEVDGQQLLVTREIDGGLERVALDLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PRY++LPNI+KA+KK +E        +D+ PRLKVL   E  A + G+ +     LI+
Sbjct: 181 NSPRYVTLPNIMKAKKKPLETLSPEALNVDVAPRLKVLEVTEPPARKGGVMVPDVAALID 240

Query: 241 ILKSK 245
            L+++
Sbjct: 241 KLRNE 245


>gi|58039335|ref|YP_191299.1| electron transfer flavoprotein subunit beta [Gluconobacter oxydans
           621H]
 gi|58001749|gb|AAW60643.1| Electron transfer flavoprotein beta-subunit [Gluconobacter oxydans
           621H]
          Length = 249

 Score =  251 bits (640), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+  D SG+ET+  K+SMNPFDEIA+EE+++LREKG A EV+ 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVAADGSGVETQGVKMSMNPFDEIAVEEAVRLREKGAAKEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG+   ++VL+ ++AMGADR IL+ +++TLEP ++A +L+ I  +E   ++  GKQ  
Sbjct: 61  VTIGAQAAQDVLRMAMAMGADRAILVRTDDTLEPRAVANVLKAIATREEAGLICMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ N TGQ+LAA + WPQ TF S + + D    V RE+  GT  +   LPAVIT DL L
Sbjct: 121 DDDMNATGQILAAKLGWPQGTFASAVTVADGRVEVAREIDGGTEVVSLTLPAVITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KARKK +E  +     ID   RL V+   E    ++G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKARKKPLETIEIDSLGIDTASRLTVVSVAEPSERKEGVKVNSAAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKTEAKVI 249


>gi|261379627|ref|ZP_05984200.1| electron transfer flavoprotein, beta subunit [Neisseria subflava
           NJ9703]
 gi|284798111|gb|EFC53458.1| electron transfer flavoprotein, beta subunit [Neisseria subflava
           NJ9703]
          Length = 249

 Score =  251 bits (640), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 174/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR + +E++  LE L++AK+L+ +  KENP I++ GKQ  
Sbjct: 61  VSLGEKKCEETLRTALAMGADRAVHVETDAKLESLAVAKLLKAVADKENPQILLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TF S ++I    A+VTRE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFASKVQIEGEEALVTREIDGGEETVALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D A+D++PRL  ++F E +A + G+++    +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLSPADLAVDISPRLNTVKFAEPKARQAGVKVADVAELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|222102071|ref|YP_002546661.1| electron transfer flavoprotein beta-subunit beta-etf flavoprotein
           small subunit [Agrobacterium radiobacter K84]
 gi|221728188|gb|ACM31197.1| electron transfer flavoprotein beta-subunit beta-etf flavoprotein
           small subunit [Agrobacterium radiobacter K84]
          Length = 273

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 181/243 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN K+R+K D +G++  N K+SMNPFDEIA+E +L+L+E G A+EV+ 
Sbjct: 25  MKILVPVKRVVDYNVKIRVKPDGTGVDLANVKMSMNPFDEIAVEGALRLKEAGKASEVVA 84

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K E+ L+ +LAMG DRG+L+E++ET+EPL++AK+L+ + ++E   ++I GKQ  
Sbjct: 85  VSVGPSKAEDTLRTALAMGVDRGLLVETDETVEPLTVAKLLKAVAQQEAFDLIILGKQAI 144

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQML+AL+ W QATF S I I D    VTREV  G  T++  LPAVIT DL L
Sbjct: 145 DDDSNQTGQMLSALLGWSQATFASKIVIGDGSITVTREVDGGLQTIDVILPAVITTDLRL 204

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   +  +++  R++VL+ EE    + G+++ S  +L++
Sbjct: 205 NEPRYASLPNIMKAKKKPLDKKTPAELGVEVVQRVRVLKTEEPAGRKAGVKVTSVAELVD 264

Query: 241 ILK 243
            LK
Sbjct: 265 KLK 267


>gi|293604874|ref|ZP_06687271.1| electron transfer flavoprotein beta subunit [Achromobacter
           piechaudii ATCC 43553]
 gi|292816702|gb|EFF75786.1| electron transfer flavoprotein beta subunit [Achromobacter
           piechaudii ATCC 43553]
          Length = 249

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 175/249 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+L  +K V++YN KVR+K D SG++  N K+SMNPFDEIA+E +++L+E+G+AT+V+ 
Sbjct: 1   MKVLTAVKRVVDYNVKVRVKADQSGVDIGNVKMSMNPFDEIAVEAAVRLKEQGVATDVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADRG+L++++  L+PL++AK+LR +V+ E P +VI GKQ  
Sbjct: 61  VSCGPAQSQETLRTALAIGADRGVLVQADAALQPLAVAKLLRAVVQTEQPALVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++ QTGQMLAAL+ W QAT  S I+I    A VTREV  G   +   LPA+IT DL L
Sbjct: 121 DDDACQTGQMLAALLGWSQATNASAIEIDGGTARVTREVDGGLEVLALTLPAIITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++   A    +D   RL+ L  +E  A   G+++     L++
Sbjct: 181 NEPRYVTLPNIMKAKKKPLDVVTAESLGVDPASRLQTLSVQEPEARAPGIKVADVATLVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|85375528|ref|YP_459590.1| hypothetical protein ELI_13505 [Erythrobacter litoralis HTCC2594]
 gi|84788611|gb|ABC64793.1| hypothetical protein ELI_13505 [Erythrobacter litoralis HTCC2594]
          Length = 248

 Score =  250 bits (638), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 119/244 (48%), Positives = 171/244 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K VI+YN K R+K D SG++  N K+SMNPFDEIA+EE+++++E G A E++ 
Sbjct: 1   MKILVPVKRVIDYNVKPRVKADGSGVDLANVKMSMNPFDEIAVEEAIRIKEAGKAEEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K +E L+ +LAMGADR IL+E+++ +EPL++AKIL+ I ++E P IV+ GKQ+ 
Sbjct: 61  VSIGPAKAQETLRTALAMGADRAILVETDDEVEPLAVAKILKAIAEEEQPGIVMLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
            ++SNQTGQMLAAL   PQ TF + +++  +   V REV  G  T++  LPA+IT DL L
Sbjct: 121 SDDSNQTGQMLAALTGRPQGTFANTVEVDGDSVTVKREVDGGLETVKLTLPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++ K   D+ +D+ PRL      E    + G ++     L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPLDTKSPADYGVDIAPRLTTTNVAEPPVRQAGEKVEDVDALVA 240

Query: 241 ILKS 244
            +K+
Sbjct: 241 KIKA 244


>gi|71281245|ref|YP_270355.1| electron transfer flavoprotein subunit beta [Colwellia
           psychrerythraea 34H]
 gi|71146985|gb|AAZ27458.1| electron transfer flavoprotein, beta subunit [Colwellia
           psychrerythraea 34H]
          Length = 250

 Score =  250 bits (638), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 182/249 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVPIK VI+YN KVR+K D S ++  NTK+++NPF EIA+EE+++L+E GIATEVI 
Sbjct: 1   MKVLVPIKRVIDYNVKVRVKPDQSNVDLANTKMAINPFCEIAVEEAVRLKEAGIATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           +S+G+   +E L+ +LA+GADR I I+++E+L+ L+IAK+L+++V++E P ++I GKQ+ 
Sbjct: 61  ISVGNKSCQEQLRTALALGADRAIQIDTDESLDALNIAKLLQKVVEEEQPQLIILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQ TF S +K+      VTREV  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALTGMPQGTFASVVKVEGEKVNVTREVDGGLQTVALNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K +  K A DF IDLT R K+L+       + G+ + S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKRKPLAVKPAADFGIDLTARTKLLKVTPPAQRQAGIVVESIDELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|313669311|ref|YP_004049595.1| electron transfer flavoprotein beta-subunit [Neisseria lactamica
           ST-640]
 gi|313006773|emb|CBN88243.1| electron transfer flavoprotein beta-subunit [Neisseria lactamica
           020-06]
          Length = 249

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR I +E++  LEPL++AK+L+ I  KENP I   GKQ  
Sbjct: 61  VSLGGKKCEETLRTALAMGADRAIHVETDAKLEPLAVAKLLKAIADKENPQIFFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TF S ++I  N   + RE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFASKVQIEGNEVQIVREIDGGEETIALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D   D++PRLK ++F E +A + G+++ S  +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLTPADLVTDISPRLKTVKFAEPKARQAGVKVASVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|320324882|gb|EFW80954.1| electron transfer flavoprotein, beta subunit [Pseudomonas syringae
           pv. glycinea str. B076]
          Length = 249

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 174/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    +E L+ +LA+GADR +L+ES E L PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VTIGPTTAQEQLRTALALGADRAVLVESAEELTPLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  +PQ TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALSGYPQGTFASKVEVSGDKVAVTREIDGGLQTVSLSLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEMLTPDALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|88810409|ref|ZP_01125666.1| probable electron transfer flavoprotein, beta subunit [Nitrococcus
           mobilis Nb-231]
 gi|88792039|gb|EAR23149.1| probable electron transfer flavoprotein, beta subunit [Nitrococcus
           mobilis Nb-231]
          Length = 249

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 171/249 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K VI+YN +VR+K D SG+ET N K+SMNPFDE+A+EE+++L+E G    ++ 
Sbjct: 1   MKILVPVKRVIDYNVRVRVKADGSGVETANVKMSMNPFDELAVEEAIRLKEAGRVEAIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+    E L+ +LAMGADR +L+ +   L+PL +AK+L+ +V +E P +VI GKQ  
Sbjct: 61  VSIGAPACRETLRTALAMGADRALLVTTESELQPLDVAKVLKAVVGQEAPELVIMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL+ W Q TF   + + ++   VTRE+  G  T+   LPAV+T DL L
Sbjct: 121 DDDCNQTGQMLAALLGWGQGTFACGVALAEDSVTVTREIDGGNQTVRLKLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRYI LPNI+KA++K ++     +  +++  RLK L+  E    R G+++ S  +L++
Sbjct: 181 NEPRYIKLPNIMKAKQKPLQSMTVQELGVEVAARLKTLQVSEPPPRRSGVKVSSVAELVD 240

Query: 241 ILKSKHDLL 249
            L ++  +L
Sbjct: 241 KLHNEAKVL 249


>gi|332967855|gb|EGK06951.1| electron transfer flavoprotein beta subunit [Kingella kingae ATCC
           23330]
          Length = 248

 Score =  249 bits (636), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 115/244 (47%), Positives = 173/244 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V+++N KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDFNVKVRVKADGSGVDIGNVKMSMNPFDEIAVEEAVRLKEAGKISEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K E+VL+ +LAMGADR I +E++  LEPL++AK+L+++   E P IV+ GKQ  
Sbjct: 61  VSLGEKKCEDVLRTALAMGADRAIHVETDAVLEPLTVAKLLKKVADNEQPQIVLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQT QMLAALM  PQATF S + +  +   VTRE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQTAQMLAALMNAPQATFASKVDLSADEVAVTREIDGGLETIALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LP ++ A+KK +EK+      +DLT R+ V +F E +A + G+++ +  +L+E
Sbjct: 181 NEPRFVKLPALMAAKKKSLEKQSPESLGVDLTARVSVKQFAEPKARQAGVKVVNVAELVE 240

Query: 241 ILKS 244
            L +
Sbjct: 241 KLAA 244


>gi|83855006|ref|ZP_00948536.1| electron transfer flavoprotein, beta subunit [Sulfitobacter sp.
           NAS-14.1]
 gi|83842849|gb|EAP82016.1| electron transfer flavoprotein, beta subunit [Sulfitobacter sp.
           NAS-14.1]
          Length = 252

 Score =  249 bits (636), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/247 (47%), Positives = 179/247 (72%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D +G++  N K+SMNPFDEI++E++++++E G   EV+V
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGTGVDLANVKMSMNPFDEISVEQAIRMKEAGQVEEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR ILI    + +  +EPL++AKIL+ +V++E P +V+ G
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILIVAADDVHNDIEPLTVAKILKGVVEEEKPDLVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W QATF S + I  + A+VTREV  G  T++  +P V+TV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQATFASKVDIDGDSAVVTREVDGGLQTIKVSMPTVVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K   D+ ++++ RL++++  E      G+++ S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTPADYGVEVSNRLEIIKTAEPAERAAGVKVESVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVAKLK 247


>gi|83941529|ref|ZP_00953991.1| electron transfer flavoprotein, beta subunit [Sulfitobacter sp.
           EE-36]
 gi|83847349|gb|EAP85224.1| electron transfer flavoprotein, beta subunit [Sulfitobacter sp.
           EE-36]
          Length = 252

 Score =  249 bits (636), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/247 (47%), Positives = 179/247 (72%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D +G++  N K+SMNPFDEI++E++++++E G   EV+V
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGTGVDLANVKMSMNPFDEISVEQAIRMKEAGQVEEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR ILI    + +  +EPL++AKIL+ +V++E P +V+ G
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILIVAADDVHNDIEPLTVAKILKGVVEEEKPDLVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W QATF S + I  + A+VTREV  G  T++  +P V+TV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQATFASKVDIDGDSAVVTREVDGGLQTIKVSMPTVVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K   D+ ++++ RL++++  E      G+++ S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPLDEKTPADYGVEVSNRLEIIKTAEPAERAAGIKVESVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVAKLK 247


>gi|254488621|ref|ZP_05101826.1| electron transfer flavoprotein, beta subunit [Roseobacter sp.
           GAI101]
 gi|214045490|gb|EEB86128.1| electron transfer flavoprotein, beta subunit [Roseobacter sp.
           GAI101]
          Length = 252

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 179/247 (72%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D +G++  N K+SMNPFDEI++E++++L+E G   E++V
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKADGTGVDLANVKMSMNPFDEISVEQAIRLKEAGQVDEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + +  +EPL++AKIL+ IV +E P +V+ G
Sbjct: 61  VSIGVKQSQETLRTALAMGADRAILVVAADDVHNDIEPLTVAKILKAIVDEEQPGLVLCG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQML+AL+ W QATF S ++I  + A+VTREV  G  T++  +P+V+TV
Sbjct: 121 KQAIDNDMNATGQMLSALLGWSQATFASKVEIDGDSAVVTREVDGGLQTIKVSMPSVVTV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK +++K   D+ +++  RL++L+  E      G+++ S  
Sbjct: 181 DLRLNEPRYASLPNIMKAKKKPMDEKTPADYGVEIGNRLEILKTVEPAERAAGIKVDSVD 240

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 241 ELVAKLK 247


>gi|308390235|gb|ADO32555.1| electron transfer flavoprotein beta-subunit [Neisseria meningitidis
           alpha710]
 gi|325135377|gb|EGC57998.1| electron transfer flavoprotein, beta subunit [Neisseria
           meningitidis M0579]
 gi|325203128|gb|ADY98582.1| electron transfer flavoprotein, beta subunit [Neisseria
           meningitidis M01-240149]
 gi|325208997|gb|ADZ04449.1| electron transfer flavoprotein, beta subunit [Neisseria
           meningitidis NZ-05/33]
          Length = 249

 Score =  249 bits (635), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 170/244 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR I +E++  LEPL++AK+L+ +  KENP I   GKQ  
Sbjct: 61  VSLGEKKCEETLRTALAMGADRAIHVETDAKLEPLAVAKLLKAVADKENPQIFFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TF S ++I  +   + RE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFASKVQIEGDEVQIVREIDGGEETIALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D A D+ PRLK ++F E +A + G+++ S  +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLAPADLATDILPRLKTVKFAEPKARQAGVKVASVAELVE 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKN 244


>gi|296162115|ref|ZP_06844912.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           Ch1-1]
 gi|295887621|gb|EFG67442.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           Ch1-1]
          Length = 249

 Score =  249 bits (635), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 175/249 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V+++N KVR+K+D SG+E  N K+S+NPFDEIA+EE+++LREKG+ +EVI 
Sbjct: 1   MKVLVAVKRVVDFNVKVRVKSDGSGVELSNVKMSINPFDEIAVEEAVRLREKGVVSEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G+   +E L+ ++A+GADRGIL+E++  L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSCGTNASQETLRTAMAIGADRGILVETDAQLQPLAVAKLLKVLVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           DN+ NQTGQMLAAL  + QATF S +++ ++   VTRE+  G  T+   LPAV+T DL L
Sbjct: 121 DNDCNQTGQMLAALAGFAQATFASRVELSNDCVTVTREIDGGLETLRLKLPAVVTSDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +LPNI+KA+KK ++        +D+ PRL  L   E      G+++     L+ 
Sbjct: 181 NEPRYATLPNIMKAKKKPLDVVTPEQLGVDVAPRLTALSTTEPAGRSAGVKVPDVAALVA 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|261401547|ref|ZP_05987672.1| electron transfer flavoprotein, beta subunit [Neisseria lactamica
           ATCC 23970]
 gi|269208384|gb|EEZ74839.1| electron transfer flavoprotein, beta subunit [Neisseria lactamica
           ATCC 23970]
          Length = 249

 Score =  248 bits (634), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR I +E++  LEPL++AK+L+ +  KENP I   GKQ  
Sbjct: 61  VSLGGKKCEETLRTALAMGADRAIHVETDAKLEPLAVAKLLKAVADKENPQIFFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TF S ++I  +   + RE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFASKVQIESDEVQIVREIDGGEETIALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D   D++PRLK ++F E +A + G+++ S  +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLTPADLVTDISPRLKTVKFAEPKARQAGVKVASVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|309379831|emb|CBX21607.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 249

 Score =  248 bits (634), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKTDGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR I +E++  LEPL++AK+L+ +  KENP I   GKQ  
Sbjct: 61  VSLGGKKCEETLRTALAMGADRAIHVETDAKLEPLAVAKLLKAVADKENPQIFFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TF S ++I  +   + RE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFASKVQIESDEVQIVREIDGGEETIALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D   D++PRLK ++F E +A + G+++ S  +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLTPADLVTDISPRLKTVKFAEPKARQAGVKVASVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|330899169|gb|EGH30588.1| electron transfer flavoprotein subunit beta [Pseudomonas syringae
           pv. japonica str. M301072PT]
          Length = 249

 Score =  248 bits (634), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 174/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    +E L+ +LA+GADR +L+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VTIGPTTAQEQLRTALALGADRAVLVESAEELTSLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  +PQ TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALSGYPQGTFASKVEVTGDKVAVTREIDGGLQTVSLSLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E +      +      K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEVRTPDALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|261365267|ref|ZP_05978150.1| electron transfer flavoprotein, beta subunit [Neisseria mucosa ATCC
           25996]
 gi|288566356|gb|EFC87916.1| electron transfer flavoprotein, beta subunit [Neisseria mucosa ATCC
           25996]
          Length = 249

 Score =  248 bits (634), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR I +E++  LEPL++AK+L+ +  KENP I   GKQ  
Sbjct: 61  VSLGEKKCEETLRTALAMGADRAIHVETDAKLEPLAVAKLLKAVADKENPQIFFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TF S ++I  +   + RE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFASKVQIEGDEVQIVREIDGGEETIALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D   D++PRLK ++F E +A + G+++ S  +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLAPADLVADISPRLKTVKFAEPKARQAGVKVASVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|261378569|ref|ZP_05983142.1| electron transfer flavoprotein, beta subunit [Neisseria cinerea
           ATCC 14685]
 gi|269145123|gb|EEZ71541.1| electron transfer flavoprotein, beta subunit [Neisseria cinerea
           ATCC 14685]
          Length = 249

 Score =  248 bits (633), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR I +E++  LEPL++AK+L+ +  KENP I   GKQ  
Sbjct: 61  VSLGEKKCEETLRTALAMGADRAIHVETDAKLEPLAVAKLLKAVADKENPQIFFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TF S ++I  +   + RE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFASKVQIEGDEVQIVREIDGGEETIALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D   D++PRLK ++F E +A + G+++ S  +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLTPADLVADISPRLKTVKFAEPKARQAGIKVASVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|224824068|ref|ZP_03697176.1| Electron transfer flavoprotein alpha/beta-subunit [Lutiella
           nitroferrum 2002]
 gi|224603487|gb|EEG09662.1| Electron transfer flavoprotein alpha/beta-subunit [Lutiella
           nitroferrum 2002]
          Length = 249

 Score =  248 bits (633), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 175/249 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D +G++  N K+SMNPFDEIA+EE+++L+E G  +EV+ 
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGKVSEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + EE L+ +LAMGADR I +E++  L+PL++AK+L+ + +KE P ++I GKQ  
Sbjct: 61  VSLGVKQCEETLRTALAMGADRAIHVETDAELQPLAVAKLLKAVAEKEQPQLMILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQM+AAL+ W Q TF S + +      VTREV  G  T++  LPAV+T DL L
Sbjct: 121 DDDANQTGQMVAALLGWGQGTFASKVDLAAETVDVTREVDGGLETVKLRLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY+ LPNI+ A+KK ++K       +D+TPRLK L+  E      G+++ +  +L+ 
Sbjct: 181 NEPRYVKLPNIMAAKKKPLDKLTVEALGVDVTPRLKTLKVAEPAKRSAGIKVANAAELVA 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAKVL 249


>gi|255065423|ref|ZP_05317278.1| electron transfer flavoprotein, beta subunit [Neisseria sicca ATCC
           29256]
 gi|255050248|gb|EET45712.1| electron transfer flavoprotein, beta subunit [Neisseria sicca ATCC
           29256]
          Length = 249

 Score =  248 bits (633), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 171/245 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR I +E++  LEPL++AK+L+ +  KENP I   GKQ  
Sbjct: 61  VSLGEKKCEETLRTALAMGADRAIHVETDTKLEPLAVAKLLKAVADKENPQIFFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TF S ++I  +   + RE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFASKVQIEGDEVQIVREIDGGEETLALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D   D++PRLK ++F E +A + G+++ S  +L+E
Sbjct: 181 NEPRFVKLPNIMTAKKKPLEKLTPADLVADISPRLKTVKFAEPKARQAGVKVASVAELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|296313780|ref|ZP_06863721.1| electron transfer flavoprotein, beta subunit [Neisseria
           polysaccharea ATCC 43768]
 gi|296839708|gb|EFH23646.1| electron transfer flavoprotein, beta subunit [Neisseria
           polysaccharea ATCC 43768]
          Length = 249

 Score =  248 bits (632), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR I IE++  LEPL++AK+L+ +  KENP I   GKQ  
Sbjct: 61  VSLGEKKCEETLRTALAMGADRAIHIETDVKLEPLAVAKLLKAVADKENPQIFFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TF S ++I  +   + RE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFASKVQIEGDEVQIVREIDGGEETIALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D   D++PRLK ++F E +A + G+++ S  +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLAPADLVADISPRLKTVKFAEPKARQAGVKVASVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|254786171|ref|YP_003073600.1| electron transfer flavoprotein subunit beta [Teredinibacter
           turnerae T7901]
 gi|237684731|gb|ACR11995.1| electron transfer flavoprotein, beta subunit [Teredinibacter
           turnerae T7901]
          Length = 250

 Score =  247 bits (631), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 177/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+VPIK V++YN KVR  +D S ++  N K+++NPF EIA+EE+++L+E+G A EV+V
Sbjct: 1   MKIMVPIKRVVDYNVKVRPNSDGSDVDLANVKMAINPFCEIAVEEAIRLKERGKADEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V IG  K +E L+ ++A+GADR IL+E++ +LEPL+IAKIL++I  +E+P +VI GKQ+ 
Sbjct: 61  VCIGPSKAQEQLRAAMALGADRAILVETDLSLEPLAIAKILQKIYDQESPGLVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAAL   PQ TF S +   ++   VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DGDNNQTGQMLAALCGLPQGTFASEVTFNESSIYVTREVDGGLETLELQLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +LPNI+KA+KK +E   A    +DLTPR K+L          G+++ S  +LIE
Sbjct: 181 NEPRYAALPNIMKAKKKPLETLAADSIGVDLTPRTKLLSVSTPPERAAGIKVASVDELIE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|325129265|gb|EGC52104.1| electron transfer flavoprotein, beta subunit [Neisseria
           meningitidis OX99.30304]
          Length = 249

 Score =  247 bits (631), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR I +E++  LEPL++AK+L+ +  KENP I   GKQ  
Sbjct: 61  VSLGEKKCEETLRTALAMGADRAIHVETDAKLEPLAVAKLLKAVADKENPQIFFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQ  QMLAAL+   Q TF S ++I  +   + RE+  G  T+   LPAVI+ DL L
Sbjct: 121 DYDANQVAQMLAALLNAAQGTFASKVQIEGDEVQIVREIDGGEETIALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D A D+ PRLK ++F E +A + G+++ S  +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLAPADLATDILPRLKTVKFAEPKARQAGVKVASVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|329890915|ref|ZP_08269258.1| electron transfer flavoprotein subunit beta [Brevundimonas diminuta
           ATCC 11568]
 gi|328846216|gb|EGF95780.1| electron transfer flavoprotein subunit beta [Brevundimonas diminuta
           ATCC 11568]
          Length = 248

 Score =  247 bits (630), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 167/243 (68%), Gaps = 6/243 (2%)

Query: 7   IKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLRE------KGIATEVIV 60
           +K VI+ N K R+K D +G++  N K+SMNPFDEIA+EE+++L+E       G ATE++V
Sbjct: 1   MKRVIDSNVKARVKADQTGVDLANVKMSMNPFDEIAVEEAVRLKEGKEHHAAGTATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E ++ +LAMGADRG+L++S+  LEPL++AK+L+ +V +E P +V+ GKQ+ 
Sbjct: 61  VSIGVTQAQETIRTALAMGADRGVLVQSDTDLEPLAVAKVLKAVVDEEKPDLVLLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++N  GQMLAAL+ WPQATF   + I    A+VTREV  G  T+   LPAV++VDL L
Sbjct: 121 DGDNNAVGQMLAALLDWPQATFAGKLAIEGGKAVVTREVDGGLQTVSAELPAVVSVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PRY SLPNI+KA+KK I  K   D+ +D   RLKVL+  E      G+++    +L+ 
Sbjct: 181 NTPRYASLPNIMKAKKKEIAMKAVADYGVDTADRLKVLKVTEPPKRSAGVKVADAAELVS 240

Query: 241 ILK 243
            LK
Sbjct: 241 KLK 243


>gi|167645012|ref|YP_001682675.1| electron transfer flavoprotein alpha/beta-subunit [Caulobacter sp.
           K31]
 gi|167347442|gb|ABZ70177.1| Electron transfer flavoprotein alpha/beta-subunit [Caulobacter sp.
           K31]
          Length = 248

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 119/243 (48%), Positives = 174/243 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN KVR+K D +G++  N K+SMNPF EIA+EE+++L+EKG+ATEV++
Sbjct: 1   MKVLVPVKRVIDYNVKVRVKPDQTGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEVVI 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E ++ +LAMG DRG+LI ++   EPL++AK+L  +  +E P +++ GKQ  
Sbjct: 61  VSIGPQQAQETIRTALAMGGDRGVLIVTDADPEPLAVAKLLAAVAAEEKPDLILMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++N  GQML+AL+ WPQAT+ S ++I  + A VTREV  G   ++  LPA+IT DL L
Sbjct: 121 DGDNNAVGQMLSALLGWPQATYASAVEISGSTAKVTREVDGGLQVLDVDLPAIITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK I  K   D+ +D+ PRLKV++  E      G+++ +   L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKEIASKTVADYGVDIAPRLKVVKVAEPAKRSAGIKVETAADLVA 240

Query: 241 ILK 243
            LK
Sbjct: 241 KLK 243


>gi|167836524|ref|ZP_02463407.1| electron transfer flavoprotein beta-subunit [Burkholderia
           thailandensis MSMB43]
          Length = 249

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 174/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D + ++  N K+SMNPFDEI +EE ++L+E G A+EVI 
Sbjct: 1   MKVLVGVKRVVDYNVKVRVKADGTDVDISNVKMSMNPFDEIGVEEGVRLKESGAASEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR I I ++E L+PL++AK+L  IV++E P +VI GKQ  
Sbjct: 61  VSCGPTQCQETLRTALAIGADRAIHIRTDEELQPLAVAKLLAAIVEEERPGLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + +  + AIV REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALAGMPQATFASKVTVDCDIAIVAREVDGGAETLSLKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +   + ++  +D+  RLK ++  E  A   G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLATIEPSELRVDVRARLKTIKVSEPTARGAGVKVPDVRTLVE 240

Query: 241 ILKSKHDLL 249
            LKS+  +L
Sbjct: 241 KLKSEAKVL 249


>gi|213968198|ref|ZP_03396343.1| electron transfer flavoprotein, beta subunit [Pseudomonas syringae
           pv. tomato T1]
 gi|301383797|ref|ZP_07232215.1| electron transfer flavoprotein, beta subunit [Pseudomonas syringae
           pv. tomato Max13]
 gi|302060761|ref|ZP_07252302.1| electron transfer flavoprotein, beta subunit [Pseudomonas syringae
           pv. tomato K40]
 gi|302131860|ref|ZP_07257850.1| electron transfer flavoprotein, beta subunit [Pseudomonas syringae
           pv. tomato NCPPB 1108]
 gi|302187434|ref|ZP_07264107.1| electron transfer flavoprotein, beta subunit [Pseudomonas syringae
           pv. syringae 642]
 gi|213927178|gb|EEB60728.1| electron transfer flavoprotein, beta subunit [Pseudomonas syringae
           pv. tomato T1]
          Length = 249

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    +E L+ +LA+GADR +L+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VTIGPTTAQEQLRTALALGADRAVLVESAEELTSLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  +PQ TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALSGYPQGTFASKVEVAGDKVAVTREIDGGLQTVSLSLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEVLTPDALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|170699540|ref|ZP_02890581.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           ambifaria IOP40-10]
 gi|170135558|gb|EDT03845.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           ambifaria IOP40-10]
          Length = 249

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 175/249 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++ N KV +K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ TEV+ 
Sbjct: 1   MKALVAVKRVVDANVKVGVKSDRTGVDIANVKMSMNPFDEIAVEEAVRLKESGVVTEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+ES +++EPL++AKIL+ +V KE P +VI GKQ  
Sbjct: 61  VSVGVAQAQETLRTALAIGADRAILVESTDSVEPLAVAKILKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + I D    V REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVTIADGRVTVAREVDGGAETLSLQLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+ PR K L+  E      G+++     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLETVKPEDLGVDVAPRQKTLKVVEPPKRAAGVKVPDVKTLVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|330973481|gb|EGH73547.1| electron transfer flavoprotein subunit beta [Pseudomonas syringae
           pv. aceris str. M302273PT]
          Length = 249

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    +E L+ +LA+GADR +L+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VTIGPTTAQEQLRTALALGADRAVLVESAEELTSLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  +PQ TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALSGYPQGTFASRVEVTGDKVAVTREIDGGLQTVSLSLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEVLTPDALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|289679922|ref|ZP_06500812.1| electron transfer flavoprotein, beta subunit [Pseudomonas syringae
           pv. syringae FF5]
 gi|330980716|gb|EGH78819.1| electron transfer flavoprotein subunit beta [Pseudomonas syringae
           pv. aptata str. DSM 50252]
          Length = 249

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    +E L+ +LA+GADR +L+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VTIGPTTAQEQLRTALALGADRAVLVESAEELTSLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  +PQ TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALSGYPQGTFASKVEVTGDKVAVTREIDGGLQTVSLSLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEVLTPDALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|257485490|ref|ZP_05639531.1| electron transfer flavoprotein, beta subunit [Pseudomonas syringae
           pv. tabaci ATCC 11528]
 gi|298486504|ref|ZP_07004564.1| Electron transfer flavoprotein, beta subunit [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|298158981|gb|EFI00042.1| Electron transfer flavoprotein, beta subunit [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|331010670|gb|EGH90726.1| electron transfer flavoprotein, subunit beta [Pseudomonas syringae
           pv. tabaci ATCC 11528]
          Length = 249

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    +E L+ +LA+GADR +L+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VTIGPTTAQEQLRTALALGADRAVLVESTEELTSLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  +PQ TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALSGYPQGTFASKVEVSGDKVAVTREIDGGLQTVSLSLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEVLTPDALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|330951668|gb|EGH51928.1| electron transfer flavoprotein subunit beta [Pseudomonas syringae
           Cit 7]
          Length = 249

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    +E L+ +LA+GADR +L+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VTIGPTTAQEQLRTALALGADRAVLVESAEELTSLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  +PQ TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALSGYPQGTFASKVEVTGDKVAVTREIDGGLQTVSLSLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEVLTPEALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|320329247|gb|EFW85244.1| electron transfer flavoprotein, beta subunit [Pseudomonas syringae
           pv. glycinea str. race 4]
 gi|330880856|gb|EGH15005.1| electron transfer flavoprotein, subunit beta [Pseudomonas syringae
           pv. glycinea str. race 4]
          Length = 249

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    +E L+ +LA+GADR +L+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VTIGPTTAQEQLRTALALGADRAVLVESAEELTSLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  +PQ TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALSGYPQGTFASKVEVSGDKVAVTREIDGGLQTVSLSLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEMLTPDALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|28869387|ref|NP_792006.1| electron transfer flavoprotein subunit beta [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|28852628|gb|AAO55701.1| electron transfer flavoprotein, beta subunit [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|331018612|gb|EGH98668.1| electron transfer flavoprotein, beta subunit [Pseudomonas syringae
           pv. lachrymans str. M302278PT]
          Length = 249

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    +E L+ +LA+GADR +L+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VTIGPTTAQEQLRTALALGADRAVLVESAEELTSLAVAKLLKAVVDKEQPHLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  +PQ TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALSGYPQGTFASKVEVTGDKVAVTREIDGGLQTVSLSLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEVLTPDALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|224823855|ref|ZP_03696964.1| Electron transfer flavoprotein alpha/beta-subunit [Lutiella
           nitroferrum 2002]
 gi|224604310|gb|EEG10484.1| Electron transfer flavoprotein alpha/beta-subunit [Lutiella
           nitroferrum 2002]
          Length = 249

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 174/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +EV+ 
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADGSDVDIANVKMSMNPFDEIAVEEAVRLKEAGKVSEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + EE L+ +LAMGADR I +E++  L+PL++AK+L+ + +KE P ++I GKQ  
Sbjct: 61  VSLGVKQCEETLRTALAMGADRAIHVETDAELQPLAVAKLLKAVAEKEQPQLMILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQM+AAL+ W Q TF S + +      VTREV  G  T++  LPAV+T DL L
Sbjct: 121 DDDANQTGQMVAALLGWGQGTFASKVDLAAETVDVTREVDGGLETVKLRLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY+ LPNI+ A+KK ++K       +D+TPRLK L+  E      G+++ +  +L+ 
Sbjct: 181 NEPRYVKLPNIMAAKKKPLDKLTVEALGVDVTPRLKTLKVAEPAKRSAGIKVANAAELVA 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAKVL 249


>gi|307728020|ref|YP_003911233.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           CCGE1003]
 gi|307588545|gb|ADN61942.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           CCGE1003]
          Length = 249

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 168/245 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+   +K V++YN KVR++ D SG+ET N K+SMNPFDEIA+E + +L+E G A++VI 
Sbjct: 1   MKVFAAVKRVVDYNVKVRVRADQSGVETGNVKMSMNPFDEIAVEAATRLKEAGKASDVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+ G  +  E L  +LA+GADR + I+ +  L+PL++AK+L+  V +E P +VI GKQ  
Sbjct: 61  VTCGPAQSVETLHTALAIGADRALHIQIDAELQPLAVAKLLKAAVDREQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++ QTGQ+LAAL+ WPQATF S I+I  + A VTREV  G   +E  LPA++T DL L
Sbjct: 121 DDDAGQTGQLLAALLDWPQATFASAIEIDGDKATVTREVDGGLEVIELQLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++     D A+D   RLK L+  E  A + G R+     LI 
Sbjct: 181 NEPRYVTLPNIMKAKKKAVDTLSPADLAVDPASRLKTLKVVEPAARKAGERVADVATLIN 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|332993298|gb|AEF03353.1| electron transfer flavoprotein subunit beta [Alteromonas sp. SN2]
          Length = 250

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 177/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K  I+YN KVR+K D SG++  N K+++NPF EIA+EE+++L+EKGIATE++V
Sbjct: 1   MKILVPVKRAIDYNVKVRVKADNSGVDLTNAKMAINPFCEIAVEEAVRLKEKGIATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E ++ +LA+GADRGI I++++ L+ L +AK+L ++V++E P +V+ GKQ+ 
Sbjct: 61  VSIGDKSCQEQIRTALALGADRGIQIDTDQNLDSLQVAKLLAKVVEEEQPQLVVLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQ TF S + +      VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DSDNNQTGQMLAALTGMPQGTFASEVAVDGTSVNVTREVDGGLQTVALTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K ++ K A DF + L   +K+L+         G+++    +L+E
Sbjct: 181 NEPRYASLPNIMKAKRKPLDVKSAADFGVALESNVKILKVTPPPQREGGVKVADVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|289624415|ref|ZP_06457369.1| electron transfer flavoprotein, beta subunit [Pseudomonas syringae
           pv. aesculi str. NCPPB3681]
 gi|289646671|ref|ZP_06478014.1| electron transfer flavoprotein, beta subunit [Pseudomonas syringae
           pv. aesculi str. 2250]
 gi|330867431|gb|EGH02140.1| electron transfer flavoprotein, subunit beta [Pseudomonas syringae
           pv. aesculi str. 0893_23]
 gi|330987427|gb|EGH85530.1| electron transfer flavoprotein, subunit beta [Pseudomonas syringae
           pv. lachrymans str. M301315]
          Length = 249

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    +E L+ +LA+GADR +L+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VTIGPTTAQEQLRTALALGADRAVLVESAEELTSLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  +PQ TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALSGYPQGTFASKVEVSGDKVAVTREIDGGLQTVSLSLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEVLTPDALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|78062315|ref|YP_372223.1| electron transfer flavoprotein subunit beta [Burkholderia sp. 383]
 gi|77970200|gb|ABB11579.1| Electron transfer flavoprotein beta-subunit [Burkholderia sp. 383]
          Length = 249

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 177/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++ N KV +K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ TEV+ 
Sbjct: 1   MKALVAVKRVVDANVKVGVKSDRTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVVTEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+E+ +++EPL +AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSVGVVQAQETLRTALAIGADRAILVEATDSVEPLGVAKVLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + + D  A V REV  G  T+   LPAVIT DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVVVADARATVAREVDGGAETLSLQLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK +E  K  D  +D+TPRLKVL+  E      G+++     L+ 
Sbjct: 181 NEPRYVTLPNIMKAKKKPLEVVKPGDLGVDVTPRLKVLKVNEPPKRAAGVKVPDVQTLVA 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKTEAKVL 249


>gi|77460338|ref|YP_349845.1| electron transfer flavoprotein subunit beta [Pseudomonas
           fluorescens Pf0-1]
 gi|77384341|gb|ABA75854.1| electron transfer flavoprotein beta-subunit [Pseudomonas
           fluorescens Pf0-1]
          Length = 249

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+ +LA+GADR IL+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSIGPSTAQEQLRTALALGADRAILVESAEDLTSLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  + Q TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALSGYGQGTFASKVEVSGDSVAVTREIDGGAQTVSLKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLETLTPDALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|330959070|gb|EGH59330.1| electron transfer flavoprotein subunit beta [Pseudomonas syringae
           pv. maculicola str. ES4326]
          Length = 249

 Score =  245 bits (626), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++LREKG+A+E++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLREKGVASEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    +E L+ +LA+GADR +L+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VTIGPTTAQEQLRTALALGADRAVLVESAEELTSLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  +PQ TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALSGYPQGTFASKVEVTGDKVAVTREIDGGLQTVSLSLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K ++ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEVLTPDALGVSTASTNKTVKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|171463916|ref|YP_001798029.1| Electron transfer flavoprotein alpha/beta-subunit [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|171193454|gb|ACB44415.1| Electron transfer flavoprotein alpha/beta-subunit [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 249

 Score =  245 bits (626), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 178/245 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++YN K+R+K+D SG++  N K+SMNPFDEIA+EE+++L+E G+ATEV+V
Sbjct: 1   MKILVAVKRVVDYNVKIRVKSDNSGVDLANVKMSMNPFDEIAVEEAVRLKEAGVATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+ G+ + +E L+ +LA+GADR IL+E++  L+PL++AKIL+ +  KE   I+I GKQ  
Sbjct: 61  VTAGANQCQETLRTALAIGADRAILVETDADLQPLAVAKILKVLSDKEQAQIIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLA+L+   QATF S + + D  A VTREV  G  T+   LPAVIT DL L
Sbjct: 121 DDDSNQTGQMLASLLDIAQATFASKVVVADGKATVTREVDGGLETITLALPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK I+  K  D  +D+ PRLK ++ EE      G+ +     L+E
Sbjct: 181 NEPRYVTLPNIMKAKKKTIDIVKPEDLGVDIAPRLKTIKVEEPPKRSTGVMVADVAALVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|330502925|ref|YP_004379794.1| electron transfer flavoprotein subunit beta [Pseudomonas mendocina
           NK-01]
 gi|328917211|gb|AEB58042.1| electron transfer flavoprotein beta-subunit [Pseudomonas mendocina
           NK-01]
          Length = 249

 Score =  245 bits (626), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 174/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+A+E++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVASEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+ +LA+GADR IL+ESN+ L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSIGPATAQEQLRTALALGADRAILVESNDELNSLAVAKLLKAVVDKEQPQLVIMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQML AL  + Q TF S ++++ +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLGALTGFGQGTFASKVEVVGDKVNVTREIDGGLQTVALNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +     +K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLETVTPDALGVSTASTVKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|304322201|ref|YP_003855844.1| electron transfer flavoprotein beta chain, (ETFSS) [Parvularcula
           bermudensis HTCC2503]
 gi|303301103|gb|ADM10702.1| electron transfer flavoprotein beta chain, (ETFSS) [Parvularcula
           bermudensis HTCC2503]
          Length = 249

 Score =  245 bits (626), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A E++V
Sbjct: 1   MKILVPVKRVVDYNVKVRVKPDQSGVDLANVKMSMNPFDEIAVEEAVRLKEAGTAEEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           +SIG  K ++ ++ +LAMGADRGIL+ ++  LE L++AKIL+++  +E P IV+ GKQ  
Sbjct: 61  ISIGPEKAQDQIRQALAMGADRGILVTTDSDLESLAVAKILQKVCDEEKPEIVMMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ +QTGQMLAALM W Q TF S +K   +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DDDRSQTGQMLAALMGWSQGTFASEVKKDGDKLHVTREIDGGLQTIALSLPAIVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++KK   DF +D  PRL+VL+  E      G+ + S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDKKSVEDFGVDTAPRLEVLKVTEPPKREAGIIVESVDQLVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAGVI 249


>gi|332142149|ref|YP_004427887.1| electron transfer flavoprotein, beta subunit [Alteromonas macleodii
           str. 'Deep ecotype']
 gi|327552171|gb|AEA98889.1| electron transfer flavoprotein, beta subunit [Alteromonas macleodii
           str. 'Deep ecotype']
          Length = 250

 Score =  245 bits (626), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 119/250 (47%), Positives = 180/250 (72%), Gaps = 2/250 (0%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K  I+YN KVR+K D SG++  N K+++NPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKILVPVKRAIDYNVKVRVKADESGVDLTNAKMAINPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E ++ +LA+GADRGI I++++ L+ L +AK+L ++V++E P +VI GKQ+ 
Sbjct: 61  VSIGDKSCQEQIRTALALGADRGIQIDTDQNLDSLQVAKLLSKVVEEEQPQLVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAI-VTREVGHGTMTMETPLPAVITVDLN 179
           D+++NQTGQMLAAL   PQ TF S + ++D   + VTRE+  G  T+   LPAV+T DL 
Sbjct: 121 DSDNNQTGQMLAALTGMPQGTFASEV-VVDGEKVNVTREIDGGLQTVALSLPAVVTTDLR 179

Query: 180 LNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLI 239
           LNEPRY SLPNI+KA++K ++ K A DF + L   +KVL+         G+++    +L+
Sbjct: 180 LNEPRYASLPNIMKAKRKPLDVKAAADFGVALESNVKVLKVTPPPQREGGIKVADVAELV 239

Query: 240 EILKSKHDLL 249
           E LK++  ++
Sbjct: 240 EKLKNEAKVI 249


>gi|87120048|ref|ZP_01075944.1| Electron transfer flavoprotein, beta subunit [Marinomonas sp.
           MED121]
 gi|86164750|gb|EAQ66019.1| Electron transfer flavoprotein, beta subunit [Marinomonas sp.
           MED121]
          Length = 250

 Score =  245 bits (625), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 181/249 (72%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+YN KVR+K D S ++  N K+++NPF EIA+EE+++L+E+G+ATEV+V
Sbjct: 1   MKILVAVKRVIDYNVKVRVKADQSNVDLNNVKMALNPFCEIAVEEAVRLKEQGVATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIGS   +E L+N+LA+G DR I +E+ +  + LS+A+IL ++ + E P +++ GKQ  
Sbjct: 61  VSIGSKSCQEQLRNALALGCDRAIQVEAEDGPDSLSVARILAKVAEAETPGLILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+  PQATF S IKI +  A VTRE+  G  T++  LPAV+T DL L
Sbjct: 121 DSDNNQTGQMLAALLDRPQATFASEIKIEEGKASVTREIDGGLQTLKLTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+ SLPNI+KA++K +E K A +  + ++  +K++  EE    + G+++ S  +L+E
Sbjct: 181 NEPRFASLPNIMKAKRKPLEVKSADELGVSVSSNIKLISVEEPAQRQAGIKVSSVDELVE 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|66045235|ref|YP_235076.1| electron transfer flavoprotein subunit beta [Pseudomonas syringae
           pv. syringae B728a]
 gi|63255942|gb|AAY37038.1| Electron transfer flavoprotein beta-subunit [Pseudomonas syringae
           pv. syringae B728a]
          Length = 249

 Score =  245 bits (625), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+A+E++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVASEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    +E L+ +LA+GADR +L+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VTIGPTTAQEQLRTALALGADRAVLVESAEELTSLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  +PQ TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALSGYPQGTFASRVEVTGDKVAVTREIDGGLQTVSLSLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEVLTPDALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|66045414|ref|YP_235255.1| electron transfer flavoprotein subunit beta [Pseudomonas syringae
           pv. syringae B728a]
 gi|63256121|gb|AAY37217.1| Electron transfer flavoprotein beta-subunit [Pseudomonas syringae
           pv. syringae B728a]
          Length = 249

 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKMLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+ +LA+GADR IL+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSIGPSTAQEQLRTALALGADRAILVESAEDLTSLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  + Q TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALSGYGQGTFASKVEVSGDSVAVTREIDGGAQTVSLKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLETLTPDALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|126668264|ref|ZP_01739224.1| Electron transfer flavoprotein, beta subunit [Marinobacter sp.
           ELB17]
 gi|126627290|gb|EAZ97927.1| Electron transfer flavoprotein, beta subunit [Marinobacter sp.
           ELB17]
          Length = 249

 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 174/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K++MNPF EIA+EE+++L+EKG+  E++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKPDNSGVDLANVKMAMNPFCEIAVEEAVRLKEKGVVNEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E ++ +LA+GADRGI IE++  ++ L +AK+L+ +  KE P +VI GKQ  
Sbjct: 61  VSIGPKACQEQIRTALALGADRGIHIETDAEIQSLQVAKLLKAVADKEQPNLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL    Q TF S I I  +   VTREV  G MT+   LPAV+T DL L
Sbjct: 121 DSDNNQTGQMLAALAGMSQGTFASEIVIDGDKVNVTREVDGGMMTVSLTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E     D  +D+TPRL +++ E   + + G+++    +L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPLESISPADLGVDVTPRLTIVKVEAPASRQAGIKVADVAELVN 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|311694647|gb|ADP97520.1| electron transfer flavoprotein, beta subunit [marine bacterium
           HP15]
          Length = 249

 Score =  244 bits (624), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 178/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+YN KVR+K D +G++  N K++MNPF EIA+EE+++L+EKG+A+E++V
Sbjct: 1   MKVLVAVKRVIDYNVKVRVKPDNTGVDLANVKMAMNPFCEIAVEEAVRLKEKGVASEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E ++ +LA+GADRGI +E++E ++ L  AK+L+ +V+KE P +VI GKQ+ 
Sbjct: 61  VSIGPKASQEQIRTALALGADRGIHVETDEEVQSLEAAKLLKAVVEKEEPKLVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL    Q TF S + +  +   VTREV  G MT+   LPAV+T DL L
Sbjct: 121 DSDNNQTGQMLAALTGMGQGTFASEVVVEGDKVNVTREVDGGLMTVALNLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++     D  +D+ PRL  L+ E   + + G+++    +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDNMSPADLGVDIAPRLSTLKVEAPASRQAGVKVADVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|312962534|ref|ZP_07777025.1| electron transfer flavoprotein beta-subunit [Pseudomonas
           fluorescens WH6]
 gi|311283461|gb|EFQ62051.1| electron transfer flavoprotein beta-subunit [Pseudomonas
           fluorescens WH6]
          Length = 249

 Score =  244 bits (624), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+ +LA+GADR IL+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSIGPTTAQEQLRTALALGADRAILVESAEELTSLAVAKLLKAVVDKEQPSLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  + Q TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALTGYGQGTFASKVEVSGDSVAVTREIDGGAQTVSLKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K ++ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEVLTPDALGVSTASTNKTVKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAKVL 249


>gi|239995832|ref|ZP_04716356.1| electron transfer flavoprotein, beta subunit [Alteromonas macleodii
           ATCC 27126]
          Length = 250

 Score =  244 bits (624), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 118/250 (47%), Positives = 180/250 (72%), Gaps = 2/250 (0%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K  I+YN KVR+K D SG++  N K+++NPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKILVPVKRAIDYNVKVRVKADESGVDLTNAKMAINPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E ++ +LA+GADRGI I++++ L+ L +AK+L ++V++E P +VI GKQ+ 
Sbjct: 61  VSIGDKSCQEQIRTALALGADRGIQIDTDQNLDSLQVAKLLSKVVEEEQPQLVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAI-VTREVGHGTMTMETPLPAVITVDLN 179
           D+++NQTGQMLAAL   PQ TF S + ++D   + VTRE+  G  T+   LPAV+T DL 
Sbjct: 121 DSDNNQTGQMLAALTGMPQGTFASEV-VVDGEKVNVTREIDGGLQTVALSLPAVVTTDLR 179

Query: 180 LNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLI 239
           LNEPRY SLPNI+KA++K ++ K A DF + L   +KVL+         G+++    +L+
Sbjct: 180 LNEPRYASLPNIMKAKRKPLDVKAAADFGVSLDSNVKVLKVTPPPQREGGIKVADVAELV 239

Query: 240 EILKSKHDLL 249
           + LK++  ++
Sbjct: 240 DKLKNEAKVI 249


>gi|330810961|ref|YP_004355423.1| Electron transfer flavoprotein, beta subunit [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327379069|gb|AEA70419.1| Electron transfer flavoprotein, beta subunit [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 249

 Score =  244 bits (624), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+ +LA+GADR IL+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSIGPTTAQEQLRTALALGADRAILVESAEELTSLAVAKLLKAVVDKEQPSLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  + Q TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALSGYGQGTFASKVEVSGDSVAVTREIDGGAQTVSLKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEVLTPDALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|241605103|ref|XP_002406003.1| electron transfer flavoprotein, beta subunit, putative [Ixodes
           scapularis]
 gi|215502611|gb|EEC12105.1| electron transfer flavoprotein, beta subunit, putative [Ixodes
           scapularis]
          Length = 200

 Score =  244 bits (624), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 109/200 (54%), Positives = 156/200 (78%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+ +L+E G ATEVI 
Sbjct: 1   MKVLVPVKRVVDYNVKVRVKSDQTGVDIANVKMSMNPFDEIAVEEATRLKESGAATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           +S G  + +E L+ +LA+GADR  L++++  L+PL++AK+++ +V KE P +VI GKQ  
Sbjct: 61  LSCGVAQSQETLRTALAIGADRATLVQTDAELQPLAVAKLIKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+ WPQATF S +++  +   VTREV  G  T++  LPAVIT DL L
Sbjct: 121 DDDANQTGQMLAALLDWPQATFASKVEVSGDSVSVTREVDGGLETLKLSLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIE 200
           NEPRY++LPNI+KA+KK +E
Sbjct: 181 NEPRYVTLPNIMKAKKKPLE 200


>gi|21537123|gb|AAM61464.1| electron transfer flavoprotein beta-subunit-like [Arabidopsis
           thaliana]
          Length = 251

 Score =  244 bits (623), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 123/248 (49%), Positives = 171/248 (68%), Gaps = 4/248 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++Y  K+R+K D +G+ET+N K+SMNPF EIALEE+L+++E G A EVI 
Sbjct: 1   MKILVAVKRVVDYAVKIRVKPDKTGVETQNVKMSMNPFCEIALEEALRIKEAGFAKEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  + L+  LAMGADRGI +E+N +  PL+IAKIL+ +   ENP ++  GKQ  
Sbjct: 61  VSIGPSQCVDTLRTGLAMGADRGIHVETNSSFLPLTIAKILKSLADVENPGLIFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIID---NHAIVTREVGHGTMTMETPLPAVITVD 177
           D++ NQTGQM+AAL+ WPQATF S + ++D   N A V REV  G  T+   LPAVIT D
Sbjct: 121 DDDCNQTGQMVAALLGWPQATFASKV-VLDKDKNVATVDREVDGGLETLNVDLPAVITTD 179

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LN+PRY SLPNI+KA+ K I+K    D  +D+   +++L   E    + G+ + S  +
Sbjct: 180 LRLNQPRYASLPNIMKAKSKPIKKMTVQDLKVDIKSDIEILEVTEPPKRKSGVMVSSVDE 239

Query: 238 LIEILKSK 245
           LI+ LK++
Sbjct: 240 LIDKLKNE 247


>gi|297795077|ref|XP_002865423.1| hypothetical protein ARALYDRAFT_494654 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297311258|gb|EFH41682.1| hypothetical protein ARALYDRAFT_494654 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 251

 Score =  244 bits (623), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 123/248 (49%), Positives = 171/248 (68%), Gaps = 4/248 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++Y  K+R+K D +G+ET+N K+SMNPF EIALEE+L+++E G A EVI 
Sbjct: 1   MKILVAVKRVVDYAVKIRVKPDKTGVETQNVKMSMNPFCEIALEEALRIKEAGFAEEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  + L+  LAMGADRGI +E+N +  PL+IAKIL+ +   ENP ++  GKQ  
Sbjct: 61  VSIGPSQCVDTLRTGLAMGADRGIHVETNSSFLPLTIAKILKSLADVENPGLIFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIID---NHAIVTREVGHGTMTMETPLPAVITVD 177
           D++ NQTGQM+AAL+ WPQATF S + ++D   N A V REV  G  T+   LPAVIT D
Sbjct: 121 DDDCNQTGQMVAALLGWPQATFASKV-VLDKDKNVATVDREVDGGLETLNVDLPAVITTD 179

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LN+PRY SLPNI+KA+ K I+K    D  +D+   +++L   E    + G+ + S  +
Sbjct: 180 LRLNQPRYASLPNIMKAKSKPIKKMTVQDLKVDIKSDIEILEVTEPPKRKSGVMVSSVDE 239

Query: 238 LIEILKSK 245
           LI+ LK++
Sbjct: 240 LIDKLKNE 247


>gi|330875710|gb|EGH09859.1| electron transfer flavoprotein subunit beta [Pseudomonas syringae
           pv. morsprunorum str. M302280PT]
          Length = 249

 Score =  244 bits (623), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 171/249 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+ +L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAARLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    +E L+ +LA+GADR +L+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VTIGPTTAQEQLRTALALGADRAVLVESAEELTSLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  +PQ TF S +++  +   VTRE+  G   +   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALSGYPQGTFASKVEVTGDKVAVTREIDGGLQAVSLSLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEVLTPDALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|149374765|ref|ZP_01892538.1| Electron transfer flavoprotein, beta subunit [Marinobacter algicola
           DG893]
 gi|149360654|gb|EDM49105.1| Electron transfer flavoprotein, beta subunit [Marinobacter algicola
           DG893]
          Length = 249

 Score =  244 bits (622), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 177/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+YN KVR+K D +G++  N K++MNPF EIA+EE+++L+EKG+A+E++V
Sbjct: 1   MKVLVAVKRVIDYNVKVRVKPDNTGVDLANVKMAMNPFCEIAVEEAVRLKEKGVASEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E ++ +LA+GADRGI IE++E ++ L  AK+L+ +V+KE P +VI GKQ+ 
Sbjct: 61  VSIGPKACQEQIRTALALGADRGIHIETDEEVQSLEAAKLLKSVVEKEEPKLVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL    Q TF S + +      VTREV  G MT+   LPAV+T DL L
Sbjct: 121 DSDNNQTGQMLAALTGMGQGTFASEVVVEGEKVNVTREVDGGLMTVALNLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++     D  ++L PRL  L+ E   + + G+++    +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDAMTPADLGVELAPRLSTLKVEAPASRQAGVKVADVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|146307729|ref|YP_001188194.1| electron transfer flavoprotein beta-subunit [Pseudomonas mendocina
           ymp]
 gi|145575930|gb|ABP85462.1| electron transfer flavoprotein beta-subunit [Pseudomonas mendocina
           ymp]
          Length = 249

 Score =  244 bits (622), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+A+E++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVASEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+ +LA+GADR IL+ESN+ L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSIGPATAQEQLRTALALGADRAILVESNDELNSLAVAKLLKAVVDKEQPQLVIMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQML AL  + Q TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLGALTGFGQGTFASKVEVAGDKVNVTREIDGGLQTVALNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +     +K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLETVTPDALGVSTASTVKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|71736122|ref|YP_274188.1| electron transfer flavoprotein subunit beta [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|71556675|gb|AAZ35886.1| electron transfer flavoprotein, beta subunit [Pseudomonas syringae
           pv. phaseolicola 1448A]
          Length = 249

 Score =  244 bits (622), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    +E L+ +LA+G DR +L+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VTIGPTTAQEQLRTALALGVDRAVLVESAEELTSLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  +PQ TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALSGYPQGTFASKVEVSGDKVAVTREIDGGLQTVSLSLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEVLTPDALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|15677968|ref|NP_275140.1| electron transfer flavoprotein, beta subunit [Neisseria
           meningitidis MC58]
 gi|7227413|gb|AAF42463.1| electron transfer flavoprotein, beta subunit [Neisseria
           meningitidis MC58]
 gi|316984518|gb|EFV63484.1| electron transfer flavoprotein subunit beta [Neisseria meningitidis
           H44/76]
 gi|325127250|gb|EGC50188.1| electron transfer flavoprotein, beta subunit [Neisseria
           meningitidis N1568]
 gi|325139465|gb|EGC62005.1| electron transfer flavoprotein, beta subunit [Neisseria
           meningitidis CU385]
 gi|325201191|gb|ADY96646.1| electron transfer flavoprotein, beta subunit [Neisseria
           meningitidis H44/76]
 gi|325207049|gb|ADZ02502.1| electron transfer flavoprotein, beta subunit [Neisseria
           meningitidis M04-240196]
          Length = 249

 Score =  244 bits (622), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 170/245 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR I +E++  LE L++AK+L+ +  KENP I   GKQ  
Sbjct: 61  VSLGEKKCEETLRTALAMGADRAIHVETDTKLESLAVAKLLKAVADKENPQIFFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TF S ++I  +   + RE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFASKVQIEGDEVQIVREIDGGEETIALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D   D++PRLK ++F E +A + G+++ S  +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLTPDDLVADISPRLKTVKFAEPKARQAGVKVASVAELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|120554392|ref|YP_958743.1| electron transfer flavoprotein beta-subunit [Marinobacter aquaeolei
           VT8]
 gi|120324241|gb|ABM18556.1| electron transfer flavoprotein beta-subunit [Marinobacter aquaeolei
           VT8]
          Length = 249

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 175/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+YN KVR+K D +G++  N K++MNPF EIA+EE+++L+EKG+A+E++V
Sbjct: 1   MKVLVAVKRVIDYNVKVRVKPDNTGVDLANVKMAMNPFCEIAVEEAVRLKEKGVASEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E ++ +LA+GADRGI IE++E ++ L  AK+L+ +V+KE P +VI GKQ+ 
Sbjct: 61  VSIGPKASQEQIRTALALGADRGIHIETDEEVQSLEAAKLLKAVVEKEEPKLVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL    Q TF S + +  +   VTREV  G MT+   LPAV+T DL L
Sbjct: 121 DSDNNQTGQMLAALTGMGQGTFASEVVVDGDKVNVTREVDGGLMTVALNLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++     D  +D+  RL  L+ E   A + G+++    +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDSMSPADLGVDVAARLSTLKVEAPAARQAGIKVADVAELVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|91793890|ref|YP_563541.1| electron transfer flavoprotein beta-subunit [Shewanella
           denitrificans OS217]
 gi|91715892|gb|ABE55818.1| electron transfer flavoprotein beta-subunit [Shewanella
           denitrificans OS217]
          Length = 249

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 175/249 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++ N KVR+K D + ++T N K+++NPF EIA+EE+++L+E G ATEVIV
Sbjct: 1   MKVLVPVKRVVDANVKVRVKADNTNVDTANLKMALNPFCEIAVEEAVRLKEAGKATEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G+  V+E L+ ++A+GADR I IE++E L PLSIAK+L  + +KE   +VI GKQ+ 
Sbjct: 61  VSVGTKAVQEQLRTAMALGADRAIHIETDEELVPLSIAKLLLAVQQKEQAELVIFGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAAL   PQATF S I I    A VTREV  G  T+  PLPAV+TVDL L
Sbjct: 121 DGDNNQTGQMLAALAGMPQATFASEINIEGQTATVTREVDGGLQTLTMPLPAVVTVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K ++     D  ++L    KVL+       + G+ + S  +LIE
Sbjct: 181 NEPRYASLPNIMKAKRKPLDVMSIADLGVELKVHQKVLKVAPPSERKAGIMVSSVEELIE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKTEAKVI 249


>gi|15598148|ref|NP_251642.1| electron transfer flavoprotein beta-subunit [Pseudomonas aeruginosa
           PAO1]
 gi|116050954|ref|YP_790221.1| electron transfer flavoprotein beta-subunit [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218890850|ref|YP_002439714.1| electron transfer flavoprotein beta-subunit [Pseudomonas aeruginosa
           LESB58]
 gi|254235927|ref|ZP_04929250.1| electron transfer flavoprotein beta-subunit [Pseudomonas aeruginosa
           C3719]
 gi|254241662|ref|ZP_04934984.1| electron transfer flavoprotein beta-subunit [Pseudomonas aeruginosa
           2192]
 gi|296388556|ref|ZP_06878031.1| electron transfer flavoprotein beta-subunit [Pseudomonas aeruginosa
           PAb1]
 gi|313108136|ref|ZP_07794271.1| electron transfer flavoprotein beta-subunit [Pseudomonas aeruginosa
           39016]
 gi|81540582|sp|Q9HZP6|ETFB_PSEAE RecName: Full=Electron transfer flavoprotein subunit beta;
           Short=Beta-ETF; AltName: Full=Electron transfer
           flavoprotein small subunit; Short=ETFSS
 gi|9949049|gb|AAG06340.1|AE004721_8 electron transfer flavoprotein beta-subunit [Pseudomonas aeruginosa
           PAO1]
 gi|115586175|gb|ABJ12190.1| electron transfer flavoprotein beta-subunit [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126167858|gb|EAZ53369.1| electron transfer flavoprotein beta-subunit [Pseudomonas aeruginosa
           C3719]
 gi|126195040|gb|EAZ59103.1| electron transfer flavoprotein beta-subunit [Pseudomonas aeruginosa
           2192]
 gi|218771073|emb|CAW26838.1| electron transfer flavoprotein beta-subunit [Pseudomonas aeruginosa
           LESB58]
 gi|310880773|gb|EFQ39367.1| electron transfer flavoprotein beta-subunit [Pseudomonas aeruginosa
           39016]
          Length = 249

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++ 
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G    +E L+ +LA+GADR IL+ESN+ L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSVGPTAAQEQLRTALALGADRAILVESNDELNSLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  + Q TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALTGYAQGTFASKVEVAGDKVNVTREIDGGLQTVALNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++        +     +K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLDVVTPDALGVSTASTVKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|218767264|ref|YP_002341776.1| electron transfer flavoprotein beta-subunit [Neisseria meningitidis
           Z2491]
 gi|254804051|ref|YP_003082272.1| electron transfer flavoprotein beta-subunit [Neisseria meningitidis
           alpha14]
 gi|121051272|emb|CAM07548.1| electron transfer flavoprotein beta-subunit [Neisseria meningitidis
           Z2491]
 gi|254667593|emb|CBA03347.1| electron transfer flavoprotein beta-subunit [Neisseria meningitidis
           alpha14]
 gi|319411470|emb|CBY91886.1| electron transfer flavoprotein beta-subunit (beta-ETF; electron
           transfer flavoprotein small subunit; ETFSS) [Neisseria
           meningitidis WUE 2594]
          Length = 249

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 116/244 (47%), Positives = 167/244 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR I +E++  LE L++AK+L+ +  KENP I   GKQ  
Sbjct: 61  VSLGEKKCEETLRTALAMGADRAIHVETDTKLESLAVAKLLKAVADKENPQIFFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TF S + I      + RE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFASKVHIEGGEVQIVREIDGGEETIALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D A D+ PRLK ++F E +A + G+++ S  +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLAPADLATDILPRLKTVKFAEPKARQAGVKVASVAELVE 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKN 244


>gi|157961954|ref|YP_001501988.1| electron transfer flavoprotein subunit alpha/beta [Shewanella
           pealeana ATCC 700345]
 gi|157846954|gb|ABV87453.1| Electron transfer flavoprotein alpha/beta-subunit [Shewanella
           pealeana ATCC 700345]
          Length = 249

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVPIK V+++N KVRIK+D SG++  N K+S+NPFDEIA+EE+++L+E GIATEVI 
Sbjct: 1   MKILVPIKRVVDHNVKVRIKSDGSGVDFNNVKMSINPFDEIAIEEAVRLKEAGIATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G+   +E L+ +LA+GADR I + ++  LEPL +AKIL++IVK+E P +VI GKQ  
Sbjct: 61  VSCGAKACQETLRTALAVGADRAIQVNTDADLEPLGVAKILKQIVKREAPQLVICGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQML+AL+ W Q TF S +K+  N   VTRE+  G  T+   LPAV++ DL L
Sbjct: 121 DDDCNQTGQMLSALLGWSQGTFASELKVDANELSVTREIDGGLETLMLALPAVVSCDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N+PRY SLPNI+KA++K +E  +  +  +D+  R+  + +        G+ +    +L+ 
Sbjct: 181 NQPRYASLPNIMKAKRKPLEVIELNELNVDVKQRVTAINYTFPATRSAGVMVEDVAELVS 240

Query: 241 ILKSKHDLL 249
            L+ +  +L
Sbjct: 241 KLREEARVL 249


>gi|70729203|ref|YP_258939.1| electron transfer flavoprotein subunit beta [Pseudomonas
           fluorescens Pf-5]
 gi|68343502|gb|AAY91108.1| electron transfer flavoprotein, beta subunit [Pseudomonas
           fluorescens Pf-5]
          Length = 249

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKTDNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+ +LA+GADR IL+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSIGPATAQEQLRTALALGADRAILVESAEELNSLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  + Q TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALSGYAQGTFASKVEVSGDKVNVTREIDGGLQTVALNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLETLTPDALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|327481283|gb|AEA84593.1| electron transfer flavoprotein beta-subunit [Pseudomonas stutzeri
           DSM 4166]
          Length = 249

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 174/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+A+E++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVASEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+ +LA+GADR +L++SN+ L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSIGPTAAQEQLRTALALGADRAVLVDSNDELNSLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQML AL  + Q TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLGALTGYAQGTFASKVEVAGDKVNVTREIDGGLQTVALNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +  T  +K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEVLTPDALGVATTSTVKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|90415892|ref|ZP_01223825.1| electron transfer flavoprotein beta-subunit [marine gamma
           proteobacterium HTCC2207]
 gi|90332266|gb|EAS47463.1| electron transfer flavoprotein beta-subunit [marine gamma
           proteobacterium HTCC2207]
          Length = 250

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 173/245 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++YN KVR K+D S ++  N K+S+NPF EIA+EE+++L EKG+ATEV+ 
Sbjct: 1   MKILVAVKRVVDYNVKVRPKSDGSDVDLANVKMSINPFCEIAVEEAVRLAEKGLATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR +L+E++E+LEPL+IAK L+ +   E+P I++ GKQ  
Sbjct: 61  VSVGPKQAQEQLRTALALGADRAVLVETDESLEPLAIAKCLKAVCDAESPDIILMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQML+AL+   QATF S + +    A+V REV  G  T+E  LPA++T DL L
Sbjct: 121 DGDNNQTGQMLSALLDCSQATFASELTLDGGKAVVIREVDGGLQTLELSLPAIVTSDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K ++ K   D  + + PR+ +L  E     + G+++     L++
Sbjct: 181 NEPRYASLPNIMKAKRKSLDVKTPDDLGVSIAPRVTLLGVELPAERQAGIKVDDVAMLVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|83646660|ref|YP_435095.1| electron transfer flavoprotein subunit beta [Hahella chejuensis
           KCTC 2396]
 gi|83634703|gb|ABC30670.1| Electron transfer flavoprotein, beta subunit [Hahella chejuensis
           KCTC 2396]
          Length = 249

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 178/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+YN KVR+K D +G++  N K++MNPF EIA+EE+++L+EKG+ATEV+V
Sbjct: 1   MKVLVAVKRVIDYNVKVRVKPDNTGVDLTNVKMAMNPFCEIAVEEAVRLKEKGVATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E ++ +LA+GADRGI +E++E ++ L+ AK+L+ +V+KE P +VI GKQ+ 
Sbjct: 61  VSIGPKAAQEQIRTALALGADRGIHVETDEEIQSLAAAKLLKAVVEKEQPKLVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAAL  + Q TF S + +  +   VTRE+  G +T+   LPA++T DL L
Sbjct: 121 DTDNNQTGQMLAALCGYAQGTFASEVVVEGDKVNVTREIDGGLLTVALNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++     D   ++ PRL  L+ E     + G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDTVTPADLGAEIAPRLTTLKVEAPAQRQAGIKVGSVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|15239866|ref|NP_199156.1| ETFBETA; electron carrier [Arabidopsis thaliana]
 gi|75264214|sp|Q9LSW8|ETFB_ARATH RecName: Full=Electron transfer flavoprotein subunit beta,
           mitochondrial; Short=Beta-ETF; Flags: Precursor
 gi|17386108|gb|AAL38600.1|AF446867_1 AT5g43430/MWF20_14 [Arabidopsis thaliana]
 gi|8843896|dbj|BAA97422.1| electron transfer flavoprotein beta-subunit-like [Arabidopsis
           thaliana]
 gi|15010712|gb|AAK74015.1| AT5g43430/MWF20_14 [Arabidopsis thaliana]
 gi|332007577|gb|AED94960.1| Electron transfer flavoprotein subunit beta [Arabidopsis thaliana]
          Length = 251

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 123/248 (49%), Positives = 170/248 (68%), Gaps = 4/248 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++Y  K+R+K D +G+ET+N K+SMNPF EIALEE+L+++E G A EVI 
Sbjct: 1   MKILVAVKRVVDYAVKIRVKPDKTGVETQNVKMSMNPFCEIALEEALRIKEAGFAKEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  + L+  LAMGADRGI +E+N    PL+IAKIL+ +   ENP ++  GKQ  
Sbjct: 61  VSIGPSQCVDTLRTGLAMGADRGIHVETNSIFLPLTIAKILKSLADVENPGLIFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIID---NHAIVTREVGHGTMTMETPLPAVITVD 177
           D++ NQTGQM+AAL+ WPQATF S + ++D   N A V REV  G  T+   LPAVIT D
Sbjct: 121 DDDCNQTGQMVAALLGWPQATFASKV-VLDKDKNVATVDREVDGGLETLNVDLPAVITTD 179

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LN+PRY SLPNI+KA+ K I+K    D  +D+   +++L   E    + G+ + S  +
Sbjct: 180 LRLNQPRYASLPNIMKAKSKPIKKMTVQDLKVDIKSDIEILEVTEPPKRKSGVMVSSVDE 239

Query: 238 LIEILKSK 245
           LI+ LK++
Sbjct: 240 LIDKLKNE 247


>gi|66816083|ref|XP_642058.1| electron transfer flavoprotein beta subunit [Dictyostelium
           discoideum AX4]
 gi|74856840|sp|Q54YZ4|ETFB_DICDI RecName: Full=Electron transfer flavoprotein subunit beta;
           Short=Beta-ETF
 gi|60470188|gb|EAL68168.1| electron transfer flavoprotein beta subunit [Dictyostelium
           discoideum AX4]
          Length = 250

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 172/249 (69%), Gaps = 1/249 (0%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           +KILVPIK V++Y  K+R+K D SG+ET N K+SMNPFDEIA+EE+++++EK +A E+I 
Sbjct: 3   LKILVPIKRVVDYAVKIRVKGDKSGVETANVKMSMNPFDEIAVEEAIRIKEKNLAKEIIA 62

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G    +E ++ ++AMGAD+GI +E+   L+PLS+AK+L+E+V KE P ++I GKQ  
Sbjct: 63  VSMGPKTSQETIRTAIAMGADKGIHVETTAELQPLSVAKLLKELVDKEKPNLIILGKQAI 122

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQT QMLA L+ WPQATF S + I D+   VTRE+  G  T+   LPA+I+ DL L
Sbjct: 123 DDDCNQTAQMLAGLLNWPQATFASKVDIKDDSVHVTREIDGGLETLSMKLPAIISCDLRL 182

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  L NI+K++K  ++ +      +D    LK++  EE      G+++ S   ++E
Sbjct: 183 NEPRYAKLQNIMKSKKAELKVETPESLNVDTNCNLKIISVEEPPKRSGGVKVESVENVVE 242

Query: 241 ILKSKHDLL 249
            LK KH L+
Sbjct: 243 ALK-KHALI 250


>gi|104782676|ref|YP_609174.1| electron transfer flavoprotein subunit beta [Pseudomonas
           entomophila L48]
 gi|95111663|emb|CAK16384.1| electron transfer flavoprotein beta-subunit [Pseudomonas
           entomophila L48]
          Length = 249

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+A+E++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVASEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+ +LA+GADR IL+E+ + L  L++AK L+ +V KE P +VI GKQ  
Sbjct: 61  VSIGPTAAQEQLRTALALGADRAILVEAADELSSLAVAKALKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  + Q TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALTGYAQGTFASKVEVAGDKVNVTREIDGGLQTVALNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        + L    K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLETVTPDALGVSLASTSKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|229592079|ref|YP_002874198.1| electron transfer flavoprotein subunit beta [Pseudomonas
           fluorescens SBW25]
 gi|229363945|emb|CAY51470.1| electron transfer flavoprotein beta-subunit [Pseudomonas
           fluorescens SBW25]
          Length = 249

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+ +LA+GADR IL+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSIGPTTAQEQLRTALALGADRAILVESAEELTSLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  + Q TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALTGYGQGTFASKVEVNGDSVAVTREIDGGAQTVSLKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K ++ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEVLTPDALGVSTASTNKTVKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|152985005|ref|YP_001347581.1| electron transfer flavoprotein beta-subunit [Pseudomonas aeruginosa
           PA7]
 gi|150960163|gb|ABR82188.1| electron transfer flavoprotein beta-subunit [Pseudomonas aeruginosa
           PA7]
          Length = 249

 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+A+E++ 
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVASEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G    +E L+ +LA+GADR IL+ESN+ L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSVGPTAAQEQLRTALALGADRAILVESNDELNSLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  + Q TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALTGYAQGTFASKVEVAGDKVNVTREIDGGLQTVALNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++        +     +K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLDVVTPDALGVSTASTVKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|87198481|ref|YP_495738.1| electron transfer flavoprotein beta-subunit [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87201181|ref|YP_498438.1| electron transfer flavoprotein beta-subunit [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87134162|gb|ABD24904.1| electron transfer flavoprotein beta-subunit [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87136862|gb|ABD27604.1| electron transfer flavoprotein beta-subunit [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 250

 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 167/245 (68%), Gaps = 2/245 (0%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K VI+YN K R+K D SG++  N K+SMNPFDEIA+EE+++L+EKG+ TE++ 
Sbjct: 1   MKALVCVKRVIDYNVKPRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEKGVVTEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLE--PLSIAKILREIVKKENPIIVIAGKQ 118
           VS+G  K +E L+ +LAMGADR +L++ ++ +E  PL++AKI++ I  +E P ++I GKQ
Sbjct: 61  VSVGPAKAQETLRTALAMGADRAVLVQVDDGVEVEPLAVAKIVKGIADEEQPGLIITGKQ 120

Query: 119 TTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDL 178
             D++SNQ GQM+AAL+  PQ TF + + +  +  +V RE+  G  T+   LPAV+T DL
Sbjct: 121 AIDDDSNQVGQMVAALLGRPQGTFANEVSVEGDAVVVKREIDGGLQTVRLALPAVVTTDL 180

Query: 179 NLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKL 238
            LNEPRY SLPNI+KA+ K +  K   D+ +D+  RLK L+  E      G+++     L
Sbjct: 181 RLNEPRYASLPNIMKAKSKPLANKTPADYGVDVAARLKTLKVSEPPVRSAGIKVADVDAL 240

Query: 239 IEILK 243
           +  LK
Sbjct: 241 VAKLK 245


>gi|330967024|gb|EGH67284.1| electron transfer flavoprotein subunit beta [Pseudomonas syringae
           pv. actinidiae str. M302091]
          Length = 249

 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    +E L+ +LA+GADR +L+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VTIGPTTAQEQLRTALALGADRAVLVESAEELTSLAVAKLLKAVVDKEQPRLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  + Q TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALSGYAQGTFASKVEVSGDKVAVTREIDGGLQTVSLSLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEVLTPDALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|114761484|ref|ZP_01441399.1| electron transfer flavoprotein, beta subunit [Pelagibaca
           bermudensis HTCC2601]
 gi|114545732|gb|EAU48734.1| electron transfer flavoprotein, beta subunit [Roseovarius sp.
           HTCC2601]
          Length = 247

 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 119/240 (49%), Positives = 171/240 (71%), Gaps = 4/240 (1%)

Query: 5   VPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIG 64
           +P+K VI+YN KVR+K D SG++  N K+SMNPFDEIA+EE+++L+E G A EVIVVSIG
Sbjct: 1   MPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKAEEVIVVSIG 60

Query: 65  SCKVEEVLKNSLAMGADRGILIES----NETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
             + +E L+  LAMGADR IL+ +    +E +EPL++AK+L  IVK+E P +VI GKQ  
Sbjct: 61  VKQAQETLRTGLAMGADRAILVTAADDVHEDIEPLAVAKLLAAIVKEEEPGLVICGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           DN+ N TGQMLAAL  + QAT  +++++  + A V REV  G  T++  LPA++T DL L
Sbjct: 121 DNDLNATGQMLAALTGYAQATNANSLEVDGDAATVAREVDGGLQTIKVKLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +++K   D+ +D+ PRL++++  E      G+ + S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLDEKTPADYGVDVAPRLEIVKTAEPAERAAGIMVGSVDELVE 240


>gi|304388791|ref|ZP_07370847.1| electron transfer flavoprotein beta subunit [Neisseria meningitidis
           ATCC 13091]
 gi|304337243|gb|EFM03421.1| electron transfer flavoprotein beta subunit [Neisseria meningitidis
           ATCC 13091]
          Length = 249

 Score =  242 bits (617), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 168/245 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR I +E++  LE L++AK+L+ +  KENP I   GKQ  
Sbjct: 61  VSLGEKKCEETLRTALAMGADRAIHVETDTKLESLAVAKLLKAVADKENPQIFFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TF S + I      + RE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFASKVHIEGGEVQIVREIDGGEETIALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D   D++PRLK ++F E +A + G+++ S  +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKLLEKLTPDDLVADISPRLKTVKFAEPKARQAGVKVASVAELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|254671282|emb|CBA08608.1| electron transfer flavoprotein beta-subunit [Neisseria meningitidis
           alpha153]
 gi|325143390|gb|EGC65719.1| electron transfer flavoprotein, beta subunit [Neisseria
           meningitidis 961-5945]
 gi|325199229|gb|ADY94685.1| electron transfer flavoprotein, beta subunit [Neisseria
           meningitidis G2136]
 gi|325205100|gb|ADZ00554.1| electron transfer flavoprotein, beta subunit [Neisseria
           meningitidis M01-240355]
          Length = 249

 Score =  242 bits (617), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 168/245 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR I +E++  LE L++AK+L+ +  KENP I   GKQ  
Sbjct: 61  VSLGEKKCEETLRTALAMGADRAIHVETDTKLESLAVAKLLKAVADKENPQIFFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TF S + I      + RE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFASKVHIEGGEVQIVREIDGGEETIALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D   D++PRLK ++F E +A + G+++ S  +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLTPDDLVADISPRLKTVKFAEPKARQAGVKVASVAELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|34499273|ref|NP_903488.1| electron transfer flavoprotein subunit beta [Chromobacterium
           violaceum ATCC 12472]
 gi|34105124|gb|AAQ61480.1| probable electron transfer flavoprotein, beta subunit
           [Chromobacterium violaceum ATCC 12472]
          Length = 249

 Score =  242 bits (617), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 171/249 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADGSDVDIANVKMSMNPFDEIAVEEAVRLKEAGKVSEIVT 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + EE L+ +LAMGADR IL+E++  L+PL++AK+L+ +  KE P +VI GKQ  
Sbjct: 61  VSMGVKQCEETLRTALAMGADRAILVETDVELQPLAVAKLLKAVADKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQM +AL+ W Q TF S + +      V RE+  G  T++  LPAV+T DL L
Sbjct: 121 DDDANQTGQMTSALLGWSQGTFASKVDLAAETVDVIREIDGGLETVKLRLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LPNI+ A+KK ++K    +  +D  PRLK L+  E      G+++ +  +L+ 
Sbjct: 181 NEPRFIKLPNIMAAKKKPLDKTTPAELGVDAAPRLKTLKVAEPAKRSAGIKVANAAELVA 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAKVL 249


>gi|325133323|gb|EGC55989.1| electron transfer flavoprotein, beta subunit [Neisseria
           meningitidis M13399]
 gi|325143557|gb|EGC65878.1| electron transfer flavoprotein, beta subunit [Neisseria
           meningitidis M01-240013]
          Length = 249

 Score =  242 bits (617), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 169/245 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR I +E++  LE L++AK+L+ +  KENP I   GKQ  
Sbjct: 61  VSLGEKKCEETLRTALAMGADRAIHVETDTKLESLAVAKLLKAVADKENPQIFFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TF S ++I  +   + RE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFASKVQIEGDEVQIVREIDGGEETIALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D   D++PRLK ++F E +A + G+++    +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLTPDDLVADISPRLKTVKFAEPKARQAGVKVAGVAELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|315126667|ref|YP_004068670.1| electron transfer flavoprotein subunit beta [Pseudoalteromonas sp.
           SM9913]
 gi|315015181|gb|ADT68519.1| electron transfer flavoprotein subunit beta [Pseudoalteromonas sp.
           SM9913]
          Length = 249

 Score =  242 bits (617), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 177/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVPIK VI+YN K R+K D SG++  N K++MNPF EIA+EE+++L+E G A+EV+V
Sbjct: 1   MKVLVPIKRVIDYNVKARVKPDNSGVDLTNVKMAMNPFCEIAVEEAIRLKEAGTASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG+   +E L+ +LA+GAD+ I +E+ + LE L IAK+L ++V++E+P +VI GKQ+ 
Sbjct: 61  VTIGAKASQEQLRTALALGADKAIHVETEQNLESLHIAKLLAKVVEQESPELVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL    Q TF S + I +    VTREV  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALTNRGQGTFASKVVIENGKVNVTREVDGGLQTVALNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K +E   A    +DLTPR++V+R EE      G+ +    +L+E
Sbjct: 181 NEPRYASLPNIMKAKRKPLEVIAADSLGVDLTPRIEVVRVEEPAKRSGGIIVEDVAQLVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKTEAKVI 249


>gi|225025325|ref|ZP_03714517.1| hypothetical protein EIKCOROL_02223 [Eikenella corrodens ATCC
           23834]
 gi|224941943|gb|EEG23152.1| hypothetical protein EIKCOROL_02223 [Eikenella corrodens ATCC
           23834]
          Length = 249

 Score =  241 bits (616), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 174/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++V
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAMEEAVRLKEAGKISEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + EE L+ +LAMG DR I +++++ LEPL++AK+LR+I ++E P +++ GKQ  
Sbjct: 61  VSLGVKQCEETLRTALAMGGDRAIHVQTDDYLEPLAVAKLLRKIAEREQPQLILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQT QMLAAL+  PQ TF S +++ +N   V REV  G  T+   LPAV++ DL L
Sbjct: 121 DDDANQTAQMLAALLNAPQGTFASKVELGENEVTVVREVDGGLETVALKLPAVVSADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY+ LPNI++A+KK +EK    +  +D+ P+L+  +  E +    G+++ S  +L+ 
Sbjct: 181 NEPRYVKLPNIMQAKKKPLEKLAVEELGVDIAPKLQQQKVAEPKPRSGGVKVQSVAELVA 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|121635798|ref|YP_976043.1| electron transfer flavoprotein beta-subunit [Neisseria meningitidis
           FAM18]
 gi|120867504|emb|CAM11281.1| electron transfer flavoprotein beta-subunit [Neisseria meningitidis
           FAM18]
 gi|254672624|emb|CBA06381.1| electron transfer flavoprotein beta-subunit [Neisseria meningitidis
           alpha275]
 gi|261393467|emb|CAX51113.1| electron transfer flavoprotein beta-subunit (beta-ETF; electron
           transfer flavoprotein small subunit; ETFSS) [Neisseria
           meningitidis 8013]
 gi|325131239|gb|EGC53951.1| electron transfer flavoprotein, beta subunit [Neisseria
           meningitidis M6190]
          Length = 249

 Score =  241 bits (616), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 168/245 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR I +E++  LE L++AK+L+ +  KENP I   GKQ  
Sbjct: 61  VSLGEKKCEETLRTALAMGADRAIHVETDTKLESLAVAKLLKAVADKENPQIFFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TF S + I      + RE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFASKVHIECGEVQIVREIDGGEETIALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D   D++PRLK ++F E +A + G+++ S  +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLTPDDLVADISPRLKTVKFAEPKARQAGVKVASVAELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|325525842|gb|EGD03567.1| electron transfer flavoprotein beta-subunit [Burkholderia sp.
           TJI49]
          Length = 249

 Score =  241 bits (616), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 174/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V+++N KVR+K D SG++ +N K+S+NPF EIA+EE+++L+E+GIATEV+ 
Sbjct: 1   MKILVTVKRVVDHNVKVRVKTDNSGVDLDNVKMSINPFCEIAVEEAVRLKEQGIATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G+   +E L+ +LA+GADR IL+ES E L  L++AK+L+ IV++E P +++ GKQ  
Sbjct: 61  VSVGTSAAQEQLRTALALGADRAILVESGEPLASLAVAKLLKVIVEREQPQLILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  + Q TF S I+I      VTREV  G  T+   LPAV+TVDL  
Sbjct: 121 DSDNNQTGQMLAALTGYAQGTFASRIEIAAQSGTVTREVDGGLQTVALTLPAVVTVDLRP 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLP+I+KA+KK +E   A    ++    ++ LR +       G+R+ S  +L+E
Sbjct: 181 NEPRYASLPSIMKAKKKPLEVCSAASLGVETVSSVRTLRVDAPPMRNAGVRVGSVDELVE 240

Query: 241 ILKSKHDLL 249
            LK +  ++
Sbjct: 241 KLKQEAKVI 249


>gi|119470318|ref|ZP_01613077.1| Electron transfer flavoprotein beta-subunit [Alteromonadales
           bacterium TW-7]
 gi|119446490|gb|EAW27765.1| Electron transfer flavoprotein beta-subunit [Alteromonadales
           bacterium TW-7]
          Length = 249

 Score =  241 bits (615), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 173/245 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVPIK VI+YN K R+K+D S ++  N K++MNPF EIA+EE+++L+E G ATEV+ 
Sbjct: 1   MKVLVPIKRVIDYNVKARVKSDNSDVDLTNVKMAMNPFCEIAIEEAIRLKEAGTATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG+   +E L+ +LA+GAD+ I IE++E LE L IAK+L +IV++E P +VI GKQ+ 
Sbjct: 61  VTIGAKTSQEQLRTALALGADKAIHIETDEKLESLHIAKLLAKIVEQEAPELVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL    Q TF S + + D    VTREV  G  T+   LPA+IT DL L
Sbjct: 121 DSDNNQTGQMLAALTNRGQGTFASKVVVADGKVNVTREVDGGLQTVALSLPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K ++   A    +DLTPR++++  EE      G+ +    +L+E
Sbjct: 181 NEPRYASLPNIMKAKRKPLDVIAADSLGVDLTPRIQLVSVEEPAKRSGGIIVEDVAQLVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKTE 245


>gi|187921012|ref|YP_001890044.1| electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           phytofirmans PsJN]
 gi|187719450|gb|ACD20673.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           phytofirmans PsJN]
          Length = 207

 Score =  241 bits (615), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 153/196 (78%), Gaps = 2/196 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR ILIES++ L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSAGVTQSQETLRTALAIGADRAILIESSQELQPLAVAKLLKALVDKEQPSLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHG--TMTMETPLPAVITVDL 178
           D++SNQTGQMLAAL   PQATF S + + D  A V+REV  G  T+++   LPAV+T DL
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVVVADGKATVSREVDGGAETLSLSLTLPAVVTTDL 180

Query: 179 NLNEPRYISLPNIIKA 194
            LNEPRY++LPNI+ A
Sbjct: 181 RLNEPRYVTLPNIMTA 196


>gi|114563913|ref|YP_751427.1| electron transfer flavoprotein beta-subunit [Shewanella
           frigidimarina NCIMB 400]
 gi|114335206|gb|ABI72588.1| electron transfer flavoprotein beta-subunit [Shewanella
           frigidimarina NCIMB 400]
          Length = 249

 Score =  241 bits (615), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 120/245 (48%), Positives = 173/245 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++ N KVR+K D + ++T N K+++NPF EIA+EE+++L+E GIATEV+V
Sbjct: 1   MKVLVPVKRVVDANVKVRVKADNTNVDTTNLKMALNPFCEIAVEEAVRLKEAGIATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G   V+E L+ ++A+GADR I IE++E L PLSIAK+L+ + +KE   +VI GKQ+ 
Sbjct: 61  VSVGPKAVQEQLRTAMALGADRAIHIETDEELVPLSIAKLLKAVQEKEQAQLVIFGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAAL   PQATF S +KI  +   VTRE+  G  T++ PLPA++TVDL L
Sbjct: 121 DGDNNQTGQMLAALTDMPQATFASKVKIDGDMITVTREIDGGLQTLKMPLPAIVTVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K +E     D  + L     VL        + G+ + S  +L++
Sbjct: 181 NEPRYASLPNIMKAKRKPLEIMAVADLGVSLRAHQTVLSVTPPVDRKAGIMVSSVEELVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|332304756|ref|YP_004432607.1| Electron transfer flavoprotein alpha/beta-subunit [Glaciecola
           agarilytica 4H-3-7+YE-5]
 gi|332172085|gb|AEE21339.1| Electron transfer flavoprotein alpha/beta-subunit [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 249

 Score =  241 bits (614), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 169/245 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVPIK VI+YN KVR+K D S ++  NTK+ +NPFDEIA+EE+++L+E  IATEVI 
Sbjct: 1   MKILVPIKRVIDYNLKVRVKKDNSDVDLSNTKMGVNPFDEIAIEEAIRLKEASIATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           +S G+    +VL+ +LA+GADR IL+E     EPL++AK++  +  KE   ++I GKQ  
Sbjct: 61  ISCGTSASTDVLRTALALGADRAILVELEHNPEPLAVAKLISAVCAKEQVKLIICGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQM AAL+ W QATF S IKI  + A V RE+  G  T++  LPAV+T DL L
Sbjct: 121 DDDCNQTGQMTAALLDWSQATFASEIKIEGDSAFVVREIDGGLETLKVALPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +L NI++A++K I+   A+D  +D++PR+ +L+  E      G  + +   L+E
Sbjct: 181 NEPRYATLSNIMQAKRKPIDVITASDLGVDVSPRVSLLKVMEPPTRTAGEMVANVDVLLE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKTE 245


>gi|313497951|gb|ADR59317.1| Electron transfer flavoprotein, beta subunit [Pseudomonas putida
           BIRD-1]
          Length = 249

 Score =  241 bits (614), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G    +E L+ +LA+GADR IL+E+ + L  L++AK L+ +V KE P +VI GKQ  
Sbjct: 61  VSVGPTTAQEQLRTALALGADRAILVEAADELNSLAVAKALKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  + Q TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALTGFAQGTFASKVEVAGDKLNVTREIDGGLQTVALNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        + L    K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLETVTPDALGVSLASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|294789121|ref|ZP_06754360.1| electron transfer flavoprotein, beta subunit [Simonsiella muelleri
           ATCC 29453]
 gi|294482862|gb|EFG30550.1| electron transfer flavoprotein, beta subunit [Simonsiella muelleri
           ATCC 29453]
          Length = 248

 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 114/244 (46%), Positives = 171/244 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V+++N KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G   EV+ 
Sbjct: 1   MKALVAVKRVVDFNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKESGKINEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K E+VL+ +LAMGADR I +E++E LEPL +AK+L+++  KE P I + GKQ  
Sbjct: 61  VSLGEKKCEDVLRTALAMGADRAIHVETDEKLEPLLVAKMLQKLAVKEQPQIFLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQT QMLAAL+  PQAT  + + + D+  +V RE+  GT T+   LPAVI+ DL L
Sbjct: 121 DDDSNQTAQMLAALLHAPQATCAAQVDLNDDEVVVVREIDGGTETVALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPN++ A+KK +EK    D  +D+  RL+ ++  E +A + G ++ +  +L+ 
Sbjct: 181 NEPRFVKLPNLMAAKKKSLEKMMPADLGMDVKTRLETVKVSEPKARQAGEKVDTVEELVA 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKA 244


>gi|170722690|ref|YP_001750378.1| electron transfer flavoprotein alpha/beta-subunit [Pseudomonas
           putida W619]
 gi|169760693|gb|ACA74009.1| Electron transfer flavoprotein alpha/beta-subunit [Pseudomonas
           putida W619]
          Length = 249

 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+A+E++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVASEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G    +E L+ +LA+GADR IL+E+ + L  L++AK L+ +V KE P +VI GKQ  
Sbjct: 61  VSVGPTTAQEQLRTALALGADRAILVEAADELNSLAVAKALKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  + Q TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALTGYAQGTFASKVEVAGDKLNVTREIDGGLQTVALNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        + L    K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLETLTPDALGVSLASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|325137413|gb|EGC60001.1| electron transfer flavoprotein, beta subunit [Neisseria
           meningitidis ES14902]
          Length = 249

 Score =  240 bits (612), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 168/245 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV ++ V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVRRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR I +E++  LE L++AK+L+ +  KENP I   GKQ  
Sbjct: 61  VSLGEKKCEETLRTALAMGADRAIHVETDTKLESLAVAKLLKAVADKENPQIFFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TF S + I      + RE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFASKVHIECGEVQIVREIDGGEETIALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D   D++PRLK ++F E +A + G+++ S  +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLTPDDLVADISPRLKTVKFAEPKARQAGVKVASVAELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|1173889|gb|AAA86623.1| FlaX [Neisseria meningitidis]
          Length = 249

 Score =  240 bits (612), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 168/245 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K EE L+ +LAMGADR I +E++  LE L++AK+L+ +  KENP I   GKQ  
Sbjct: 61  VSLGEKKPEETLRTALAMGADRAIHVETDTKLESLAVAKLLKAVADKENPQIFFLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+   Q TF S + I      + RE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQVAQMLAALLNAAQGTFASKVHIECGEVQIVREIDGGEETIALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI+ A+KK +EK    D   D++PRLK ++F E +A + G+++ S  +L+E
Sbjct: 181 NEPRFVKLPNIMAAKKKPLEKLTPDDLVADISPRLKTVKFAEPKARQAGVKVASVAELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|301106072|ref|XP_002902119.1| electron transfer flavoprotein subunit beta [Phytophthora infestans
           T30-4]
 gi|23394375|gb|AAN31477.1| electron transfer flavoprotein beta subunit [Phytophthora
           infestans]
 gi|262098739|gb|EEY56791.1| electron transfer flavoprotein subunit beta [Phytophthora infestans
           T30-4]
          Length = 251

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 113/253 (44%), Positives = 180/253 (71%), Gaps = 6/253 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++Y  K+R+  +  G++ +N K+SMNPF EIA+EE+++L+EK +A+E++ 
Sbjct: 1   MKVLVPVKRVVDYAVKIRV--EPKGVDLKNVKMSMNPFCEIAVEEAIRLKEKKVASEIVA 58

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADRGI I     +++ L+PL++AK+L+E+V KE P +VI G
Sbjct: 59  VSIGPKQSQETLRTALAMGADRGIHITTDMRTDQELQPLAVAKLLKEVVAKEGPKLVICG 118

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ+ D ++ QTG MLA L+ W Q TF S++ +  +   +TRE   G  T++  LPAV+T 
Sbjct: 119 KQSIDADAAQTGPMLAGLLDWSQGTFASDVAVDGDAVNITRETDSGVETLKLGLPAVVTA 178

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+IE   A  F +DL PR+ V+  ++  + + G+++ S  
Sbjct: 179 DLRLNEPRYATLPNIMKAKKKKIETLAADSFGVDLAPRIDVVEVKDPASRKAGIKVASVD 238

Query: 237 KLIEILKSKHDLL 249
           +L++ LK++  ++
Sbjct: 239 ELVDKLKNEAGVI 251


>gi|268590786|ref|ZP_06125007.1| electron transfer flavoprotein, beta subunit [Providencia rettgeri
           DSM 1131]
 gi|291313564|gb|EFE54017.1| electron transfer flavoprotein, beta subunit [Providencia rettgeri
           DSM 1131]
          Length = 251

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 127/252 (50%), Positives = 181/252 (71%), Gaps = 9/252 (3%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI++N K+R+K D SG+E  N K+++NPFDEIA+EE+++L+E G ATEVI 
Sbjct: 1   MKILVAVKRVIDHNVKIRVKADGSGVELANVKMAINPFDEIAVEEAVRLKEAGKATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE-SNE-TLEPLSIAKILREIVKKENPIIVIAGKQ 118
           VSIG    +E L++++A+GADRGIL++ S E TLEPL IA++L++IV++E P +++ GKQ
Sbjct: 61  VSIGDIGYQETLRSAMAIGADRGILVQRSGELTLEPLDIARLLQQIVEREQPDLILLGKQ 120

Query: 119 TTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDL 178
             D++ NQ GQML+AL+ +PQATF S +K       VTRE+  G  T+E PLPAVIT DL
Sbjct: 121 AIDDDCNQIGQMLSALLDYPQATFASQVKFEGQSLQVTREIDGGLETLEMPLPAVITTDL 180

Query: 179 NLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTP--RLKVLRFEE--NRAERKGLRLYS 234
            LNEPRY +LPNI+KA+KK ++    TD  +D  P  +++ L   E   RA +  L L S
Sbjct: 181 RLNEPRYATLPNIMKAKKKTLDIIDITD--MDFIPLGQIRTLSVSEPKKRAGQCTL-LSS 237

Query: 235 TTKLIEILKSKH 246
            T+L+ +L++K 
Sbjct: 238 ATELVSVLQAKE 249


>gi|167034769|ref|YP_001670000.1| electron transfer flavoprotein alpha/beta-subunit [Pseudomonas
           putida GB-1]
 gi|166861257|gb|ABY99664.1| Electron transfer flavoprotein alpha/beta-subunit [Pseudomonas
           putida GB-1]
          Length = 249

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G    +E L+ +LA+GADR IL+E+ + L  L++AK L+ +V KE P +VI GKQ  
Sbjct: 61  VSVGPTTAQEQLRTALALGADRAILVEAADELNSLAVAKALKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  + Q TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALTGYAQGTFASKVELAGDKLNVTREIDGGLQTVALNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        + L    K ++ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLETVTPDALGVSLASTNKTVKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|26990894|ref|NP_746319.1| electron transfer flavoprotein, beta subunit [Pseudomonas putida
           KT2440]
 gi|148546889|ref|YP_001266991.1| electron transfer flavoprotein, alpha/beta-subunit-like protein
           [Pseudomonas putida F1]
 gi|24985908|gb|AAN69783.1|AE016614_9 electron transfer flavoprotein, beta subunit [Pseudomonas putida
           KT2440]
 gi|148510947|gb|ABQ77807.1| Electron transfer flavoprotein, alpha/beta-subunit-like protein
           [Pseudomonas putida F1]
          Length = 249

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G    +E L+ +LA+GADR IL+E+ + L  L++AK L+ +V KE P +VI GKQ  
Sbjct: 61  VSVGPTTAQEQLRTALALGADRAILVEAADELNSLAVAKALKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  + Q TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALTGFAQGTFASKVEVAGDKLNVTREIDGGLQTVALNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        + L    K ++ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLETVTPDALGVSLASTNKTVKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|119476193|ref|ZP_01616545.1| Electron transfer flavoprotein, beta subunit [marine gamma
           proteobacterium HTCC2143]
 gi|119450820|gb|EAW32054.1| Electron transfer flavoprotein, beta subunit [marine gamma
           proteobacterium HTCC2143]
          Length = 249

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V + N KVR K+D SG +  N K+++NPF EIA+EE+++++E G ATE+I 
Sbjct: 1   MKVLVAVKRVADANVKVRPKSDGSGADLNNVKMAINPFCEIAVEEAVRMKEAGTATEIIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E ++ SLA+GADRGI +E++ +++PL+IAK+L+ +V KE P ++I GKQ+ 
Sbjct: 61  VSIGDKSCQEQIRTSLALGADRGIQVEADNSIQPLAIAKLLKAVVDKEQPDLIILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAAL    Q TF S I ++D    VTRE+  G  T+   LPAV+T DL L
Sbjct: 121 DGDNNQTGQMLAALAGLGQGTFASEITVVDGKLNVTREIDGGLQTITLSLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++   A D  +D+ PRL  ++ E       G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDVFTAEDLGVDVAPRLTTVKVEPPAERAAGIKVESVAELVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|330842209|ref|XP_003293075.1| hypothetical protein DICPUDRAFT_50761 [Dictyostelium purpureum]
 gi|325076636|gb|EGC30407.1| hypothetical protein DICPUDRAFT_50761 [Dictyostelium purpureum]
          Length = 248

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 112/243 (46%), Positives = 171/243 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVPIK V++Y  K+R+K+D SG+ET N K+SMNPFDEIA+EE+++L+EKGIA E+  
Sbjct: 1   MKILVPIKRVVDYAVKIRVKSDKSGVETANVKMSMNPFDEIAVEEAIRLKEKGIAKEIAA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E ++ ++AMGAD GI +E+++ L+PL++AK+L+++V+ E P ++I GKQ  
Sbjct: 61  VSMGPKQSQETIRTAIAMGADTGIHVETDKELQPLAVAKLLQKLVETEKPQLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQT QMLA L+ WPQATF S + I D+   VTRE+  G  T+   LPA+++ DL L
Sbjct: 121 DDDCNQTAQMLAGLLNWPQATFASKVDIKDDKVHVTREIDGGLETLSMKLPAIVSCDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  L NI+K++K ++         +D T  L  +  EE    + G+++ +  +++E
Sbjct: 181 NEPRYAKLQNIMKSKKAQLNVLTPEKLGVDTTSHLSTVSVEEPPKRKGGVKVENIDQVVE 240

Query: 241 ILK 243
            LK
Sbjct: 241 GLK 243


>gi|326796139|ref|YP_004313959.1| electron transfer flavoprotein alpha/beta-subunit [Marinomonas
           mediterranea MMB-1]
 gi|326546903|gb|ADZ92123.1| Electron transfer flavoprotein alpha/beta-subunit [Marinomonas
           mediterranea MMB-1]
          Length = 250

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 176/249 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+YN KVRIK D+S ++  N K+SMNPF EIA+EE+++L+EKG+ +E+IV
Sbjct: 1   MKILVAVKRVIDYNVKVRIKPDHSAVDLTNIKMSMNPFCEIAVEEAIRLKEKGVVSEIIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            SIGS   +E L+ +LA+GADR I +E+ + L+ LS+AK+L +IVK+E   +VI GKQ  
Sbjct: 61  ASIGSKACQETLRTALALGADRAIQVEAEDALDSLSVAKLLSKIVKEEGTDLVIMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+  PQATF S + I    AIVTREV  G  T+   LPAVIT DL L
Sbjct: 121 DSDNNQTGQMLAALLDAPQATFASEVAIEGGEAIVTREVDGGLQTLAVKLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+  LP+I+KA++K ++ K   D  +++   L+++          G+++ S ++L++
Sbjct: 181 NEPRFAKLPDIMKAKRKPLDVKTPEDLGVEIKSTLEIVSVTPPPERSGGVKVGSVSELVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|326566548|gb|EGE16694.1| electron transfer flavoprotein alpha/beta-subunit-like protein
           [Moraxella catarrhalis 12P80B1]
          Length = 249

 Score =  239 bits (610), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 174/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI++N KVR+K D SG+E  N K+S+NPF EIA+EE+++L+EKG+A+E+I 
Sbjct: 1   MKILVAVKRVIDHNVKVRVKADESGVELANAKMSVNPFCEIAIEEAVRLKEKGVASEIIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+ +  E ++++LA+GADRGIL+E++   +PL +AKIL+ + + E   IV+ GKQ  
Sbjct: 61  VSIGTSQSSEQIRSALALGADRGILVETDAKAQPLQVAKILKGVAEAEGVQIVLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAALM   Q TF S + +  +   VTRE+  G  T+  PLPAVIT DL L
Sbjct: 121 DDDNNQTGQMLAALMGVGQGTFASEVVVEGDKVHVTREIDGGLQTVALPLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+  LPNI+ A+KK ++ K   DF +++  +L+ ++    +    G+++ S  +LI+
Sbjct: 181 NEPRFPKLPNIMAAKKKPLDTKSPADFGVEMNAKLETIKVSAPKERSAGVKVSSVDELID 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|325275394|ref|ZP_08141338.1| electron transfer flavoprotein alpha/beta-subunit [Pseudomonas sp.
           TJI-51]
 gi|324099478|gb|EGB97380.1| electron transfer flavoprotein alpha/beta-subunit [Pseudomonas sp.
           TJI-51]
          Length = 249

 Score =  239 bits (610), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 114/249 (45%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+A+E++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVASEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G    +E L+ +LA+GADR IL+E+ + L  L++AK L+ +V KE P ++I GKQ  
Sbjct: 61  VSVGPTTAQEQLRTALALGADRAILVEAADELNSLAVAKALKAVVDKEQPQLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  + Q TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALTGYAQGTFASKVEVAGDKLNVTREIDGGLQTVALNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        + L    K ++ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLETHAPDALGVSLASTNKTVKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|332305100|ref|YP_004432951.1| Electron transfer flavoprotein alpha/beta-subunit [Glaciecola
           agarilytica 4H-3-7+YE-5]
 gi|332172429|gb|AEE21683.1| Electron transfer flavoprotein alpha/beta-subunit [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 249

 Score =  239 bits (609), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 176/249 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+YN KVR+K D S ++  N K++MNPF EIA+EE+++L+E G+A+EV+V
Sbjct: 1   MKILVAVKRVIDYNVKVRVKADNSDVDLTNVKMAMNPFCEIAVEEAVRLKESGVASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+   +E ++ +LA+GADRGI IE +   + LSI+K+L+ +V +E P +VI GKQ+ 
Sbjct: 61  VSIGAKACQEQIRTALALGADRGIQIELDTAADALSISKLLKAVVDEEQPGLVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+  PQATF S +K+  +   VTRE+  G  T+E  +PA+IT DL L
Sbjct: 121 DSDNNQTGQMLAALLDQPQATFASEVKVDGDKVQVTREIDGGLQTLELSMPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K +E K   D  +++   + +         + G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKRKPLEVKTPADLGVEVRNNITLDSVSAPAQRQAGIKVESVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAKVL 249


>gi|326560886|gb|EGE11251.1| electron transfer flavoprotein alpha/beta-subunit-like protein
           [Moraxella catarrhalis 7169]
 gi|326563877|gb|EGE14128.1| electron transfer flavoprotein alpha/beta-subunit-like protein
           [Moraxella catarrhalis 46P47B1]
 gi|326566886|gb|EGE17025.1| electron transfer flavoprotein alpha/beta-subunit-like protein
           [Moraxella catarrhalis 103P14B1]
 gi|326569785|gb|EGE19835.1| electron transfer flavoprotein alpha/beta-subunit-like protein
           [Moraxella catarrhalis BC8]
 gi|326570816|gb|EGE20841.1| electron transfer flavoprotein alpha/beta-subunit-like protein
           [Moraxella catarrhalis BC1]
 gi|326575112|gb|EGE25040.1| electron transfer flavoprotein alpha/beta-subunit-like protein
           [Moraxella catarrhalis CO72]
 gi|326576802|gb|EGE26709.1| electron transfer flavoprotein alpha/beta-subunit-like protein
           [Moraxella catarrhalis 101P30B1]
 gi|326577745|gb|EGE27621.1| electron transfer flavoprotein alpha/beta-subunit-like protein
           [Moraxella catarrhalis O35E]
          Length = 249

 Score =  239 bits (609), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 174/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V+++N KVR+K D SG+E  N K+S+NPF EIA+EE+++L+EKG+A+E+I 
Sbjct: 1   MKILVAVKRVVDHNVKVRVKADESGVELANAKMSVNPFCEIAIEEAVRLKEKGVASEIIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+ +  E ++++LA+GADRGIL+E++   +PL +AKIL+ + + E   IV+ GKQ  
Sbjct: 61  VSIGTSQSSEQIRSALALGADRGILVETDAKAQPLQVAKILKGVAEAEGVQIVLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAALM   Q TF S + +  +   VTRE+  G  T+  PLPAVIT DL L
Sbjct: 121 DDDNNQTGQMLAALMGVGQGTFASEVVVEGDKVHVTREIDGGLQTVALPLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+  LPNI+ A+KK ++ K   DF +++  +L+ ++    +    G+++ S  +LI+
Sbjct: 181 NEPRFPKLPNIMAAKKKPLDTKSPADFGVEMNAKLETIKVSAPKERSAGVKVSSVDELID 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|77360559|ref|YP_340134.1| electron transfer flavoprotein subunit beta [Pseudoalteromonas
           haloplanktis TAC125]
 gi|76875470|emb|CAI86691.1| Electron transfer flavoprotein beta-subunit (Beta-ETF) (Electron
           transfer flavoprotein small subunit) (ETFSS)
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 249

 Score =  238 bits (608), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 174/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVPIK VI+YN K R+K+D + ++  N K++MNPF EIA+EE+++L+E G A+EVI 
Sbjct: 1   MKVLVPIKRVIDYNVKARVKSDKTDVDLTNVKMAMNPFCEIAIEEAIRLKEAGTASEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    +E L+ +LA+GAD+ I IE++E LE L IAK+L +IV++E P +VI GKQ+ 
Sbjct: 61  VTIGPKASQEQLRTALALGADKAIHIETDEKLESLHIAKLLAKIVEQEAPELVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL +  Q TF S ++++D    VTREV  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALTKRGQGTFASKVEVVDGKVNVTREVDGGLQTVALNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K +E   A    +DLT R++++  EE      G+ +    +L+E
Sbjct: 181 NEPRYASLPNIMKAKRKPLEVIAADTLGVDLTARVQLISVEEPAKRTAGIIVEDVAQLVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKTE 245


>gi|85713222|ref|ZP_01044250.1| Electron transfer flavoprotein, beta subunit [Idiomarina baltica
           OS145]
 gi|85692965|gb|EAQ30935.1| Electron transfer flavoprotein, beta subunit [Idiomarina baltica
           OS145]
          Length = 249

 Score =  238 bits (608), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 174/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+YN KVR+K D S ++  N K+++NPF EIA+EE+++L+E G A EV+V
Sbjct: 1   MKILVAVKRVIDYNVKVRVKPDQSDVDLANVKMALNPFCEIAVEEAVRLKEAGTADEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG   V+E L+ +LA+GADR I +E+++  + LS AKIL+ +V++E P ++I GKQ+ 
Sbjct: 61  VSIGPKAVQEQLRTALALGADRAIQVETDDMPDSLSAAKILKGVVEREEPDMIILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQ TF S +++ D H  VTREV  G  T++  LPAV+T DL L
Sbjct: 121 DSDNNQTGQMLAALTDMPQGTFASKVEVADGHVSVTREVDGGLQTVKLALPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K +E     D  + +   +K+L+ E       G+++    +L++
Sbjct: 181 NEPRYASLPNIMKAKRKPLETVSTDDLDVSVKRTVKLLKVESPAERSAGVKVADVDELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAKVL 249


>gi|186474760|ref|YP_001863731.1| electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           phymatum STM815]
 gi|184198719|gb|ACC76681.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           phymatum STM815]
          Length = 446

 Score =  238 bits (606), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 171/245 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK++  +K V++YN KVR+K D +G++  N K+SMNPFDEIA+E + +L+E   A++VI 
Sbjct: 198 MKVMAAVKRVVDYNVKVRVKADQTGVDIGNVKMSMNPFDEIAIEAATRLKEASHASDVIA 257

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+ G  +  E L+ +LA+GADR + I+++  L+PL++AK+L+  V++E P +VI GKQ  
Sbjct: 258 VTCGPTQSAETLRTALAIGADRALHIQTDVELQPLAVAKLLKAAVEREQPQLVILGKQAI 317

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++ QTGQ+LAAL+ WPQATF S I+I  N   VTREV  G   +E  LPA++T DL L
Sbjct: 318 DDDAGQTGQLLAALLDWPQATFASAIEIQGNTVTVTREVDGGFEVIELDLPAIVTTDLRL 377

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LP+I+KA+KK ++     +  +D  PRLK L+  E  A + G+R+     LI+
Sbjct: 378 NEPRYVTLPSIMKAKKKPLDILTPAELGVDPAPRLKTLKVVEPAARKAGVRVPDVATLID 437

Query: 241 ILKSK 245
            L+++
Sbjct: 438 KLRNE 442


>gi|297171085|gb|ADI22097.1| electron transfer flavoprotein, beta subunit [uncultured
           Planctomycetales bacterium HF0200_11L05]
          Length = 250

 Score =  238 bits (606), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVPIK V++YN KVR K+D +G +  N K+++NPF EIA+EE+++LRE   A EVI 
Sbjct: 1   MKVLVPIKRVVDYNVKVRAKSDETGPDLANVKMAINPFCEIAVEEAVRLRESETAQEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+GS   +E L+ +LA+GADR IL+E+   +EPL +AK+L+ +V+KE P ++I GKQ  
Sbjct: 61  VSVGSNACQEQLRTALALGADRAILVETELEVEPLGVAKLLKAVVEKERPDLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLA+L+ + Q TF S IKI  N   VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLASLLSYAQGTFASEIKIEGNKIDVTREVDGGLQTVSLNLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++     +  +D +PR++ L+         G+ + S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLDTLTPEELNVDASPRIETLKVSPPPERAAGVIVESVDELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|63054923|gb|AAY29000.1| electron transfer flavoprotein beta subunit [Stenotrophomonas
           maltophilia]
          Length = 248

 Score =  238 bits (606), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 117/245 (47%), Positives = 165/245 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ T+  K+S NPFDEIALEE+L+LR+KGIATEVIV
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVVTDGVKLSPNPFDEIALEEALRLRDKGIATEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            +I     +  L+N LAMGA+R I + +++ ++PL+ A+ L ++V+KE P +VI GKQ  
Sbjct: 61  ATISPADAQAHLRNGLAMGANRAIHVVTDQAIQPLTAARTLLKLVEKEQPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF S ++I D  A VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFASKLEIADGKATVTREVDAGLETLEVDLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LP+I+KA+ K +E  +  D  +D     K  ++       KG+ +    +L+ 
Sbjct: 181 NEPRFIKLPDIMKAKAKPLETLQLADLGVDAADTFKTTQYAAPSKRSKGVMVKDAAELVA 240

Query: 241 ILKSK 245
            LK K
Sbjct: 241 ALKQK 245


>gi|134288216|ref|YP_001110379.1| electron transfer flavoprotein beta-subunit [Burkholderia
           vietnamiensis G4]
 gi|134132866|gb|ABO59576.1| electron transfer flavoprotein beta-subunit [Burkholderia
           vietnamiensis G4]
          Length = 249

 Score =  238 bits (606), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 169/249 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V+++N KVR+K D SG+E  N K SMNPF EIA+EE+++L+E GIATE+I 
Sbjct: 1   MKVLVAVKRVVDFNVKVRVKADQSGVELANVKFSMNPFCEIAVEEAVRLKEAGIATEIIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR I ++ +  L+ L +A+ILR I ++E P +VI GKQ  
Sbjct: 61  VSAGPGQCQETLRTALAIGADRAIHVKVDGELQQLGVARILRAIFEREKPELVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL    QATF S++++    A V RE+  G  T+   LPAV+T DL L
Sbjct: 121 DDDANQTGQMLAALADISQATFASHLQVEGGAAFVAREIDGGAETLSITLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY++LPNI+KA+KK ++     +  +D+ PRLK L+  E      G+ +     L +
Sbjct: 181 NEPRYVTLPNIMKAKKKPLDVIDVAELGLDIKPRLKTLKVSEPPKRTAGVMVSDVGALAD 240

Query: 241 ILKSKHDLL 249
            +K+K  ++
Sbjct: 241 AVKNKAGMV 249


>gi|167042020|gb|ABZ06756.1| putative electron transfer flavoprotein beta subunit [uncultured
           marine microorganism HF4000_141F21]
          Length = 249

 Score =  238 bits (606), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 176/249 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+YN ++R+K D +G+ T+N K++ NP D+ A+EE+++++E G A EVI 
Sbjct: 1   MKILVAVKRVIDYNVQIRVKEDGTGVHTDNVKMATNPPDDNAVEEAVKIKESGKAKEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V++G  K +E ++ +LA GADRGI ++++  +EPL +AKIL++IV+KE P ++  GKQ  
Sbjct: 61  VTVGEEKSQETVRKALAAGADRGIHVKTDSYVEPLGVAKILKKIVEKEKPDLIFMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQML A++ W Q TFVS +++ +    VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDCNQTGQMLGAMLNWAQGTFVSKVELKEKTIQVTREVDEGLETLEINLPAVVTCDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK IE+  A D  +D+  R++ ++ EE    + G+++ +   L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPIEQLFAKDLGVDVANRIQQIKVEEPPKRKGGVKVANVADLVS 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKII 249


>gi|332534602|ref|ZP_08410435.1| electron transfer flavoprotein, beta subunit [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332035952|gb|EGI72432.1| electron transfer flavoprotein, beta subunit [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 249

 Score =  237 bits (605), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 171/245 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVPIK VI+YN K R+K+D S ++  N K++MNPF EIA+EE+++ +E G ATEV+ 
Sbjct: 1   MKVLVPIKRVIDYNVKARVKSDNSDVDLTNVKMAMNPFCEIAIEEAIRFKEAGTATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    +E L+ +LA+GAD+ I IE++E LE L IAK+L +IV++E P +VI GKQ+ 
Sbjct: 61  VTIGPKASQEQLRTALALGADKAIHIETDEKLESLHIAKLLAKIVEQETPELVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL    Q TF S + I +    VTREV  G  T+   LPAV+T DL L
Sbjct: 121 DSDNNQTGQMLAALTNRGQGTFASKVVIENGKVNVTREVDGGLQTVALNLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K +E   A    +DLTPR++++  EE      G+ +    +L+E
Sbjct: 181 NEPRYASLPNIMKAKRKPLEVIAADSLGVDLTPRMQLISVEEPAKRTAGIIVEDVAQLVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKTE 245


>gi|212636230|ref|YP_002312755.1| electron transfer flavoprotein beta-subunit [Shewanella
           piezotolerans WP3]
 gi|212557714|gb|ACJ30168.1| Electron transfer flavoprotein beta-subunit [Shewanella
           piezotolerans WP3]
          Length = 249

 Score =  237 bits (605), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 170/245 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++ N KVR+  D + ++T N K+++NPF EIA+EE+++L+E G A EV+V
Sbjct: 1   MKVLVPVKRVVDANVKVRVNADNTSVDTANLKMAINPFCEIAVEEAVRLKEAGSAAEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           +SIG    +E L+ +LA+GADR I IE++E L PLS+AK++  + +KE   +VI GKQ+ 
Sbjct: 61  LSIGPKASQEQLRTALALGADRAIHIETDEDLVPLSVAKLIHAVQQKEQADLVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAA+ + PQATF S +K+  N  IVTREV  G  T++ PLPAV+T DL L
Sbjct: 121 DSDNNQTGQMLAAIGKMPQATFASEVKVDANQLIVTREVDGGLQTLQLPLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  LPNI+KA++K +E     DF I L     VL+         G+ + S  +L+E
Sbjct: 181 NEPRYAKLPNIMKAKRKPLESLTPADFDITLKAHQTVLKVTPPAQRSAGVMVSSVEELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|87118367|ref|ZP_01074266.1| electron transfer flavoprotein beta-subunit [Marinomonas sp.
           MED121]
 gi|86166001|gb|EAQ67267.1| electron transfer flavoprotein beta-subunit [Marinomonas sp.
           MED121]
          Length = 250

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 174/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++YN KVR++ D+  +E  N K+S+NPF EIA+EE+++L+EKGIATE++ 
Sbjct: 1   MKILVAVKRVVDYNVKVRVQADHKAVELANVKMSINPFCEIAVEEAVRLKEKGIATEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIGS   +E L+ +L +GADR I IE+ + ++ L++AK+L E+ K E+P ++I GKQ  
Sbjct: 61  VSIGSKGCQETLRTALGLGADRAIQIETEDGVDSLAVAKLLTEVAKTESPDLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+  PQATF S + I +  A VTRE+  G  T+   LPAV+T DL L
Sbjct: 121 DSDNNQTGQMLAALLDMPQATFASEVVIENGEAQVTREIDGGLQTLAISLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LPNI+KA+KK ++ K   +  +     +KV+        + G+++ S  +L+E
Sbjct: 181 NEPRFIKLPNIMKAKKKPLDVKTPEELGVSTASNVKVISVTPPAERQGGIKVGSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|298370474|ref|ZP_06981790.1| electron transfer flavoprotein, beta subunit [Neisseria sp. oral
           taxon 014 str. F0314]
 gi|298281934|gb|EFI23423.1| electron transfer flavoprotein, beta subunit [Neisseria sp. oral
           taxon 014 str. F0314]
          Length = 249

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 174/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDE+A+EE+++L+E G   E+I 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDINNVKMSMNPFDEVAVEEAVRLKEAGKVNEIIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G+ K EE L+ +LAMGADR + IE+++ LEPL++AK+L+ +  KENP I++ GKQ  
Sbjct: 61  VSLGNKKCEETLRTALAMGADRAVHIETDKKLEPLTVAKLLKALADKENPQILLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQT QML+AL+   Q TF S I++  +  +VTRE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQTAQMLSALLNAAQGTFASKIELNADEVLVTREIDGGEETLALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR++ LPNI++A+KK +EK    +  I + P ++ ++  E R  + G+++ S T+L +
Sbjct: 181 NEPRFVKLPNIMQAKKKPLEKLSPEELGISIVPLIRTIKVAEPRERQAGIKVGSVTELAD 240

Query: 241 ILKSK 245
            L+++
Sbjct: 241 KLRNE 245


>gi|332977981|gb|EGK14725.1| electron transfer flavoprotein beta subunit [Psychrobacter sp.
           1501(2011)]
          Length = 249

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 175/249 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K VI+YN KVR+K D SG++  NTK+S+NPF EIA+EE+++L+E G+  EVIV
Sbjct: 1   MKALVAVKRVIDYNVKVRVKADNSGVDLSNTKMSINPFCEIAVEEAVRLKEAGVVDEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            SIG  + +E ++ +LA+GADRGIL+++++   PL +AKIL+ I ++E   I++ GKQ  
Sbjct: 61  ASIGPKESQEQIRAALALGADRGILVQTDDKAYPLQVAKILKGIAEQEGTDIILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAALM   Q TF S +K+  +   VTRE+  G  T+  PLPAVIT DL L
Sbjct: 121 DDDNNQTGQMLAALMGIGQGTFASEVKVEGDKVNVTREIDGGLQTVALPLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  LPNI+KA+KK +++K   DF +D+  + +V++         G+++ S  +LI+
Sbjct: 181 NEPRYAKLPNIMKAKKKPLDEKTPADFGVDMASKQEVVKVTPPPERSAGIKVGSVDELID 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|146418321|ref|XP_001485126.1| hypothetical protein PGUG_02855 [Meyerozyma guilliermondii ATCC
           6260]
 gi|146390599|gb|EDK38757.1| hypothetical protein PGUG_02855 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 255

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 122/246 (49%), Positives = 175/246 (71%), Gaps = 3/246 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLRE--KGIATEV 58
           ++ILVPIK VI++  K RI    +G+ET+  K SMNPF +IALEESL+LRE  K +   +
Sbjct: 5   LRILVPIKRVIDFAIKPRINKAGTGVETKGVKFSMNPFCDIALEESLRLRENNKDLVDHI 64

Query: 59  IVVSIGSCKVEEVLKNSLAMGADRGILIE-SNETLEPLSIAKILREIVKKENPIIVIAGK 117
             VSIG  K ++VL+ +LA GAD   L++  ++ +EPL++AKIL+++V+K+N  +VI GK
Sbjct: 65  HAVSIGPTKAQDVLRTALAKGADSTTLVDVGDDEVEPLAVAKILKKMVEKQNSNLVILGK 124

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D+++NQTGQ+L+ L+ WPQAT  S +++  +   VTRE+  G+ T+   LP VIT D
Sbjct: 125 QAIDDDANQTGQILSGLLDWPQATNASKVQVEGDSVTVTREIDGGSGTLRAKLPMVITTD 184

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LNEPRY SLPNI+KA+KK +EK KA+DF +DLT R++ L+ EE  A + G+R+ S  +
Sbjct: 185 LRLNEPRYASLPNIMKAKKKPLEKLKASDFDVDLTKRVETLKVEEPPARQAGVRVESVDE 244

Query: 238 LIEILK 243
           LI  LK
Sbjct: 245 LISKLK 250


>gi|254497681|ref|ZP_05110460.1| electron transfer flavoprotein, beta subunit [Legionella
           drancourtii LLAP12]
 gi|254353088|gb|EET11844.1| electron transfer flavoprotein, beta subunit [Legionella
           drancourtii LLAP12]
          Length = 249

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+   K+R+K+D SG+ET+N K++MNPFDEIA+EE+L+LRE   ATEV+V
Sbjct: 1   MKILVAVKRVIDPYVKIRVKSDNSGVETQNIKMAMNPFDEIAVEEALRLRENNWATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+   +E L+++LA+GADR I + +  ++E L++AKIL++IV  E P +V+ GKQ  
Sbjct: 61  VSIGADSAQETLRHALALGADRAIHVHTQASMESLNVAKILKKIVDDEKPALVLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQT QMLAAL+ WPQAT+ S +    +H  VTRE+  G  T+   LPAV++ DL L
Sbjct: 121 DGDNNQTPQMLAALLDWPQATYASKLDAHSDHLEVTREIDGGLETLSVKLPAVVSTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K +   +  +  + L   + VL+         G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKRKELTVIELDNMGLSLKKHVDVLKVTAPAVRSAGIKVESVAELLD 240

Query: 241 ILKSKHDLL 249
            L++K  +L
Sbjct: 241 HLQNKAKVL 249


>gi|262376580|ref|ZP_06069808.1| electron transfer flavoprotein subunit beta [Acinetobacter lwoffii
           SH145]
 gi|262308290|gb|EEY89425.1| electron transfer flavoprotein subunit beta [Acinetobacter lwoffii
           SH145]
          Length = 250

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 117/250 (46%), Positives = 176/250 (70%), Gaps = 1/250 (0%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++ N KVR+K D SG++  N K+S+NPF EIA+EE+++L+EKG  +E+IV
Sbjct: 1   MKALVAVKRVVDANVKVRVKPDNSGVDLTNVKMSINPFCEIAVEEAVRLKEKGTVSEIIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNET-LEPLSIAKILREIVKKENPIIVIAGKQT 119
           VSIG  + +E +++++A+GADRGIL+E++++ L  L IAKIL+ +V  E P +++ GKQ 
Sbjct: 61  VSIGPKEAQEQIRSAMALGADRGILVEADDSQLGALEIAKILKGVVDAEQPQLILLGKQA 120

Query: 120 TDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLN 179
            D++SNQ GQML ALM   Q TF S +K+  +   VTREV  G  T+E  LPA+IT DL 
Sbjct: 121 IDDDSNQVGQMLGALMGAGQGTFASEVKVDGDKVQVTREVDGGLQTVELKLPAIITTDLR 180

Query: 180 LNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLI 239
           LNEPRY +LPNI+KARKK ++ K   DF ++   +LK ++ E     + G+++ S  +L+
Sbjct: 181 LNEPRYAALPNIMKARKKPLDTKSPADFGVNPATKLKTVKVESPAERKAGVQVKSVDELV 240

Query: 240 EILKSKHDLL 249
           E LK++  ++
Sbjct: 241 EKLKNEAKVI 250


>gi|120598315|ref|YP_962889.1| electron transfer flavoprotein beta-subunit [Shewanella sp.
           W3-18-1]
 gi|146293607|ref|YP_001184031.1| electron transfer flavoprotein beta-subunit [Shewanella
           putrefaciens CN-32]
 gi|120558408|gb|ABM24335.1| electron transfer flavoprotein beta-subunit [Shewanella sp.
           W3-18-1]
 gi|145565297|gb|ABP76232.1| electron transfer flavoprotein beta-subunit [Shewanella
           putrefaciens CN-32]
 gi|319426910|gb|ADV54984.1| Electron transfer flavoprotein alpha/beta-subunit [Shewanella
           putrefaciens 200]
          Length = 249

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 171/245 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++ N KVR+K D + ++T N K+++NPF EIA+EE+++L+E G ATEV+V
Sbjct: 1   MKVLVPVKRVVDANVKVRVKADNTSVDTANLKMALNPFCEIAVEEAVRLKESGSATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+  V+E L+ +LA+GADR I I++ + L PLSIAK+L+ + ++E   +VI GKQ+ 
Sbjct: 61  VSIGNKAVQEQLRTALALGADRAIHIDTEDDLVPLSIAKLLKAVQEREQAELVIFGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQM AALM  PQATF S IK+  N   VTRE+  G  T+  PLPAV+T DL L
Sbjct: 121 DGDNNQTGQMFAALMDMPQATFASEIKLEANTVQVTREIDGGMQTLNLPLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K ++     D  + L     V++       + G+ + S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKRKPLDVMTVADLGVTLKNHQTVVKVTPPAERKAGIMVASVAELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|326571610|gb|EGE21625.1| electron transfer flavoprotein alpha/beta-subunit-like protein
           [Moraxella catarrhalis BC7]
          Length = 249

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 173/245 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V+++N KVR+K D SG+E  N K+S+NPF EIA+EE+++L+EKG+A+E+I 
Sbjct: 1   MKILVAVKRVVDHNVKVRVKADESGVELANAKMSVNPFCEIAIEEAVRLKEKGVASEIIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+ +  E ++++LA+GADRGIL+E++   +PL +AKIL+ + + E   IV+ GKQ  
Sbjct: 61  VSIGTSQSSEQIRSALALGADRGILVETDAKAQPLQVAKILKGVAEAEGVQIVLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAALM   Q TF S + +  +   VTRE+  G  T+  PLP VIT DL L
Sbjct: 121 DDDNNQTGQMLAALMGVGQGTFASEVVVEGDKVHVTREIDGGLQTVALPLPVVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+  LPNI+ A+KK ++ K   DF +++  +L+ ++    +    G+++ S  +LI+
Sbjct: 181 NEPRFPKLPNIMAAKKKPLDTKSPADFGVEMNAKLETIKVSAPKERSAGVKVSSVDELID 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|262369528|ref|ZP_06062856.1| electron transfer flavoprotein subunit beta [Acinetobacter
           johnsonii SH046]
 gi|262315596|gb|EEY96635.1| electron transfer flavoprotein subunit beta [Acinetobacter
           johnsonii SH046]
          Length = 250

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 176/250 (70%), Gaps = 1/250 (0%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++ N KVR+K D SG++  N K+S+NPF EIA+EE+++L+EKG  +E+IV
Sbjct: 1   MKALVAVKRVVDANVKVRVKPDNSGVDLTNVKMSINPFCEIAVEEAVRLKEKGTVSEIIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNET-LEPLSIAKILREIVKKENPIIVIAGKQT 119
           VSIG  + +E +++++A+GADRGIL+E++++ L  L IAK+L+ +V  E P +++ GKQ 
Sbjct: 61  VSIGPKEAQEQIRSAMALGADRGILVEADDSQLGALEIAKVLKGVVDAEQPQLILLGKQA 120

Query: 120 TDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLN 179
            D++SNQ GQML AL+   Q TF S +K+  +   VTRE+  G  T+E  LPA+IT DL 
Sbjct: 121 IDDDSNQVGQMLGALLGAGQGTFASEVKVDGDKVQVTREIDGGLQTVELALPAIITTDLR 180

Query: 180 LNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLI 239
           LNEPRY +LPNI+KARKK ++ K   DF +  T +LK ++ E     + G+++ S  +L+
Sbjct: 181 LNEPRYAALPNIMKARKKPLDTKSPADFGVSTTTKLKTVKVEAPAERKAGVQVKSVDELV 240

Query: 240 EILKSKHDLL 249
           E LK++  ++
Sbjct: 241 EKLKNEAKVI 250


>gi|326386313|ref|ZP_08207937.1| electron transfer flavoprotein beta-subunit [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326209538|gb|EGD60331.1| electron transfer flavoprotein beta-subunit [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 248

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 116/243 (47%), Positives = 171/243 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K VI+YN K R+K D +G++  N K+SMNPFDEIA+EE+++L+EKG+ +EV+V
Sbjct: 1   MKALVTVKRVIDYNVKPRVKADGTGVDLANVKMSMNPFDEIAVEEAIRLKEKGVVSEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K +E L+ +LAMGADR IL+ +++ +EPL +AKI++ I  +E P ++I GKQ  
Sbjct: 61  VSVGPAKAQETLRTALAMGADRAILVSTDDEVEPLGVAKIVKAIAAEEAPGLIITGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQM+AAL+  PQ TF + I +  +  +V RE+  G  T++  LPAV+T DL L
Sbjct: 121 DDDANQTGQMIAALLGRPQGTFANEISVEGDSLVVKREIDGGLETVKLALPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+ K +  K   D+ +D+ PRLK L+  E    + G+++     L+ 
Sbjct: 181 NEPRYASLPNIMKAKSKPLATKSPADYGVDVAPRLKTLKVGEPPVRQAGIKVADVDALVG 240

Query: 241 ILK 243
            LK
Sbjct: 241 KLK 243


>gi|331005699|ref|ZP_08329063.1| Electron transfer flavoprotein, beta subunit [gamma proteobacterium
           IMCC1989]
 gi|330420491|gb|EGG94793.1| Electron transfer flavoprotein, beta subunit [gamma proteobacterium
           IMCC1989]
          Length = 260

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 170/249 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++YN KVR+  D SGI+  NTK+S+NPF EIA+EE+L+L+EKG+A EVIV
Sbjct: 11  MKILVAVKRVVDYNVKVRVNADNSGIDLANTKMSINPFCEIAVEEALRLKEKGLADEVIV 70

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIGS K EE L+ ++A+GADRGIL+E++ T   L  AK+L ++V+KENP ++I GKQ+ 
Sbjct: 71  VSIGSRKCEEQLRYAMALGADRGILLETDSTPSSLYCAKLLSKMVEKENPGLIILGKQSI 130

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQ+LA L    Q TF S + I    AIVTREV  G  T+   LPAVIT DL L
Sbjct: 131 DSDNNQTGQILAGLCGIAQGTFASELTIEGGQAIVTREVDSGLQTLSLTLPAVITTDLRL 190

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  LP I+KA+KK +E   A        P++   R +     + G ++ +  +LI 
Sbjct: 191 NEPRYAKLPQIMKAKKKPLETLSAETLVAPFAPQVTTQRVDAPTQRKAGSKVANVEELIN 250

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 251 KLKNEAKVI 259


>gi|308048697|ref|YP_003912263.1| electron transfer flavoprotein alpha/beta-subunit [Ferrimonas
           balearica DSM 9799]
 gi|307630887|gb|ADN75189.1| Electron transfer flavoprotein alpha/beta-subunit [Ferrimonas
           balearica DSM 9799]
          Length = 249

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 117/245 (47%), Positives = 169/245 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++ N KVR+K D S +E  N K+++NPF EIA+EE+++L+E+G A+EV+V
Sbjct: 1   MKILVPVKRVVDANVKVRVKADESAVELANLKMALNPFCEIAVEEAVRLKEQGKASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V IG    +E L+ ++A+GADR I +E+++ L PLS+AK+L  IV+KE P +V+ GKQ+ 
Sbjct: 61  VCIGPKAAQEQLRTAMALGADRAIQVETDQELVPLSVAKLLNAIVQKEQPELVLLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAALM   QATF S + ++D    V RE+  G  T+   LPAVIT DL L
Sbjct: 121 DGDNNQTGQMLAALMGAGQATFASEVSVVDGGVQVVREIDGGLQTVSLKLPAVITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K +E     D  + L    KVL+       + G+ + S  +L++
Sbjct: 181 NEPRYASLPNIMKAKRKPLEVVSVDDLGVALGEHQKVLKVAAPSERQAGVMVGSVEELVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|319788039|ref|YP_004147514.1| electron transfer flavoprotein alpha/beta-subunit
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317466551|gb|ADV28283.1| Electron transfer flavoprotein alpha/beta-subunit
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 248

 Score =  236 bits (601), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 167/245 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ TE  K+S NPFDEIALEE+L+LR+KG+ATEV+V
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVVTEGVKLSPNPFDEIALEEALRLRDKGVATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            +I     +  L+N LAMGA+R I + +++ ++PL+ A+ L ++V+KE P +VI GKQ  
Sbjct: 61  ATIAPADAQAHLRNGLAMGANRAIHVVTDQAVQPLAAARTLLKLVEKEQPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF S +++ +  A VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFASKLEVANGKATVTREVDAGLETLEVDLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LP+I+KA+ K +E  +  D  +D  P L+   +       +G+ +    +L+ 
Sbjct: 181 NEPRFIKLPDIMKAKSKPLETLQLADLGVDAGPGLETTAYAPPPKRSRGVMVKDAAELVA 240

Query: 241 ILKSK 245
            LK+K
Sbjct: 241 TLKAK 245


>gi|296112627|ref|YP_003626565.1| electron transfer flavoprotein alpha/beta-subunit-like protein
           [Moraxella catarrhalis RH4]
 gi|295920321|gb|ADG60672.1| electron transfer flavoprotein alpha/beta-subunit-like protein
           [Moraxella catarrhalis RH4]
          Length = 276

 Score =  236 bits (601), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 173/245 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V+++N KVR+K D SG+E  N K+S+NPF EIA+EE+++L+EKG+A+E+I 
Sbjct: 28  MKILVAVKRVVDHNVKVRVKADESGVELANAKMSVNPFCEIAIEEAVRLKEKGVASEIIA 87

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+ +  E ++++LA+GADRGIL+E++   +PL +AKIL+ + + E   IV+ GKQ  
Sbjct: 88  VSIGTSQSSEQIRSALALGADRGILVETDAKAQPLQVAKILKGVAEAEGVQIVLLGKQAI 147

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAALM   Q TF S + +  +   VTRE+  G  T+  PLPAVIT DL L
Sbjct: 148 DDDNNQTGQMLAALMGVGQGTFASEVVVEGDKVHVTREIDGGLQTVALPLPAVITTDLRL 207

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+  LPNI+ A+KK ++ K   DF +++  +L+ ++         G+++ S  +LI+
Sbjct: 208 NEPRFPKLPNIMAAKKKPLDTKSPADFGVEMNAKLETIKVSAPNERSAGVKVSSVDELID 267

Query: 241 ILKSK 245
            LK++
Sbjct: 268 KLKNE 272


>gi|29654425|ref|NP_820117.1| electron transfer flavoprotein beta-subunit [Coxiella burnetii RSA
           493]
 gi|153208393|ref|ZP_01946731.1| electron transfer flavoprotein, beta subunit [Coxiella burnetii
           'MSU Goat Q177']
 gi|154706780|ref|YP_001424578.1| electron transfer flavoprotein beta-subunit [Coxiella burnetii
           Dugway 5J108-111]
 gi|165919343|ref|ZP_02219429.1| electron transfer flavoprotein, beta subunit [Coxiella burnetii RSA
           334]
 gi|212212479|ref|YP_002303415.1| electron transfer flavoprotein beta-subunit [Coxiella burnetii
           CbuG_Q212]
 gi|212218555|ref|YP_002305342.1| electron transfer flavoprotein beta-subunit [Coxiella burnetii
           CbuK_Q154]
 gi|29541692|gb|AAO90631.1| electron transfer flavoprotein beta-subunit [Coxiella burnetii RSA
           493]
 gi|120576050|gb|EAX32674.1| electron transfer flavoprotein, beta subunit [Coxiella burnetii
           'MSU Goat Q177']
 gi|154356066|gb|ABS77528.1| electron transfer flavoprotein beta-subunit [Coxiella burnetii
           Dugway 5J108-111]
 gi|165916942|gb|EDR35546.1| electron transfer flavoprotein, beta subunit [Coxiella burnetii RSA
           334]
 gi|212010889|gb|ACJ18270.1| electron transfer flavoprotein beta-subunit [Coxiella burnetii
           CbuG_Q212]
 gi|212012817|gb|ACJ20197.1| electron transfer flavoprotein beta-subunit [Coxiella burnetii
           CbuK_Q154]
          Length = 250

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V+++  KVR+K D SGIET+  K+SMNPFDEIALEE+++++EKG+A+EVIV
Sbjct: 1   MKILVGVKRVVDFKVKVRVKADGSGIETDQIKMSMNPFDEIALEEAIRIKEKGLASEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG     E L N+LAMGADR +LI++++  EP+ +A +L+ +++KE+P ++I GKQ  
Sbjct: 61  VSIGLEACRETLLNALAMGADRALLIKTDQAQEPIHVAHLLKVLIEKESPTLLILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL+ W Q TFVS   I  +   +TREV  G  T+   LPAVIT DL L
Sbjct: 121 DDDCNQTGQMLAALLDWGQGTFVSKCDIEGDQLRITREVDTGLETLLVQLPAVITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N+PRY +LPNI+KA+ K +      +  + LTP L  L+ E       G+++ +  +L+ 
Sbjct: 181 NKPRYPTLPNIMKAKSKPLTILTPEELGVTLTPHLTTLKIESPPQRAPGIKVNNINELLN 240

Query: 241 ILKSKHDLL 249
           +LK K  +L
Sbjct: 241 LLKQKDKVL 249


>gi|153001382|ref|YP_001367063.1| electron transfer flavoprotein subunit alpha/beta [Shewanella
           baltica OS185]
 gi|160876104|ref|YP_001555420.1| electron transfer flavoprotein subunit alpha/beta [Shewanella
           baltica OS195]
 gi|217972688|ref|YP_002357439.1| electron transfer flavoprotein subunit alpha/beta [Shewanella
           baltica OS223]
 gi|304409892|ref|ZP_07391511.1| Electron transfer flavoprotein alpha/beta-subunit [Shewanella
           baltica OS183]
 gi|307302401|ref|ZP_07582159.1| Electron transfer flavoprotein alpha/beta-subunit [Shewanella
           baltica BA175]
 gi|151366000|gb|ABS09000.1| Electron transfer flavoprotein alpha/beta-subunit [Shewanella
           baltica OS185]
 gi|160861626|gb|ABX50160.1| Electron transfer flavoprotein alpha/beta-subunit [Shewanella
           baltica OS195]
 gi|217497823|gb|ACK46016.1| Electron transfer flavoprotein alpha/beta-subunit [Shewanella
           baltica OS223]
 gi|304351301|gb|EFM15700.1| Electron transfer flavoprotein alpha/beta-subunit [Shewanella
           baltica OS183]
 gi|306914439|gb|EFN44860.1| Electron transfer flavoprotein alpha/beta-subunit [Shewanella
           baltica BA175]
 gi|315268301|gb|ADT95154.1| Electron transfer flavoprotein alpha/beta-subunit [Shewanella
           baltica OS678]
          Length = 249

 Score =  235 bits (600), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 170/249 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++ N KVR+K D + ++T N K+++NPF EIA+EE+++L+E G ATEV+V
Sbjct: 1   MKVLVPVKRVVDANVKVRVKADNTSVDTANLKMALNPFCEIAVEEAVRLKEAGSATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+  V+E L+ +LA+GADR I I++ E L P+SIAK+L+ +  KE   +VI GKQ+ 
Sbjct: 61  VSIGNKAVQEQLRTALALGADRAIHIDTEEELVPVSIAKLLKAVQDKEQAELVIFGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQM AALM  PQATF S IK+      V REV  G  T+  PLPAV+T DL L
Sbjct: 121 DGDNNQTGQMFAALMDMPQATFASEIKLEGQSVQVAREVDGGMQTLLMPLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K +E     D  + L     V++       + G+ + S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKRKPLEVFTVADLGVTLKSHQTVVKVTPPAERKAGIMVASVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|170727575|ref|YP_001761601.1| electron transfer flavoprotein subunit alpha/beta [Shewanella
           woodyi ATCC 51908]
 gi|169812922|gb|ACA87506.1| Electron transfer flavoprotein alpha/beta-subunit [Shewanella
           woodyi ATCC 51908]
          Length = 249

 Score =  235 bits (600), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 170/245 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++ N KVR+  D +G++T N K+++NPF EIA+EE+++L+E G A+E++V
Sbjct: 1   MKVLVPVKRVVDANVKVRVNADNTGVDTANLKMAINPFCEIAVEEAVRLKEAGTASEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V++G    +E L+ ++A+GADRGI IE++E L PLSIAK+L  + +KE   +++ GKQ+ 
Sbjct: 61  VTVGPKAAQEQLRTAMALGADRGIHIETDEELVPLSIAKLLLSVQEKEQAELILLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAAL + PQATF S +K+      VTRE+  G  T+  PLPAV+TVDL L
Sbjct: 121 DGDNNQTGQMLAALAKMPQATFASEVKLEGESLAVTREIDGGLQTVTMPLPAVVTVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  LPNI+KA++K +E     D  + L    K L+       + G+ + S  +L+E
Sbjct: 181 NEPRYAKLPNIMKAKRKPLETVSIDDLGVSLKSHQKTLKVSPPSERQAGVMVSSVAELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|254453599|ref|ZP_05067036.1| electron transfer flavoprotein beta-subunit [Octadecabacter
           antarcticus 238]
 gi|198268005|gb|EDY92275.1| electron transfer flavoprotein beta-subunit [Octadecabacter
           antarcticus 238]
          Length = 238

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 117/232 (50%), Positives = 164/232 (70%), Gaps = 4/232 (1%)

Query: 16  KVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNS 75
           KVR+K D +G++  N K+SMNPFDEIA+E++++L+E G A EVI VSIG  + +E L+ +
Sbjct: 2   KVRVKADGTGVDLANVKMSMNPFDEIAVEQAIRLKEAGKADEVIAVSIGVRQSQETLRTA 61

Query: 76  LAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQML 131
           LAMGADR IL+    + +  +EPL++AKIL+ I+ +E P IV+AGKQ  DN+ N TGQML
Sbjct: 62  LAMGADRAILVIATDDVHNDIEPLAVAKILKGIIDEEKPGIVLAGKQAIDNDMNATGQML 121

Query: 132 AALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNI 191
           AAL  W Q TF S +++  + A VTREV  G  T++  +PA+ITVDL LNEPRY SLPNI
Sbjct: 122 AALTGWAQGTFASELEVDGDTATVTREVDGGLQTIKLKMPAIITVDLRLNEPRYASLPNI 181

Query: 192 IKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIEILK 243
           +KA+KK +++K   D+ +D+TPRL ++   E      G+ + S  +LIE LK
Sbjct: 182 MKAKKKPMDEKTPGDYGVDVTPRLTIVGTAEPETRAAGIMVGSVDELIEKLK 233


>gi|226952080|ref|ZP_03822544.1| electron transfer flavoprotein beta-subunit [Acinetobacter sp. ATCC
           27244]
 gi|294651113|ref|ZP_06728449.1| electron transfer flavoprotein subunit beta [Acinetobacter
           haemolyticus ATCC 19194]
 gi|226837172|gb|EEH69555.1| electron transfer flavoprotein beta-subunit [Acinetobacter sp. ATCC
           27244]
 gi|292823007|gb|EFF81874.1| electron transfer flavoprotein subunit beta [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 249

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++ N KVR+K D SG++  N K+S+NPF EIA+EE+++L+EKG  TE++V
Sbjct: 1   MKALVAVKRVVDANVKVRVKPDNSGVDLTNVKMSINPFCEIAVEEAVRLKEKGTVTEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G+   +E L++++A+GADRGIL+E+ + +  L +AKIL+ +V  E P +++ GKQ  
Sbjct: 61  VSVGTKDAQEQLRSAMALGADRGILVETADEVGALEVAKILKGVVDAEKPELILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQ GQML AL+   Q TF S +K+      VTRE+  G  T+E  LPA+IT DL L
Sbjct: 121 DDDSNQVGQMLGALLGAGQGTFASEVKVDGGKVQVTREIDGGLQTVELGLPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +LPNI+KARKK ++ K   DF +    +LK ++ E     + G+++ S  +L+E
Sbjct: 181 NEPRYAALPNIMKARKKPLDTKSPADFGVATGTKLKTIKVEAPAERKAGVQVKSVDELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|126175052|ref|YP_001051201.1| electron transfer flavoprotein alpha/beta-subunit [Shewanella
           baltica OS155]
 gi|125998257|gb|ABN62332.1| electron transfer flavoprotein beta-subunit [Shewanella baltica
           OS155]
          Length = 249

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 170/249 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++ N KVR+K D + ++T N K+++NPF EIA+EE+++L+E G ATEV+V
Sbjct: 1   MKVLVPVKRVVDANVKVRVKADNTSVDTANLKMALNPFCEIAVEEAVRLKEAGSATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+  V+E L+ +LA+GADR I I++ E L P+SIAK+L+ +  KE   +VI GKQ+ 
Sbjct: 61  VSIGNKTVQEQLRTALALGADRAIHIDTEEELVPVSIAKLLKAVQDKEQAELVIFGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQM AALM  PQATF S IK+      V REV  G  T+  PLPAV+T DL L
Sbjct: 121 DGDNNQTGQMFAALMDMPQATFASEIKLEGQSVQVAREVDGGMQTLLMPLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K +E     D  + L     V++       + G+ + S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKRKPLEVFTVADLGVTLKSHQTVVKVTPPAERKAGIMVASVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|304313020|ref|YP_003812618.1| Electron transfer flavoprotein, beta subunit [gamma proteobacterium
           HdN1]
 gi|301798753|emb|CBL46986.1| Electron transfer flavoprotein, beta subunit [gamma proteobacterium
           HdN1]
          Length = 249

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 111/249 (44%), Positives = 171/249 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D+S ++  N K+++NPF EIA+EE+++L+EKGIA E++ 
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKPDHSDVDLNNIKMALNPFCEIAIEEAVRLKEKGIAKEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E ++ +LA+GADRGIL+E+ E ++PL IAK+L+ +V +E P ++I GKQ+ 
Sbjct: 61  VSVGPKEAQEQIRTALALGADRGILVETAEKVQPLGIAKVLKALVDQEKPDLIILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAAL    Q T+ S + +      V RE+  G  T+E  LPAV+T DL L
Sbjct: 121 DGDNNQTGQMLAALAGVSQGTYASKVDVAGGKVTVVREIDGGLQTVEITLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++        ID+ PR+  L+ E     + G+++    +L  
Sbjct: 181 NEPRYASLPNIMKAKKKPLDVTTPDALGIDVKPRVATLKVEPPSERKAGIKVADVAELAA 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|88798786|ref|ZP_01114369.1| Electron transfer flavoprotein, beta subunit [Reinekea sp. MED297]
 gi|88778549|gb|EAR09741.1| Electron transfer flavoprotein, beta subunit [Reinekea sp. MED297]
          Length = 250

 Score =  235 bits (599), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 171/249 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++YN KVR+K D S ++  N K+ +NPF +IA+EE+++L+E+G+ATE++V
Sbjct: 1   MKILVPVKRVVDYNVKVRVKADQSDVDLANVKMDINPFCDIAVEEAVRLKEQGVATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  K EE ++ ++A+GADRGILI +      L++AK+L+ IV +E P +VI GKQ+ 
Sbjct: 61  VSIGEAKAEEQIRRAMAIGADRGILITTEAPASSLTVAKLLKAIVAEEEPGLVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQML AL   PQ TF S +++ DN   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DTDNNQTGQMLGALTGMPQGTFASKVEVADNKVNVTREIDGGLQTVGLTLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY+ LP+I+KA++K ++KK   D+ ++    +  L          G+ + S  +L+E
Sbjct: 181 NEPRYVKLPDIMKAKRKPLDKKTPADYGVEEKRSVTTLNVAPPAEREAGITVSSVEELVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAKVL 249


>gi|113969694|ref|YP_733487.1| electron transfer flavoprotein beta-subunit [Shewanella sp. MR-4]
 gi|114046923|ref|YP_737473.1| electron transfer flavoprotein beta-subunit [Shewanella sp. MR-7]
 gi|113884378|gb|ABI38430.1| electron transfer flavoprotein beta-subunit [Shewanella sp. MR-4]
 gi|113888365|gb|ABI42416.1| electron transfer flavoprotein beta-subunit [Shewanella sp. MR-7]
          Length = 249

 Score =  235 bits (599), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 171/249 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++ N KVR+K D + ++T N K+++NPF EIA+EE+++L+E G ATEV+V
Sbjct: 1   MKVLVPVKRVVDANVKVRVKADNTSVDTANLKMALNPFCEIAVEEAVRLKEAGSATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+  V+E L+ +LA+GADR I I++ E L P+SIAK+L+ + +KE   +V+ GKQ+ 
Sbjct: 61  VSIGNKAVQEQLRTALALGADRAIHIDTEEELTPVSIAKLLKAVQEKEQAQLVLFGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQM AAL   PQATF S IK+  N   V RE+  G  T+  PLPAV+T DL L
Sbjct: 121 DGDNNQTGQMFAALTDMPQATFASEIKVEGNSVQVAREIDGGMQTLSLPLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K ++     D  + L     V++       + G+ + S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKRKPLDVLTVADLGVTLKAHQTVVKVTPPAERKAGIMVASVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|84687631|ref|ZP_01015506.1| electron transfer flavoprotein, beta subunit [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84664421|gb|EAQ10910.1| electron transfer flavoprotein, beta subunit [Rhodobacterales
           bacterium HTCC2654]
          Length = 201

 Score =  234 bits (598), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 151/201 (75%), Gaps = 4/201 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K VI+YN K ++K+D SG++  N K+SMNPFDEIA+EE+++L+E G A EV+ 
Sbjct: 1   MKVLVPVKRVIDYNVKAKVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKAEEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+ +LAMGADR IL+    + +  +EPL++AKIL+ IV +E P +VIAG
Sbjct: 61  VSIGVKQAQETLRTALAMGADRAILVVAADDVHTDIEPLAVAKILKAIVDEEQPKLVIAG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  DN+ N TGQMLAAL+ W QATF S + I  + A VTREV  G  T++  LPA++T 
Sbjct: 121 KQAIDNDMNATGQMLAALLGWGQATFASELDIDGDAATVTREVDGGLQTIKVGLPAIVTA 180

Query: 177 DLNLNEPRYISLPNIIKARKK 197
           DL LNEPRY SLPNI+KA+KK
Sbjct: 181 DLRLNEPRYASLPNIMKAKKK 201


>gi|24374658|ref|NP_718701.1| electron transfer flavoprotein, beta subunit [Shewanella oneidensis
           MR-1]
 gi|24349297|gb|AAN56145.1|AE015752_2 electron transfer flavoprotein, beta subunit [Shewanella oneidensis
           MR-1]
          Length = 249

 Score =  234 bits (598), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 171/249 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++ N KVR+K D + ++T N K+++NPF EIA+EE+++L+E G ATEV+V
Sbjct: 1   MKVLVPVKRVVDANVKVRVKADNTSVDTANLKMALNPFCEIAVEEAVRLKEAGSATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+  V+E L+ +LA+GADR I I++ E L P+SIAK+L+ + +KE   +V+ GKQ+ 
Sbjct: 61  VSIGNKAVQEQLRTALALGADRAIHIDTEEELAPVSIAKLLKAVQEKEQAQLVLFGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQM AAL   PQATF S IK+  N   V RE+  G  T+  PLPAV+T DL L
Sbjct: 121 DGDNNQTGQMFAALTDMPQATFASAIKVEGNSIQVAREIDGGMQTLSLPLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K ++     D  + L     V++       + G+ + S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKRKPLDVLTVADLGVTLKAHQTVVKVTPPAERKAGIMVASVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|50085724|ref|YP_047234.1| electron transfer flavoprotein beta-subunit [Acinetobacter sp.
           ADP1]
 gi|49531700|emb|CAG69412.1| electron transfer flavoprotein beta-subunit [Acinetobacter sp.
           ADP1]
          Length = 249

 Score =  234 bits (597), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 114/249 (45%), Positives = 175/249 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++ N KVR+K D SG++  N K+S+NPF EIA+EE+++L+EKG  +E++V
Sbjct: 1   MKALVAVKRVVDANVKVRVKPDNSGVDLTNVKMSINPFCEIAVEEAVRLKEKGTVSEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E +++S+A+GADRGIL+E+ + +  L +AKIL+ IV++E P +++ GKQ  
Sbjct: 61  VSIGPKEAQEQIRSSMALGADRGILVETADEIGALEVAKILKGIVEQEKPELILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQ GQMLAAL+   Q TF S +K+      VTRE+  G  T+E  LPA+IT DL L
Sbjct: 121 DDDSNQVGQMLAALLDAGQGTFASEVKVDAGKVQVTREIDGGLQTVELTLPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +LPNI+KARKK ++ K   D+ +    +LK ++ E     + G+++ S  +L+E
Sbjct: 181 NEPRYAALPNIMKARKKPLDTKSPADYGVATGTKLKTVKVEPPADRKAGVQVKSVDELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|152997168|ref|YP_001342003.1| electron transfer flavoprotein subunit alpha/beta [Marinomonas sp.
           MWYL1]
 gi|150838092|gb|ABR72068.1| Electron transfer flavoprotein alpha/beta-subunit [Marinomonas sp.
           MWYL1]
          Length = 249

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 172/245 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+V +K VI+YN KVR+K+D S ++  N K+++NPF EIA+EE+++L+E GIA+E++V
Sbjct: 1   MKIIVSVKRVIDYNVKVRVKSDNSDVDLSNVKMALNPFCEIAVEEAIRLKEAGIASEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG   V+E L+ ++A+GADR I IE++   EPL++AK+L ++++ E P +VI GKQ+ 
Sbjct: 61  VSIGPNAVQEQLRTAMALGADRAIHIETDSQPEPLNVAKLLAKVMEVEAPGLVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ GQMLAAL R PQ TF S + +     +VTREV  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQVGQMLAALTRRPQGTFASKVTVEGGDVLVTREVDGGLRTLSLTLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  LP+I+KA++K +E K   DF ++    +  L+ E     + G++L S   LI+
Sbjct: 181 NEPRYAKLPDIMKAKRKPLEVKTPADFGVEFKQHISQLKVETPAQRQAGIKLDSVDALID 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|71065102|ref|YP_263829.1| electron transport flavoprotein beta-subunit [Psychrobacter
           arcticus 273-4]
 gi|71038087|gb|AAZ18395.1| electron transport flavoprotein beta-subunit [Psychrobacter
           arcticus 273-4]
          Length = 249

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 114/249 (45%), Positives = 175/249 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K VI+YN KVR+K D SG++  NTK+S+NPFDEIA+EE+++L+E G+  E+IV
Sbjct: 1   MKALVAVKRVIDYNVKVRVKADNSGVDLSNTKMSINPFDEIAVEEAVRLKEAGVIDEIIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            SIG  + +E ++ +LA+GADRGIL+ ++    PL IAKIL+ I + E+  I++ GKQ  
Sbjct: 61  ASIGPKESQEQIRAALALGADRGILVVTDAKPYPLQIAKILKNIAESESTDIILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAALM   Q TF S +K+  +   VTRE+  G  T+   LPAVIT DL L
Sbjct: 121 DDDNNQTGQMLAALMGIGQGTFASEVKVEGDKVNVTREIDGGLQTVALDLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  LPNI+KA+KK++++K   DF +D+  + ++++       + G+++ S  +L++
Sbjct: 181 NEPRYAKLPNIMKAKKKQLDEKTPADFGVDMASKQEIIKVVPPAERKAGIKVGSVDELVD 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|89093401|ref|ZP_01166350.1| electron transfer flavoprotein, beta subunit [Oceanospirillum sp.
           MED92]
 gi|89082380|gb|EAR61603.1| electron transfer flavoprotein, beta subunit [Oceanospirillum sp.
           MED92]
          Length = 249

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 176/249 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+YN KVR+K+D + ++  N K+++NPF EIA+EE+++L+E G A+EV+V
Sbjct: 1   MKILVSVKRVIDYNVKVRVKSDNTDVDLANVKMALNPFCEIAVEEAVRLKEAGTASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E ++ +LA+GADRGI +E+ E  E L++AK+L +++++E P +VI GKQ  
Sbjct: 61  VSIGPKPCQEQIRTALALGADRGIQVETEEMPESLNVAKLLAKVIEEEQPGLVIMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQ TF S +KI  +   VTREV  G  T+E  +PA++T DL L
Sbjct: 121 DSDNNQTGQMLAALTDMPQGTFASEVKIDGDKVNVTREVDGGLQTVELNMPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K ++ K   +  ++L    K+L+       + G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKRKPLDVKTPAELGVELKAHTKLLKVTPPAERQAGIKVASVDELVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAKVL 249


>gi|281201219|gb|EFA75433.1| electron transfer flavoprotein beta subunit [Polysphondylium
           pallidum PN500]
          Length = 278

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 177/251 (70%), Gaps = 4/251 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           K+LVP+K VI+Y  K+R++ D +G+ET N K+S+NPFDEIA+EE+++++E G A+EV+ V
Sbjct: 29  KVLVPVKRVIDYAVKIRVRPDKTGVETANVKMSVNPFDEIAVEEAIRMKEAGFASEVVAV 88

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIESNET-LEPLSIAKILREIVKKENPIIVIAGKQTT 120
           S+G   V+E ++NS+AMGAD+GI IE+    L+PL +AK+L+++ + E P ++I GKQ  
Sbjct: 89  SLGPKTVQETIRNSIAMGADKGIHIETGTADLQPLGVAKVLKKLAETEKPNLIILGKQAI 148

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKI--IDNHAIVTREVGHGTMTMETPLPAVITVDL 178
           D+++NQT QMLA L+ WPQATF S I++   +N   VTRE+  G  T+   +PA+I+ DL
Sbjct: 149 DDDANQTAQMLAGLLNWPQATFASKIEVDKANNSVKVTREIDGGLETLSMKMPAIISCDL 208

Query: 179 NLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKL 238
            LNEPRY  L NI+K++K  ++ +   D  +D++ ++K +  EE      G+++ S  ++
Sbjct: 209 RLNEPRYAKLQNIMKSKKAELKVQTPQDLGVDISNKIKTISVEEPAKRSGGIKVDSVDQI 268

Query: 239 IEILKSKHDLL 249
           ++ LK KH L+
Sbjct: 269 VQNLK-KHALI 278


>gi|329118360|ref|ZP_08247069.1| electron transfer flavoprotein beta subunit [Neisseria
           bacilliformis ATCC BAA-1200]
 gi|327465584|gb|EGF11860.1| electron transfer flavoprotein beta subunit [Neisseria
           bacilliformis ATCC BAA-1200]
          Length = 248

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 162/230 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K++MNPFDEIA+EE+++L+E G   E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMAMNPFDEIAVEEAVRLKEAGKINEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K E+ L+ +LAMGADR + +E+   LEPL++AK+L+ +  +E P I++ GKQ  
Sbjct: 61  VSLGGKKCEDTLRTALAMGADRAVHVETEAVLEPLAVAKLLKAVADREQPQILLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQT QMLAAL+  PQ TF   I++++N A+VTRE+  G+ T+   LPAVI+ DL L
Sbjct: 121 DDDANQTAQMLAALLNAPQGTFAGKIELLENEAVVTREIDGGSETLALKLPAVISTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGL 230
           NEPRY+ LP I++A+KK +EK       ++   R++ +R+ E +  R G+
Sbjct: 181 NEPRYVKLPQIMQAKKKPLEKLTPEALNVNTAARVQAVRYAEPQTRRAGV 230


>gi|299769079|ref|YP_003731105.1| Electron transfer flavoprotein subunit beta (Beta-ETF)
           [Acinetobacter sp. DR1]
 gi|298699167|gb|ADI89732.1| Electron transfer flavoprotein subunit beta (Beta-ETF)
           [Acinetobacter sp. DR1]
          Length = 249

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 112/249 (44%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++ N KVR+K D SG++  N K+S+NPF EIA+EE+++L+EKG  TE++V
Sbjct: 1   MKALVAVKRVVDANVKVRVKPDNSGVDLTNVKMSINPFCEIAVEEAVRLKEKGTVTEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E +++++A+GADRGIL+E+ + +  L +AKIL+ +V  E P +++ GKQ  
Sbjct: 61  VSVGPKEAQEQIRSAMALGADRGILVETTDEIGALEVAKILKGVVDAEKPELILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQ GQML AL+   Q TF S +K+      VTREV  G  T+E  LPA+IT DL L
Sbjct: 121 DDDSNQVGQMLGALLGAGQGTFASEVKVDGGKVQVTREVDGGLQTVELALPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +LPNI+KARKK ++ K   D+ +    +LK ++ E     + G+++ S  +L+E
Sbjct: 181 NEPRYAALPNIMKARKKPLDTKSPADYGVAAGTKLKTVKVEAPAERKAGVQVKSVDELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|117919853|ref|YP_869045.1| electron transfer flavoprotein beta-subunit [Shewanella sp. ANA-3]
 gi|117612185|gb|ABK47639.1| electron transfer flavoprotein beta-subunit [Shewanella sp. ANA-3]
          Length = 249

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 169/245 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++ N KVR+K D + ++T N K+++NPF EIA+EE+++L+E G ATEV+V
Sbjct: 1   MKVLVPVKRVVDANVKVRVKADNTSVDTANLKMALNPFCEIAVEEAVRLKEAGSATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+  V+E L+ +LA+GADR I I++ E L P+SIAK+L+ + +KE   +V+ GKQ+ 
Sbjct: 61  VSIGNKAVQEQLRTALALGADRAIHIDTEEELTPVSIAKLLKAVQEKEQAQLVLFGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQM AAL   PQATF S IK+  +   V RE+  G  T+  PLPAV+T DL L
Sbjct: 121 DGDNNQTGQMFAALTDMPQATFASEIKVEGHSVQVAREIDGGMQTLSLPLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K ++     D  + L     V++       + G+ + S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKRKPLDVLTVADLGVTLKAHQTVVKVTPPAERKAGIMVASVAELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|225433053|ref|XP_002284752.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|296083620|emb|CBI23609.3| unnamed protein product [Vitis vinifera]
          Length = 251

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 118/248 (47%), Positives = 171/248 (68%), Gaps = 4/248 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+V IK V++Y  K+R+K+D SG+ET N K+SMNPF EI LEE+L+++E G+A+EVI 
Sbjct: 1   MKIMVAIKRVVDYAVKIRVKSDKSGVETSNVKMSMNPFCEIGLEEALRIKESGLASEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  +  + L+  LAMGADR I +E++ TL PLS+AK+L+ +V  E P ++I GKQ  
Sbjct: 61  VSVGPSQCVDTLRTGLAMGADRAIHVEASATLYPLSVAKLLKALVDVEKPGLLILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNH---AIVTREVGHGTMTMETPLPAVITVD 177
           D++ NQTGQM+A L+ WPQ TF S + ++D     A V REV  G  T+   LPAVIT D
Sbjct: 121 DDDCNQTGQMVAGLLNWPQGTFASKV-VLDKEKEVATVEREVDGGLETLCLDLPAVITTD 179

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LN+PRY +LPNI+KA+ K I+K    +  +D+   L+V++  E    + G+ + S  +
Sbjct: 180 LRLNQPRYATLPNIMKAKSKVIKKFTPQELNVDIKSDLEVVQVTEPPKRKAGVIVSSVDE 239

Query: 238 LIEILKSK 245
           LI+ LK++
Sbjct: 240 LIDQLKNE 247


>gi|89092150|ref|ZP_01165105.1| Electron transfer flavoprotein, beta subunit [Oceanospirillum sp.
           MED92]
 gi|89083885|gb|EAR63102.1| Electron transfer flavoprotein, beta subunit [Oceanospirillum sp.
           MED92]
          Length = 249

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 173/245 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+YN KVR+K D S ++  N K+++NPF EIA+EE+++L+E G A+EV+V
Sbjct: 1   MKVLVAVKRVIDYNVKVRVKADNSDVDLANVKMALNPFCEIAIEEAVRLKEAGTASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIGS   EE ++ +LA+GADRG+ I++ +  + LS++K+L ++V+KE P +VI GKQ  
Sbjct: 61  VSIGSKSCEEQIRTALALGADRGVRIDTEDGPDSLSVSKLLAKVVEKEAPGMVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQML AL+  PQ TF S +K+  +   VTREV  G  T+E  +PA++T DL L
Sbjct: 121 DSDNNQTGQMLGALLDRPQGTFASEVKVDGDKVQVTREVDGGLQTVELAMPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K +E     D  + ++  L +LR +     + G+ + S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKRKPLEVISPDDLGVTVSSNLSLLRVDPPAERQAGIMVGSVDELVE 240

Query: 241 ILKSK 245
            L+++
Sbjct: 241 KLRNE 245


>gi|93005357|ref|YP_579794.1| electron transfer flavoprotein beta-subunit [Psychrobacter
           cryohalolentis K5]
 gi|92393035|gb|ABE74310.1| electron transfer flavoprotein beta-subunit [Psychrobacter
           cryohalolentis K5]
          Length = 249

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 114/249 (45%), Positives = 174/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K VI+YN KVR+K D SG++  NTK+S+NPFDEIA+EE+++L+E G+  E+IV
Sbjct: 1   MKALVAVKRVIDYNVKVRVKADNSGVDLSNTKMSINPFDEIAVEEAVRLKEAGVIDEIIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            SIG  + +E ++ +LA+GADRGIL+ ++    PL IAKIL+ I + E   I++ GKQ  
Sbjct: 61  ASIGPKESQEQIRAALALGADRGILVVTDAKPYPLQIAKILKNIAESEATDIILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAALM   Q TF S +K+  +   VTRE+  G  T+   LPAVIT DL L
Sbjct: 121 DDDNNQTGQMLAALMGIGQGTFASEVKVEGDKVNVTREIDGGLQTVALDLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  LPNI+KA+KK++++K   DF +D+  + ++++       + G+++ S  +L++
Sbjct: 181 NEPRYAKLPNIMKAKKKQLDEKTPADFGVDMASKQEIIKVVPPAERKAGIKVGSVDELVD 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|107102502|ref|ZP_01366420.1| hypothetical protein PaerPA_01003565 [Pseudomonas aeruginosa PACS2]
          Length = 240

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 110/240 (45%), Positives = 166/240 (69%)

Query: 10  VINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVE 69
           +++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ATE++ VS+G    +
Sbjct: 1   MVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVAVSVGPTAAQ 60

Query: 70  EVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQ 129
           E L+ +LA+GADR IL+ESN+ L  L++AK+L+ +V KE P +VI GKQ  D+++NQTGQ
Sbjct: 61  EQLRTALALGADRAILVESNDELNSLAVAKLLKAVVDKEQPQLVILGKQAIDSDNNQTGQ 120

Query: 130 MLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLP 189
           MLAAL  + Q TF S +++  +   VTRE+  G  T+   LPA++T DL LNEPRY SLP
Sbjct: 121 MLAALTGYAQGTFASKVEVAGDKVNVTREIDGGLQTVALNLPAIVTTDLRLNEPRYASLP 180

Query: 190 NIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIEILKSKHDLL 249
           NI+KA+KK ++        +     +K L+ E   A   G+++ S  +L+E LK++  ++
Sbjct: 181 NIMKAKKKPLDVVTPDALGVSTASTVKTLKVEAPAARSAGIKVKSVAELVEKLKNEAKVI 240


>gi|254524389|ref|ZP_05136444.1| electron transfer flavoprotein beta subunit [Stenotrophomonas sp.
           SKA14]
 gi|219721980|gb|EED40505.1| electron transfer flavoprotein beta subunit [Stenotrophomonas sp.
           SKA14]
          Length = 248

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 164/245 (66%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ T+  K+S NPFDEIALEE+L+LR+KGIA+EV+V
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVVTDGVKLSPNPFDEIALEEALRLRDKGIASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            +I     +  L+N LAMGA+R I + +++ ++PL+ A+ L ++++KE P +VI GKQ  
Sbjct: 61  ATIAPADAQAHLRNGLAMGANRAIHVVTDQAIQPLTAARTLLKLIEKEQPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF S ++I D  A VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFASKLEIADGKATVTREVDAGLETLEVDLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LP+I+KA+ K +E  +  D  ++     K   +       KG+ +    +L+ 
Sbjct: 181 NEPRFIKLPDIMKAKAKPLETLQLADLGVEAADTFKTTHYAAPSKRSKGVMVKDAAELVA 240

Query: 241 ILKSK 245
            LK K
Sbjct: 241 ALKQK 245


>gi|161831266|ref|YP_001596989.1| electron transfer flavoprotein, beta subunit [Coxiella burnetii RSA
           331]
 gi|161763133|gb|ABX78775.1| electron transfer flavoprotein, beta subunit [Coxiella burnetii RSA
           331]
          Length = 250

 Score =  232 bits (592), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 171/249 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V+++  KVR+K D SGIET+  K+SMNPFDEIALEE+++++EKG+A+EVIV
Sbjct: 1   MKILVGVKRVVDFKVKVRVKADGSGIETDQIKMSMNPFDEIALEEAIRIKEKGLASEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG     E L N+LAMGADR +LI++ +  EP+ +A +L+ +++ E+P ++I GKQ  
Sbjct: 61  VSIGLEACRETLLNALAMGADRALLIKTAQAQEPIHVAHLLKVLIENESPTLLILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQTGQMLAAL+ W Q TFVS   I  +   +TREV  G  T+   LPAVIT DL L
Sbjct: 121 DDDCNQTGQMLAALLDWGQGTFVSKCDIEGDQLRITREVDTGLETLLVQLPAVITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N+PRY +LPNI+KA+ K +      +  + LTP L  L+ E       G+++ +  +L+ 
Sbjct: 181 NKPRYPTLPNIMKAKSKPLTILTPEELGVTLTPHLTTLKIESPPQRAPGIKVNNINELLN 240

Query: 241 ILKSKHDLL 249
           +LK K  +L
Sbjct: 241 LLKQKDKVL 249


>gi|190572698|ref|YP_001970543.1| putative electron transfer flavoprotein subunit beta
           [Stenotrophomonas maltophilia K279a]
 gi|190010620|emb|CAQ44229.1| putative electron transfer flavoprotein subunit beta
           [Stenotrophomonas maltophilia K279a]
          Length = 248

 Score =  232 bits (592), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 165/245 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ T+  K+S NPFDEIALEE+L+LR+KGIATEV+V
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVVTDGVKLSPNPFDEIALEEALRLRDKGIATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            +I     +  L+N LAMGA+R I + +++ ++PL+ ++ L ++++KE P +VI GKQ  
Sbjct: 61  ATIAPADAQAHLRNGLAMGANRAIHVVTDQAIQPLTASRTLLKLIEKEQPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF S ++I D  A VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFASKLEIADGKATVTREVDAGLETLEVDLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LP+I+KA+ K +E  +  D  ++     K  ++       KG+ +    +L+ 
Sbjct: 181 NEPRFIKLPDIMKAKAKPLETLQLADLGVEAADTFKTTQYVAPSKRSKGVMVKDAAELVA 240

Query: 241 ILKSK 245
            LK K
Sbjct: 241 ALKQK 245


>gi|293609892|ref|ZP_06692194.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828344|gb|EFF86707.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325123124|gb|ADY82647.1| electron transfer flavoprotein beta-subunit [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 249

 Score =  232 bits (591), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 111/249 (44%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++ N KVR+K D SG++  N K+S+NPF EIA+EE+++L+EKG  +E++V
Sbjct: 1   MKALVAVKRVVDANVKVRVKPDNSGVDLTNVKMSINPFCEIAVEEAVRLKEKGTVSEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E +++++A+GADRGIL+E+ + +  L +AKIL+ +V+ E P +++ GKQ  
Sbjct: 61  VSVGPKEAQEQIRSAMALGADRGILVETTDEIGALEVAKILKGVVEAEKPELILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQ GQML AL+   Q TF S +K+      VTREV  G  T+E  LPA+IT DL L
Sbjct: 121 DDDSNQVGQMLGALLGAGQGTFASEVKVDGGKVQVTREVDGGLQTVELTLPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +LPNI+KARKK ++ K   D+ +    +LK ++ E     + G+++ S  +L+E
Sbjct: 181 NEPRYAALPNIMKARKKPLDTKSPADYGVTAGTKLKTVKVEAPAERKAGVQVKSVDELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|262278122|ref|ZP_06055907.1| electron transfer flavoprotein subunit beta [Acinetobacter
           calcoaceticus RUH2202]
 gi|262258473|gb|EEY77206.1| electron transfer flavoprotein subunit beta [Acinetobacter
           calcoaceticus RUH2202]
          Length = 249

 Score =  232 bits (591), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 111/249 (44%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++ N KVR+K D SG++  N K+S+NPF EIA+EE+++L+EKG  +E++V
Sbjct: 1   MKALVAVKRVVDANVKVRVKPDNSGVDLTNVKMSINPFCEIAVEEAVRLKEKGTVSEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E +++++A+GADRGIL+E+ + +  L +AKIL+ +V  E P +++ GKQ  
Sbjct: 61  VSVGPKEAQEQIRSAMALGADRGILVETTDEIGALEVAKILKGVVDAEKPELILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQ GQML AL+   Q TF S +K+      VTREV  G  T+E  LPA+IT DL L
Sbjct: 121 DDDSNQVGQMLGALLGAGQGTFASEVKVDGGKVQVTREVDGGLQTVELALPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +LPNI+KARKK ++ K   D+ +    +LK ++ E     + G+++ S  +L+E
Sbjct: 181 NEPRYAALPNIMKARKKPLDTKSPADYGVTAGTKLKTVKVEAPAERKAGVQVKSVDELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|169632681|ref|YP_001706417.1| electron transfer flavoprotein beta-subunit [Acinetobacter
           baumannii SDF]
 gi|184159191|ref|YP_001847530.1| electron transfer flavoprotein subunit beta [Acinetobacter
           baumannii ACICU]
 gi|239500992|ref|ZP_04660302.1| electron transfer flavoprotein subunit beta [Acinetobacter
           baumannii AB900]
 gi|260556506|ref|ZP_05828724.1| electron transfer flavoprotein subunit beta [Acinetobacter
           baumannii ATCC 19606]
 gi|332876020|ref|ZP_08443806.1| electron transfer flavoprotein subunit beta [Acinetobacter
           baumannii 6014059]
 gi|169151473|emb|CAP00224.1| electron transfer flavoprotein beta-subunit [Acinetobacter
           baumannii]
 gi|183210785|gb|ACC58183.1| Electron transfer flavoprotein, beta subunit [Acinetobacter
           baumannii ACICU]
 gi|193078104|gb|ABO13045.2| electron transfer flavoprotein beta-subunit [Acinetobacter
           baumannii ATCC 17978]
 gi|260409765|gb|EEX03065.1| electron transfer flavoprotein subunit beta [Acinetobacter
           baumannii ATCC 19606]
 gi|322509105|gb|ADX04559.1| etfB [Acinetobacter baumannii 1656-2]
 gi|323519135|gb|ADX93516.1| electron transfer flavoprotein subunit beta [Acinetobacter
           baumannii TCDC-AB0715]
 gi|332735886|gb|EGJ66927.1| electron transfer flavoprotein subunit beta [Acinetobacter
           baumannii 6014059]
          Length = 249

 Score =  232 bits (591), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 111/249 (44%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++ N KVR+K D SG++  N K+S+NPF EIA+EE+++L+EKG  +E++V
Sbjct: 1   MKALVAVKRVVDANVKVRVKPDNSGVDLTNVKMSINPFCEIAVEEAVRLKEKGTVSEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E +++++A+GADRGIL+E+ + +  L +AKIL+ +V  E P +++ GKQ  
Sbjct: 61  VSIGPKEAQEQIRSAMALGADRGILVETTDEIGALEVAKILKGVVDAEKPELILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQ GQML AL+   Q TF S +K+      VTRE+  G  T+E  LPA+IT DL L
Sbjct: 121 DDDSNQVGQMLGALLGAGQGTFASEVKVDGGKVQVTREIDGGLQTVELALPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +LPNI+KARKK ++ K   D+ +    +LK ++ E     + G+++ S  +L+E
Sbjct: 181 NEPRYAALPNIMKARKKPLDTKSPADYGVTAGTKLKTIKVEAPAERKAGVQVKSVDELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|169795025|ref|YP_001712818.1| electron transfer flavoprotein beta-subunit [Acinetobacter
           baumannii AYE]
 gi|213158312|ref|YP_002320363.1| electron transfer flavoprotein subunit beta [Acinetobacter
           baumannii AB0057]
 gi|215482573|ref|YP_002324765.1| Electron transfer flavoprotein subunit beta (Beta-ETF)
           [Acinetobacter baumannii AB307-0294]
 gi|260549308|ref|ZP_05823528.1| electron transfer flavoprotein subunit beta [Acinetobacter sp.
           RUH2624]
 gi|301345402|ref|ZP_07226143.1| Electron transfer flavoprotein subunit beta (Beta-ETF)
           [Acinetobacter baumannii AB056]
 gi|301511584|ref|ZP_07236821.1| Electron transfer flavoprotein subunit beta (Beta-ETF)
           [Acinetobacter baumannii AB058]
 gi|301594796|ref|ZP_07239804.1| Electron transfer flavoprotein subunit beta (Beta-ETF)
           [Acinetobacter baumannii AB059]
 gi|332865653|ref|ZP_08436479.1| electron transfer flavoprotein subunit beta [Acinetobacter
           baumannii 6013113]
 gi|169147952|emb|CAM85815.1| electron transfer flavoprotein beta-subunit [Acinetobacter
           baumannii AYE]
 gi|213057472|gb|ACJ42374.1| electron transfer flavoprotein subunit beta [Acinetobacter
           baumannii AB0057]
 gi|213986509|gb|ACJ56808.1| Electron transfer flavoprotein subunit beta (Beta-ETF)
           [Acinetobacter baumannii AB307-0294]
 gi|260407714|gb|EEX01187.1| electron transfer flavoprotein subunit beta [Acinetobacter sp.
           RUH2624]
 gi|332735174|gb|EGJ66254.1| electron transfer flavoprotein subunit beta [Acinetobacter
           baumannii 6013113]
          Length = 249

 Score =  232 bits (591), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 111/249 (44%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++ N KVR+K D SG++  N K+S+NPF EIA+EE+++L+EKG  +E++V
Sbjct: 1   MKALVAVKRVVDANVKVRVKPDNSGVDLTNVKMSINPFCEIAVEEAVRLKEKGTVSEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E +++++A+GADRGIL+E+ + +  L +AKIL+ +V  E P +++ GKQ  
Sbjct: 61  VSIGPKEAQEQIRSAMALGADRGILVETTDEIGALEVAKILKGVVDAEKPELILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQ GQML AL+   Q TF S +K+      VTRE+  G  T+E  LPA+IT DL L
Sbjct: 121 DDDSNQVGQMLGALLGAGQGTFASEVKVDGGKVQVTREIDGGLQTVELALPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +LPNI+KARKK ++ K   D+ +    +LK ++ E     + G+++ S  +L+E
Sbjct: 181 NEPRYAALPNIMKARKKPLDTKSPADYGVTAGTKLKTVKVEAPAERKAGVQVKSVDELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|194364280|ref|YP_002026890.1| electron transfer flavoprotein subunit alpha/beta [Stenotrophomonas
           maltophilia R551-3]
 gi|194347084|gb|ACF50207.1| Electron transfer flavoprotein alpha/beta-subunit [Stenotrophomonas
           maltophilia R551-3]
          Length = 248

 Score =  232 bits (591), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 165/245 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ T+  K+S NPFDEIALEE+L+LR+KGIA+EV+V
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVVTDGVKLSPNPFDEIALEEALRLRDKGIASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            +I     +  L+N LAMGA+R I + +++ ++PL+ ++ L ++++KE P +VI GKQ  
Sbjct: 61  ATIAPADAQAHLRNGLAMGANRAIHVVTDQAIQPLTASRTLLKLIEKEQPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF S ++I D  A VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFASKLEIADGKATVTREVDAGLETLEVDLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LP+I+KA+ K +E  +  D  ++     K  ++       KG+ +    +L+ 
Sbjct: 181 NEPRFIKLPDIMKAKAKPLETLQLADLGVEAADTFKTTQYAAPSKRSKGVMVKDAAELVA 240

Query: 241 ILKSK 245
            LK K
Sbjct: 241 ALKQK 245


>gi|118489488|gb|ABK96546.1| unknown [Populus trichocarpa x Populus deltoides]
          Length = 251

 Score =  232 bits (591), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 115/252 (45%), Positives = 176/252 (69%), Gaps = 4/252 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+V IK V++Y  K+R+K+D SG+ET+N K+SMNPF EIALEE+L++++ G+A+EV+ 
Sbjct: 1   MKIMVAIKRVVDYAVKIRVKSDKSGVETQNVKMSMNPFCEIALEEALRIKQSGLASEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+GS +  + L+  LAMGADRGI +ES+  L PL++AK+L+ +V+ E P ++I GKQ  
Sbjct: 61  VSMGSTQCVDTLRTGLAMGADRGIHVESSAALFPLTVAKLLKALVEVEKPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNH---AIVTREVGHGTMTMETPLPAVITVD 177
           D++ NQTGQM+A L+ WPQ TF S + ++D     A V REV  G  T+   LPAVIT D
Sbjct: 121 DDDCNQTGQMVAGLLGWPQGTFASKV-LLDTEKQVATVEREVDDGLETLCLDLPAVITTD 179

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LN+PRY +LPNI+KA+ K I+K    +  +++   ++V+   E    + G+ + S  +
Sbjct: 180 LRLNQPRYATLPNIMKAKSKVIKKYTPQELNVEVKSDIEVVEVTEPPKRKAGVIISSVDE 239

Query: 238 LIEILKSKHDLL 249
           LI+ L+++  ++
Sbjct: 240 LIDKLRNEAHVI 251


>gi|119774306|ref|YP_927046.1| electron transfer flavoprotein subunit beta [Shewanella amazonensis
           SB2B]
 gi|119766806|gb|ABL99376.1| electron transfer flavoprotein, beta subunit [Shewanella
           amazonensis SB2B]
          Length = 249

 Score =  232 bits (591), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 172/245 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++ N KVR+K D + ++T N K+++NPF EIA+EE+++L+E G A+E++V
Sbjct: 1   MKILVPVKRVVDANVKVRVKADNTDVDTANLKMAINPFCEIAVEEAVRLKEAGHASEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+GS  V+E ++ ++A+GADRGI +E+++ L  +SIAKIL+ +  KE   +V+ GKQ+ 
Sbjct: 61  VSVGSKAVQEQMRTAMALGADRGIHVEADDNLPAISIAKILKAVQDKEQAQLVLLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAALM  PQATF S + +     +VTREV  G  T++ P+PA++T DL L
Sbjct: 121 DGDNNQTGQMLAALMDAPQATFASKVVVEGGELLVTREVDGGLQTLKLPMPAIVTSDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  LP+I+KA++K ++     D  + L    K+L        + G+++ S  +L+E
Sbjct: 181 NEPRYAKLPDIMKAKRKPLDTLSPADLGVTLKQHHKLLSVAAPATRQAGIKVSSVEELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|226943758|ref|YP_002798831.1| electron transfer flavoprotein subunit beta [Azotobacter vinelandii
           DJ]
 gi|226718685|gb|ACO77856.1| electron transfer flavoprotein beta subunit [Azotobacter vinelandii
           DJ]
          Length = 249

 Score =  231 bits (590), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 171/245 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+YN KVR+K D S ++  N K++MNPF EIA+E +++L+E G+A+E++ 
Sbjct: 1   MKVLVTVKRVIDYNVKVRVKPDQSDVDLANVKMAMNPFCEIAVEAAVRLKEAGLASEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G    +E L+ +LA+GADRGI I+S E  +PL +AK+L  +V  E P +VI GKQ+ 
Sbjct: 61  VSVGPAACQEQLRTALALGADRGIQIDSGEAPDPLGVAKLLAAVVAAEKPDLVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAAL+ WPQATF S + +      VTRE+  G  ++E  LPA++T DL L
Sbjct: 121 DGDNNQTGQMLAALLDWPQATFASALALEAGRLRVTREIDGGLQSLELNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E K   +  + L    ++L+ E     + G+++ S ++L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEVKSPVELGVTLKAHTRLLKVEAPAERQGGIKVGSVSELVE 240

Query: 241 ILKSK 245
            LKS+
Sbjct: 241 KLKSE 245


>gi|148652426|ref|YP_001279519.1| electron transfer flavoprotein, alpha/beta-subunit-like protein
           [Psychrobacter sp. PRwf-1]
 gi|148571510|gb|ABQ93569.1| Electron transfer flavoprotein, alpha/beta-subunit-like protein
           [Psychrobacter sp. PRwf-1]
          Length = 249

 Score =  231 bits (590), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 174/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K VI+YN KVR+K D SG++  NTK+S+NPF EIA+EE+++L+E GI  EVIV
Sbjct: 1   MKALVAVKRVIDYNVKVRVKADNSGVDLSNTKMSINPFCEIAVEEAVRLKEAGIVDEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            SIG  + +E ++ +LA+GADRGIL++++E   PL +AKIL+ I ++E   I++ GKQ  
Sbjct: 61  ASIGPKEAQEQIRAALALGADRGILVQTDEKPYPLQVAKILKGIAEQEATDIILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAALM   Q TF S +K+  +   VTRE+  G  T+   LPAVIT DL L
Sbjct: 121 DDDNNQTGQMLAALMGIGQGTFASEVKVEGDKVNVTREIDGGLQTVALSLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  LPNI+KA+KK +++K   DF +++  + ++++         G+++ S  +LI+
Sbjct: 181 NEPRYAKLPNIMKAKKKPLDEKTPADFGVEMASKQEIIKVTPPPERSAGVKVGSVDELID 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|255320344|ref|ZP_05361528.1| electron transfer flavoprotein subunit beta [Acinetobacter
           radioresistens SK82]
 gi|262379373|ref|ZP_06072529.1| electron transfer flavoprotein subunit beta [Acinetobacter
           radioresistens SH164]
 gi|255302539|gb|EET81772.1| electron transfer flavoprotein subunit beta [Acinetobacter
           radioresistens SK82]
 gi|262298830|gb|EEY86743.1| electron transfer flavoprotein subunit beta [Acinetobacter
           radioresistens SH164]
          Length = 250

 Score =  231 bits (590), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 113/250 (45%), Positives = 174/250 (69%), Gaps = 1/250 (0%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++ N KVR+K D+SG++  N K+S+NPF EIA+EE+++L+EKG  +E++V
Sbjct: 1   MKALVAVKRVVDANVKVRVKPDHSGVDLTNVKMSINPFCEIAVEEAVRLKEKGTVSEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE-SNETLEPLSIAKILREIVKKENPIIVIAGKQT 119
           VSIG  + +E +++++A+GADRGIL+E + + +  L +AKIL+ IV++E P I++ GKQ 
Sbjct: 61  VSIGPKEAQEQIRSAMALGADRGILVETATDEIGALEVAKILKGIVEQEQPEIILLGKQA 120

Query: 120 TDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLN 179
            D++SNQ GQML AL+   Q TF S +K+      VTRE+  G  T+E  LPA+IT DL 
Sbjct: 121 IDDDSNQVGQMLGALLGAGQGTFASEVKVEGGKVQVTREIDGGLQTVELSLPAIITTDLR 180

Query: 180 LNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLI 239
           LNEPRY +LPNI+KARKK +E K   D+ +    +LK ++ E     + G+++ S  +L+
Sbjct: 181 LNEPRYAALPNIMKARKKPLETKSPADYGVTAASKLKTVKVESPAERQAGVQVKSVDELV 240

Query: 240 EILKSKHDLL 249
             LK++  ++
Sbjct: 241 NKLKNEAKVI 250


>gi|312884141|ref|ZP_07743853.1| electron transfer flavoprotein subunit beta [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309368189|gb|EFP95729.1| electron transfer flavoprotein subunit beta [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 250

 Score =  231 bits (590), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 174/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV IK VI+   K+R+++D SG+ET N K+++NPF EIA+EE+++L+E G+A+EV+V
Sbjct: 1   MKILVAIKRVIDPYAKIRVQSDGSGVETNNVKMTINPFCEIAVEEAIRLKELGVASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+ +LA+GADR I +++ +T  PLS+AKIL+EI K+E   +V+ GKQ+ 
Sbjct: 61  VSIGDKSCQEQLRGALALGADRAIQVDTAKTCHPLSVAKILKEIAKQEQVGLVLLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           DN++NQ  QMLA L  WPQATF S +KI D  A +TRE+  G  T++  LPAV++ DL L
Sbjct: 121 DNDNNQVPQMLAGLCGWPQATFASEVKIEDETATITREIDGGLETLKLSLPAVVSTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K ++  + +   I+ +   ++L   E      G+ + S ++L++
Sbjct: 181 NEPRYASLPNIMKAKRKPLDVIELSSLDIEPSDSQEILEVFEPSKREAGVMVSSVSELVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|45361035|ref|NP_989154.1| electron-transfer-flavoprotein, beta polypeptide [Xenopus
           (Silurana) tropicalis]
 gi|38494280|gb|AAH61629.1| electron-transfer-flavoprotein, beta polypeptide [Xenopus
           (Silurana) tropicalis]
 gi|51895914|gb|AAH80971.1| electron-transfer-flavoprotein, beta polypeptide [Xenopus
           (Silurana) tropicalis]
 gi|89272447|emb|CAJ82868.1| electron-transfer-flavoprotein, beta polypeptide [Xenopus
           (Silurana) tropicalis]
          Length = 254

 Score =  231 bits (589), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 115/247 (46%), Positives = 165/247 (66%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           ++ LV +K VI+Y  KVR+K D +G+ T+  K SMNPF EIA+EE+++L+EK I +E+I 
Sbjct: 3   LRALVGVKRVIDYAVKVRVKPDKTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKIVSEIIA 62

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + +E ++ +LAMGADRGI +E      E+L P  ++KI+  + KKEN  +V+ G
Sbjct: 63  VSCGPQQCQETIRTALAMGADRGIHVEVAAKDAESLGPFQVSKIMAALAKKENVNLVLMG 122

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQM AAL+ WPQ TF S +K+      V REV  G  T+   LPAV+T 
Sbjct: 123 KQAIDDDCNQTGQMTAALLDWPQGTFASEVKVEGEKLTVVREVDGGLETISVKLPAVVTA 182

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+IE  K +D  +D+T R++VL  E+      G+++ +  
Sbjct: 183 DLRLNEPRYATLPNIMKAKKKKIETVKPSDLGVDITSRIRVLSVEDPPQRLAGVKVETVQ 242

Query: 237 KLIEILK 243
            L+  LK
Sbjct: 243 DLVSKLK 249


>gi|91775080|ref|YP_544836.1| electron transfer flavoprotein beta-subunit [Methylobacillus
           flagellatus KT]
 gi|91709067|gb|ABE48995.1| electron transfer flavoprotein beta-subunit [Methylobacillus
           flagellatus KT]
          Length = 248

 Score =  231 bits (589), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 110/243 (45%), Positives = 169/243 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN K R+K D S ++    K+ +NPFDEIA+EE+++++E+GI TEV+ 
Sbjct: 1   MKVLVAVKHVVDYNIKPRVKQDGSDVDIAGVKMGINPFDEIAVEEAVRMKERGIVTEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    ++ L+++LAMGADR IL+E+   L+PL +AK+L+ +V++E P ++I GKQ  
Sbjct: 61  VTIGKTNSQDTLRHALAMGADRVILVETEAELQPLGVAKLLKAVVEREQPRLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++  QTGQMLAAL+   Q TF S +++  +   VTRE+  GT  +   LPAV+T DL L
Sbjct: 121 DDDLGQTGQMLAALINAGQGTFASVLEVKGDEIEVTREIDGGTDVVALKLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LP ++ A+KK IE  KA D  ID+ PRLK L+  +    + G+++ +  +L+E
Sbjct: 181 NEPRFIKLPAMMMAKKKPIENIKAADLGIDIAPRLKQLKVADPEPRKPGIKVANVAELVE 240

Query: 241 ILK 243
            L+
Sbjct: 241 KLR 243


>gi|328774290|gb|EGF84327.1| hypothetical protein BATDEDRAFT_18619 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 254

 Score =  231 bits (588), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 113/253 (44%), Positives = 173/253 (68%), Gaps = 6/253 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           +++LV +K V++Y  K+R+      +ET N K SMNPFDEIA+EE+++L+EK +A+EVI 
Sbjct: 4   LRVLVGVKRVVDYAVKIRVVGGK--VETANVKHSMNPFDEIAIEEAVRLKEKKVASEVIA 61

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNET--LEPLSIAKILREIVKKENPIIVIAGKQ 118
           +++G  K +E L+ +LAMGAD+ I IE+ E   ++PL +AK+ + I++KE+P +VI GKQ
Sbjct: 62  LTVGPAKSQETLRTALAMGADKAIHIETAEGQDVQPLQVAKLFKAIIQKESPGLVILGKQ 121

Query: 119 TTDNESNQTGQMLAALMRWPQATFVSNIKIID--NHAIVTREVGHGTMTMETPLPAVITV 176
             D+++ QTGQ+LA L+ WPQ TF S I+  D     +VTRE+  G  T++ PLPA++T 
Sbjct: 122 AIDDDAGQTGQLLAGLLNWPQGTFASKIEFTDAAKKILVTREIDGGLETLKAPLPAIVTA 181

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK +EK   +D  +DL P ++ L   E      G ++ S  
Sbjct: 182 DLRLNEPRYATLPNIMKAKKKPLEKLTPSDLGVDLAPSIETLSIAEPAKRAGGKKVESVD 241

Query: 237 KLIEILKSKHDLL 249
           +LI  LK++  ++
Sbjct: 242 ELISKLKNEAGVI 254


>gi|152997026|ref|YP_001341861.1| electron transfer flavoprotein subunit alpha/beta [Marinomonas sp.
           MWYL1]
 gi|150837950|gb|ABR71926.1| Electron transfer flavoprotein alpha/beta-subunit [Marinomonas sp.
           MWYL1]
          Length = 249

 Score =  231 bits (588), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 112/243 (46%), Positives = 167/243 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+YN KVR+K D S ++  N K++MNPF EIA+EE+++L+E G+A+EVIV
Sbjct: 1   MKILVGVKRVIDYNVKVRVKADQSNVDLTNVKMAMNPFCEIAVEEAVRLKEAGVASEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           +S+G+ + +E L+N++A+GADR IL+E+   +EPL++AK    +V+KE P +VI GKQ+ 
Sbjct: 61  MSVGTTQSQEQLRNAMALGADRAILVEAESDVEPLNVAKAFAAVVEKEQPGLVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ GQMLAAL + PQ TF S + I    A+VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQMGQMLAALTKRPQGTFASKLVIDGGKALVTREIDGGLRTIALTLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  LP+I+KA++K +E     D  +      ++ + E       G+++ S  +LI 
Sbjct: 181 NEPRYAKLPDIMKAKRKPLETLPLADLGVTSKAHCRIDKVEAPATRSAGIKVASVDELIS 240

Query: 241 ILK 243
            LK
Sbjct: 241 KLK 243


>gi|56459625|ref|YP_154906.1| electron transfer flavoprotein subunit beta [Idiomarina loihiensis
           L2TR]
 gi|56178635|gb|AAV81357.1| Electron transfer flavoprotein, beta subunit [Idiomarina loihiensis
           L2TR]
          Length = 249

 Score =  231 bits (588), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+YN KVR+K D S ++  N K+++NPF EIA+EE+++L+E G A EV+V
Sbjct: 1   MKILVAVKRVIDYNVKVRVKPDQSDVDLANVKMALNPFCEIAVEEAVRLKEAGTADEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG   V+E L+ +LA+GADR I +E+++  + LS AKIL+ +V+KE P +VI GKQ+ 
Sbjct: 61  VSIGPKAVQEQLRTALALGADRAIQVETDDMPDSLSAAKILKGVVEKEGPDMVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQML AL   PQ TF S +++ D    VTRE+  G  T++  LPAV+T DL L
Sbjct: 121 DSDNNQTGQMLGALTGMPQGTFASKVEVGDGFVNVTREIDGGLQTVKLTLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K +E     +  +++   +K+L+ E       G+++    +L++
Sbjct: 181 NEPRYASLPNIMKAKRKPLETTTPDELGVEVKRTIKLLKVETPAERSAGVKVADVDELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAKVL 249


>gi|255576816|ref|XP_002529294.1| electron transfer flavoprotein beta-subunit, putative [Ricinus
           communis]
 gi|223531218|gb|EEF33063.1| electron transfer flavoprotein beta-subunit, putative [Ricinus
           communis]
          Length = 251

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 116/248 (46%), Positives = 170/248 (68%), Gaps = 4/248 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++Y  K+R+K D SG+ET+N K+SMNPF EIALEE+L+++E G+A+EV+ 
Sbjct: 1   MKILVAVKRVVDYAVKIRVKPDKSGVETQNVKMSMNPFCEIALEEALRIKEAGLASEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G     + L+  LAMGADRGI +E+NE L PL++AK+L+ +V  E P ++I GKQ  
Sbjct: 61  VSMGPKHCVDTLRTGLAMGADRGIHVEANEALYPLTVAKVLKALVALEKPGLIIMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNH---AIVTREVGHGTMTMETPLPAVITVD 177
           D++ NQTGQM+A L+ WPQ TF S + ++D     A V REV  G  T+   LPAVIT D
Sbjct: 121 DDDCNQTGQMVAGLLGWPQGTFASKV-LLDKEKQVATVEREVDGGLETLCLDLPAVITTD 179

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LN+PRY +LPNI+KA+ K I+K    +  ++    ++++   E    + G+ + S  +
Sbjct: 180 LRLNQPRYATLPNIMKAKSKVIKKYTPEELNVETKSDIEIIEVTEPPKRKAGVIVSSVDE 239

Query: 238 LIEILKSK 245
           LI+ LK++
Sbjct: 240 LIDKLKNE 247


>gi|262373154|ref|ZP_06066433.1| electron transfer flavoprotein subunit beta [Acinetobacter junii
           SH205]
 gi|262313179|gb|EEY94264.1| electron transfer flavoprotein subunit beta [Acinetobacter junii
           SH205]
          Length = 249

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 171/249 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++ N KVR+K D SG++  N K+S+NPF EIA+EE+++L+EKG  +E++V
Sbjct: 1   MKALVAVKRVVDANVKVRVKPDNSGVDLTNVKMSINPFCEIAVEEAVRLKEKGTVSEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G    +E +++++A+GADRGIL+E+ + +  L +AKIL+ +V  E P +++ GKQ  
Sbjct: 61  VSVGPKDAQEQIRSAMALGADRGILVETADEIGALEVAKILKGVVDAEKPELILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQ GQML AL+   Q TF S +K+      VTRE+  G  T+E  LPA+IT DL L
Sbjct: 121 DDDSNQVGQMLGALLGAGQGTFASEVKVDGGKVQVTREIDGGLQTVELALPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY +LPNI+KARKK ++ K   D+ +    +LK ++ E     + G+++ S  +L+E
Sbjct: 181 NEPRYAALPNIMKARKKPLDIKSPADYGVATGTKLKTIKVEAPAERKAGVQVKSVDELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|157962674|ref|YP_001502708.1| electron transfer flavoprotein subunit alpha/beta [Shewanella
           pealeana ATCC 700345]
 gi|157847674|gb|ABV88173.1| Electron transfer flavoprotein alpha/beta-subunit [Shewanella
           pealeana ATCC 700345]
          Length = 249

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 168/245 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++ N KVR+  D +G++T N K+++NPF EIA+EE+++L+E G A+E++V
Sbjct: 1   MKVLVPVKRVVDANVKVRVNADNTGVDTANLKMAINPFCEIAVEEAVRLKEAGSASEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           +SIG    +E L+ +LA+GADR I IE+ E L PLSIAK++  + +KE   +VI GKQ+ 
Sbjct: 61  LSIGPKASQEQLRTALALGADRAIHIETEEDLVPLSIAKLIHAVQQKEQAELVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAA+ + PQATF S +K+  +  +V RE+  G  T+  PLPAV+T DL L
Sbjct: 121 DGDNNQTGQMLAAIAKMPQATFASEVKLDGDKLVVIREIDGGLQTIRLPLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  LPNI+KA++K +E     DF + L     +L+         G+ + S  +L+E
Sbjct: 181 NEPRYAKLPNIMKAKRKPLEALTPADFDVTLKSHQNILKVAPPAERSGGVMVASVEELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|332376228|gb|AEE63254.1| unknown [Dendroctonus ponderosae]
          Length = 253

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 118/246 (47%), Positives = 166/246 (67%), Gaps = 4/246 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  K+R+K D SG+ T+  K SMNPFDEIA+EE+++L+EK IA+E+I V
Sbjct: 3   RVLVGVKRVIDYAVKIRVKPDKSGVVTDGVKHSMNPFDEIAVEEAVKLKEKKIASEIIAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIESN----ETLEPLSIAKILREIVKKENPIIVIAGK 117
           S G  + +EVL+ +LAMG D+GI +E      ETL+P+ ++KIL +I + E   IVI GK
Sbjct: 63  SCGPAQSQEVLRTALAMGVDKGIHVEVTGPEYETLQPIHVSKILAKIAQNEKIDIVIVGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D++ NQT QM A ++ W QATF S ++  DN   VTREV  G   +++ LPAVI+ D
Sbjct: 123 QAIDDDCNQTAQMTAGVLDWSQATFASKVEKGDNEITVTREVDGGLEVIKSKLPAVISAD 182

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LNEPRY +LPNI+KA+KK I+K    D  +D+TPR+KV+  E+    + G  +     
Sbjct: 183 LRLNEPRYATLPNIMKAKKKPIQKLTPKDLGVDVTPRIKVVSVEDPPTRQAGQIVPDVDT 242

Query: 238 LIEILK 243
           LI  LK
Sbjct: 243 LIGKLK 248


>gi|127513512|ref|YP_001094709.1| electron transfer flavoprotein beta-subunit [Shewanella loihica
           PV-4]
 gi|126638807|gb|ABO24450.1| electron transfer flavoprotein beta-subunit [Shewanella loihica
           PV-4]
          Length = 249

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 167/245 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++ N KVR+  D + ++T N K+++NPF EIA+EE+++L+E GIATE++V
Sbjct: 1   MKVLVPVKRVVDANVKVRVNADNTNVDTANLKMAINPFCEIAVEEAVRLKEAGIATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            +IG    +E L+ ++A+GADRGI +E++E L PLSIAKIL  I   E   +++ GKQ+ 
Sbjct: 61  ATIGPKASQEQLRTAMALGADRGIHVETDEELAPLSIAKILNAIQANEQAQLIMLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAAL   PQATF S +K+     +VTRE+  G  T++ PLPA++T DL L
Sbjct: 121 DGDNNQTGQMLAALAGLPQATFASEVKVEGEQLVVTREIDGGLQTLKMPLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  LPNI+KA++K ++        + L    KVL+       + G+ + S  +L+E
Sbjct: 181 NEPRYAKLPNIMKAKRKPLDTVTVDSLGVTLKQHQKVLKVTPPAERQAGIMVASVEELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|91224793|ref|ZP_01260053.1| electron transfer flavoprotein, beta-subunit [Vibrio alginolyticus
           12G01]
 gi|91190339|gb|EAS76608.1| electron transfer flavoprotein, beta-subunit [Vibrio alginolyticus
           12G01]
          Length = 250

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 171/245 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVPIK VI+   KVR+K D+S +ET N K+++NPF EIA+EE+++L+E+GIA EVIV
Sbjct: 1   MKILVPIKRVIDPYVKVRVKADHSDVETNNVKMTINPFCEIAVEEAVRLKEQGIADEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR I I++ + +EPL +AK+L+ +V++E   +VI GKQ+ 
Sbjct: 61  VSAGGSQCQEQLRTALALGADRAIHIDTEDKIEPLVVAKLLKALVEQEQAQLVITGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQ  QMLAAL+ WPQATF S++KI D    V REV  G MT+   LPAVI+ DL L
Sbjct: 121 DTDNNQVAQMLAALLDWPQATFASDVKIEDQKVQVVREVDGGLMTVAMNLPAVISTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+ SLPNI+KA++K ++        +++     +         + G+++ S ++L++
Sbjct: 181 NEPRFASLPNIMKAKRKPLDTITPDSLGVEVVFSQTIQEITPPAQRKGGIKVESVSELLD 240

Query: 241 ILKSK 245
            L+++
Sbjct: 241 KLRNE 245


>gi|89092385|ref|ZP_01165339.1| electron transfer flavoprotein, beta subunit [Oceanospirillum sp.
           MED92]
 gi|89083473|gb|EAR62691.1| electron transfer flavoprotein, beta subunit [Oceanospirillum sp.
           MED92]
          Length = 249

 Score =  229 bits (584), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 173/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+YN KVR+K+D + ++  N K+++NPF EIA+EE+++L+E G A+EV+V
Sbjct: 1   MKVLVTVKRVIDYNVKVRVKSDNTDVDLANVKMALNPFCEIAVEEAVRLKEAGTASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E ++ +LA+GADRGI IE+ +  E L++AK+L +++ +E P +VI GKQ  
Sbjct: 61  VSIGPKTCQEQIRTALALGADRGIQIETEDMPESLNVAKLLAKVIDEEQPGLVIMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL   PQ TF S +KI  +   VTREV  G  T+   +PA++T DL L
Sbjct: 121 DSDNNQTGQMLAALTDMPQGTFASEVKIDGDKVNVTREVDGGLQTVALNMPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K ++ K   D  ++L    K+L+       + G+ + S  +L++
Sbjct: 181 NEPRYASLPNIMKAKRKPLDVKTPADLGVELKAHTKLLKVTPPAERQAGIMVASVDELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAKVL 249


>gi|237803479|ref|ZP_04591064.1| electron transfer flavoprotein subunit beta [Pseudomonas syringae
           pv. oryzae str. 1_6]
 gi|331025461|gb|EGI05517.1| electron transfer flavoprotein subunit beta [Pseudomonas syringae
           pv. oryzae str. 1_6]
          Length = 249

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K D SG++  N K+SMNPF EIA+EE+++L+EKG+ TE++V
Sbjct: 1   MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVVTEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    +E L+ +LA+GADR +L+ES E L  L++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VTIGPTTAQEQLRTALALGADRAVLVESAEELTSLAVAKLLKAVVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL  +PQ TF S +++  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DSDNNQTGQMLAALSGYPQGTFASKVEVTGDKVAVTREIDGGLQTVSLSLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E        +      K L+ E   A   G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEVLTPDALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|50426509|ref|XP_461851.1| DEHA2G06974p [Debaryomyces hansenii CBS767]
 gi|49657521|emb|CAG90312.1| DEHA2G06974p [Debaryomyces hansenii]
          Length = 255

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 118/246 (47%), Positives = 173/246 (70%), Gaps = 3/246 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLRE--KGIATEV 58
           +KILVP+K VI++  K RI    +G+ET+  K S+NPF +IALEES+++RE  KG+  ++
Sbjct: 5   LKILVPVKRVIDFAIKPRINKAQTGVETKGVKFSINPFCDIALEESIRIREAHKGLVEKI 64

Query: 59  IVVSIGSCKVEEVLKNSLAMGADRGILIE-SNETLEPLSIAKILREIVKKENPIIVIAGK 117
             VSIG  K +++L+ +LA GAD   LI+  +E +EPL++AK+L++ V+KE+  +VI GK
Sbjct: 65  HAVSIGPTKAQDILRTALAKGADSTTLIDVGDEEVEPLTVAKLLQKTVEKEDSNLVILGK 124

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D++SNQTGQMLA L+ WPQAT  S ++I  ++  VTRE+  G+ T+   LP ++T D
Sbjct: 125 QAIDDDSNQTGQMLAGLLNWPQATNASKVEIDGDNITVTREIDGGSDTLRAKLPMIVTTD 184

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LNEPRY SLPNI+KA+KK +EK K +D  I+L+ RL+ L+ EE      G+++ S  +
Sbjct: 185 LRLNEPRYASLPNIMKAKKKPLEKLKVSDLGIELSKRLETLKVEEPPQREAGVKVESVDE 244

Query: 238 LIEILK 243
           LI  LK
Sbjct: 245 LISKLK 250


>gi|254514386|ref|ZP_05126447.1| electron transfer flavoprotein, beta subunit [gamma proteobacterium
           NOR5-3]
 gi|219676629|gb|EED32994.1| electron transfer flavoprotein, beta subunit [gamma proteobacterium
           NOR5-3]
          Length = 249

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 114/249 (45%), Positives = 169/249 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR K D S ++  N K+S+NPF EIA+EE+++L+E G ATEVI 
Sbjct: 1   MKVLVAVKRVVDYNVKVRAKADGSDVDLNNVKMSINPFCEIAVEEAVRLKEAGTATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G    +E ++ +LA+GADRGI +E   + EP+ +AK+L+ IV KE+P ++I GKQ+ 
Sbjct: 61  VSVGEKSCQEQIRTALALGADRGIQVEVEGSPEPIVVAKLLKGIVDKESPDLIILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQML AL   PQ TF S IK+ D    V REV  G  T+   LPA++T DL L
Sbjct: 121 DGDNNQTGQMLGALAGMPQGTFASEIKVEDGKLTVIREVDGGMQTVSLNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK+++     +  + +T  L V++ E       G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKQLDVFTPEELGVAVTSHLTVVKVEPPPERSAGIKVESVEQLVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|183598018|ref|ZP_02959511.1| hypothetical protein PROSTU_01373 [Providencia stuartii ATCC 25827]
 gi|188022796|gb|EDU60836.1| hypothetical protein PROSTU_01373 [Providencia stuartii ATCC 25827]
          Length = 251

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 122/251 (48%), Positives = 174/251 (69%), Gaps = 7/251 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI++N KVR+K D SG+E  N K+++NPFDEIA+EE+++L+E G A EV+V
Sbjct: 1   MKILVAVKRVIDHNIKVRVKADGSGVELTNVKMAINPFDEIAVEEAVRLKEAGKADEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE--SNETLEPLSIAKILREIVKKENPIIVIAGKQ 118
           VSIG    +E L++++AMGADR IL++  S+  LEPL IA++L+++V  E P +++ GKQ
Sbjct: 61  VSIGDAHSQETLRSAMAMGADRAILVQKPSDLVLEPLDIARLLQQVVVSEQPDLILLGKQ 120

Query: 119 TTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDL 178
             DN+ NQTGQMLAAL++  QATF S I+I      VTRE+  G  T+   LPAV+T DL
Sbjct: 121 AIDNDCNQTGQMLAALLKCGQATFASLIEIDGTSLQVTREIDGGLETLTLALPAVVTTDL 180

Query: 179 NLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTP--RLKVLRFEENRAERKGLRLYSTT 236
            LNEPRY +LPNI+KA+KK +E +  +  A+D TP  ++K L   E +       L++  
Sbjct: 181 RLNEPRYATLPNIMKAKKKPLEVRDIS--ALDFTPLGQVKTLMVTEPKKRTGQCTLFNDV 238

Query: 237 K-LIEILKSKH 246
           K L+  L++K 
Sbjct: 239 KALVSELQAKE 249


>gi|269966717|ref|ZP_06180795.1| electron transfer flavoprotein, beta-subunit [Vibrio alginolyticus
           40B]
 gi|269828708|gb|EEZ82964.1| electron transfer flavoprotein, beta-subunit [Vibrio alginolyticus
           40B]
          Length = 250

 Score =  229 bits (583), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 171/245 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVPIK VI+   KVR+K D+S +ET N K+++NPF EIA+EE+++L+E+GIA EVIV
Sbjct: 1   MKILVPIKRVIDPYVKVRVKADHSDVETNNVKMTINPFCEIAVEEAVRLKEQGIADEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR I +++ + +EPL +AK+L+ +V++E   +VI GKQ+ 
Sbjct: 61  VSAGGSQCQEQLRTALALGADRAIHVDTEDKIEPLVVAKLLKALVEQEQAQLVITGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQ  QMLAAL+ WPQATF S++KI D    V REV  G MT+   LPAVI+ DL L
Sbjct: 121 DTDNNQVAQMLAALLDWPQATFASDVKIEDQKVQVVREVDGGLMTVAMNLPAVISTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+ SLPNI+KA++K ++        +++     +         + G+++ S ++L++
Sbjct: 181 NEPRFASLPNIMKAKRKPLDTITPDSLGVEVVFSQTIQEVTPPAQRKGGIKVESVSELLD 240

Query: 241 ILKSK 245
            L+++
Sbjct: 241 KLRNE 245


>gi|171769901|sp|A2XQV4|ETFB_ORYSI RecName: Full=Electron transfer flavoprotein subunit beta,
           mitochondrial; Short=Beta-ETF; Flags: Precursor
 gi|125547392|gb|EAY93214.1| hypothetical protein OsI_15020 [Oryza sativa Indica Group]
          Length = 253

 Score =  228 bits (582), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 117/253 (46%), Positives = 168/253 (66%), Gaps = 4/253 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++Y  KVR++ D +G+ET + K+SMNPF EIA+EE+L+LRE G ATEV+ 
Sbjct: 1   MKILVAVKRVVDYAVKVRVRPDRTGVETASVKMSMNPFCEIAVEEALRLREAGAATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
            ++G  +  + L+ +LAMGADR + +    + +  L PL++AKILR +  +ENP +VI G
Sbjct: 61  ATVGPSQSADTLRTALAMGADRAVHVLHDPDPSRPLLPLAVAKILRALALQENPGLVILG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQMLA L+ WPQ TF S + +    A V REV  G  T+   LPAVIT 
Sbjct: 121 KQAIDDDCNQTGQMLAGLLNWPQGTFASKVILNKEKATVEREVDGGIETISLDLPAVITT 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LN+PRY +LPNI+KA+ K I+K    D  +D+   ++V+   E    + G+ L S  
Sbjct: 181 DLRLNQPRYATLPNIMKAKSKVIKKVTPEDLDVDIRSDMEVVEVTEPPKRKAGVILSSVD 240

Query: 237 KLIEILKSKHDLL 249
           +LI+ LK++  +L
Sbjct: 241 ELIDRLKNEARVL 253


>gi|149191200|ref|ZP_01869457.1| putative electron transfer flavoprotein,beta subunit [Vibrio
           shilonii AK1]
 gi|148834949|gb|EDL51929.1| putative electron transfer flavoprotein,beta subunit [Vibrio
           shilonii AK1]
          Length = 249

 Score =  228 bits (582), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 114/249 (45%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++   KVR+  D SG+ET N K+SMNPF EIA+EE+++L+E G   EVIV
Sbjct: 1   MKVLVAVKRVVDPYVKVRVLKDGSGVETANVKMSMNPFCEIAVEEAIRLKESGSVDEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG   V+E L+N+LA+GADR I IE+  + EPL++AKIL+ +V++E P +V+ GKQ+ 
Sbjct: 61  VSIGDKTVQETLRNALALGADRAIHIEAAASPEPLAVAKILKAMVEQEQPTLVLLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQ  QMLAAL   PQ TF S +K+   H  VTRE+  G  T++  LPA+I+ DL L
Sbjct: 121 DTDNNQVAQMLAALTSRPQGTFASQVKLSGEHVEVTREIDGGLETLKLTLPAIISTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K ++        ++++P+ +V+     +A   G+++ +  +LI+
Sbjct: 181 NEPRYASLPNIMKAKRKPLDVIDVDSLGVNVSPKHQVIEVLAPKARPAGVQVTNVDELID 240

Query: 241 ILKSKHDLL 249
            L ++  +L
Sbjct: 241 KLTNEAKVL 249


>gi|115457166|ref|NP_001052183.1| Os04g0182800 [Oryza sativa Japonica Group]
 gi|75228720|sp|Q7F9U3|ETFB_ORYSJ RecName: Full=Electron transfer flavoprotein subunit beta,
           mitochondrial; Short=Beta-ETF; Flags: Precursor
 gi|38346898|emb|CAE04393.2| OSJNBb0006L01.5 [Oryza sativa Japonica Group]
 gi|113563754|dbj|BAF14097.1| Os04g0182800 [Oryza sativa Japonica Group]
 gi|125589565|gb|EAZ29915.1| hypothetical protein OsJ_13968 [Oryza sativa Japonica Group]
 gi|215693174|dbj|BAG88556.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 253

 Score =  228 bits (582), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 116/253 (45%), Positives = 168/253 (66%), Gaps = 4/253 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++Y  KVR++ D +G+ET + K+SMNPF EIA+EE+L+LRE G ATEV+ 
Sbjct: 1   MKILVAVKRVVDYAVKVRVRPDRTGVETASVKMSMNPFCEIAVEEALRLRESGAATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
            ++G  +  + L+ +LAMGADR + +    + +  L PL++AKILR +  +ENP +VI G
Sbjct: 61  ATVGPSQSADTLRTALAMGADRAVHVLHDPDPSRPLLPLAVAKILRALALQENPGLVILG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQMLA L+ WPQ TF S + +    A V REV  G  T+   LPAVIT 
Sbjct: 121 KQAIDDDCNQTGQMLAGLLNWPQGTFASKVILNKEKATVEREVDGGIETISLDLPAVITT 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LN+PRY +LPNI+KA+ K I+K    D  +D+   ++V+   E    + G+ L S  
Sbjct: 181 DLRLNQPRYATLPNIMKAKSKVIKKVTPEDLDVDIRSDMEVVEVTEPPKRKAGVILSSVD 240

Query: 237 KLIEILKSKHDLL 249
           +L++ LK++  +L
Sbjct: 241 ELVDRLKNEARVL 253


>gi|307111539|gb|EFN59773.1| hypothetical protein CHLNCDRAFT_33597 [Chlorella variabilis]
          Length = 253

 Score =  228 bits (582), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 175/247 (70%), Gaps = 4/247 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K V++Y  +VR+K D SG++  N K+SMNPF EIA+EE+ +L+E  +A EV+VV
Sbjct: 4   RVLVAVKRVLDYQARVRVKPDKSGVDLTNVKMSMNPFCEIAVEEATRLKEAKLAEEVVVV 63

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTD 121
           SIG  +  E L+ ++AMGADR + ++++E ++PL++AK+L  + ++E P +V+ GKQ  D
Sbjct: 64  SIGPKQAAETLRTAMAMGADRAVHVQTDEEVQPLAVAKLLAAVARQEQPGLVLLGKQAID 123

Query: 122 NESNQTGQMLAALMRWPQATFVSNIKIID---NHAIVTREVGHGTMTMETPLPAVITVDL 178
           ++SNQTGQML+AL+ WPQATF S + ++D     A VTREV  G  T+   LPAV+T DL
Sbjct: 124 DDSNQTGQMLSALLGWPQATFASKL-VLDASAGKATVTREVDGGLETLRVSLPAVVTADL 182

Query: 179 NLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKL 238
            LNEPRY +LPNI+KA+KK +      +  +D++PRL+ LR EE    + G+ L S  +L
Sbjct: 183 RLNEPRYATLPNIMKAKKKPLATTSPQELGVDVSPRLQTLRVEEPAKRKGGVILGSAAEL 242

Query: 239 IEILKSK 245
           ++ L+++
Sbjct: 243 VDKLRNE 249


>gi|88859195|ref|ZP_01133835.1| Electron transfer flavoprotein beta-subunit [Pseudoalteromonas
           tunicata D2]
 gi|88818212|gb|EAR28027.1| Electron transfer flavoprotein beta-subunit [Pseudoalteromonas
           tunicata D2]
          Length = 238

 Score =  228 bits (581), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 114/233 (48%), Positives = 162/233 (69%)

Query: 13  YNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVL 72
           YN K R+K D +GI+  N K++MNPF EIA+EE+++++E G ATEV+VVSIG     E L
Sbjct: 1   YNVKARVKADKTGIDLANVKMAMNPFCEIAVEEAIRIKEAGKATEVVVVSIGDKACHEQL 60

Query: 73  KNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLA 132
           + +LA+GADR I IE+   LE L IAK+L ++V++E P +VI GKQ+ D+++NQTGQMLA
Sbjct: 61  RTALALGADRAIHIETALNLESLHIAKLLAKLVEQEAPELVILGKQSIDSDNNQTGQMLA 120

Query: 133 ALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNII 192
           AL + PQ TF S + +      VTREV  G  T+E  LPA++T DL LNEPRY SLPNI+
Sbjct: 121 ALTKRPQGTFASVVAVDSGKLQVTREVDGGLQTVELSLPAIVTTDLRLNEPRYASLPNIM 180

Query: 193 KARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIEILKSK 245
           KA++K ++   A  F +DL+PR++VL  EE      G+ +    +L+E L+++
Sbjct: 181 KAKRKPLDVVDAQSFGVDLSPRVEVLLVEEPAQRASGVIVSDVAQLVEKLRNE 233


>gi|28198135|ref|NP_778449.1| electron transfer flavoprotein beta subunit [Xylella fastidiosa
           Temecula1]
 gi|71276348|ref|ZP_00652625.1| Electron transfer flavoprotein beta-subunit [Xylella fastidiosa
           Dixon]
 gi|71901362|ref|ZP_00683456.1| Electron transfer flavoprotein beta-subunit [Xylella fastidiosa
           Ann-1]
 gi|170729447|ref|YP_001774880.1| electron transfer flavoprotein beta subunit [Xylella fastidiosa
           M12]
 gi|182680765|ref|YP_001828925.1| electron transfer flavoprotein alpha/beta-subunit [Xylella
           fastidiosa M23]
 gi|28056195|gb|AAO28098.1| electron transfer flavoprotein beta subunit [Xylella fastidiosa
           Temecula1]
 gi|71162810|gb|EAO12535.1| Electron transfer flavoprotein beta-subunit [Xylella fastidiosa
           Dixon]
 gi|71728861|gb|EAO30998.1| Electron transfer flavoprotein beta-subunit [Xylella fastidiosa
           Ann-1]
 gi|167964240|gb|ACA11250.1| electron transfer flavoprotein beta subunit [Xylella fastidiosa
           M12]
 gi|182630875|gb|ACB91651.1| Electron transfer flavoprotein alpha/beta-subunit [Xylella
           fastidiosa M23]
          Length = 249

 Score =  228 bits (581), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 114/248 (45%), Positives = 166/248 (66%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ TE  K+S NPFDEIALEE+L+LR+ GIA+EV++
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVMTEGVKVSANPFDEIALEEALRLRDAGIASEVVI 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            ++    V   L+N LAMGA+R I I ++ T++PL+ A+ L ++V+KE+P +VI GKQ  
Sbjct: 61  ATLAPNDVTAHLRNGLAMGANRAIHIVTHTTVQPLTAARALLKLVEKEHPALVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF S + I D  A VTREV  G  T+   LPAVIT DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFASKVTIADGKATVTREVDAGLETLHIDLPAVITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PR+I LP+I+KA+ K +E     D  +     L+   +   +   +G+ + + T+L+ 
Sbjct: 181 NAPRFIKLPDIMKAKSKPLETIAFADLGVTAHDSLQTTHYAPPKKRNQGVMVKNVTELVT 240

Query: 241 ILKSKHDL 248
           +LK++  L
Sbjct: 241 LLKNQGAL 248


>gi|255588107|ref|XP_002534503.1| electron transfer flavoprotein beta-subunit, putative [Ricinus
           communis]
 gi|223525165|gb|EEF27883.1| electron transfer flavoprotein beta-subunit, putative [Ricinus
           communis]
          Length = 250

 Score =  228 bits (581), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 109/249 (43%), Positives = 169/249 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV IK V++YN +VR+K D S ++ +  K+ +NPFDE A+EE+++L+EKGI TE++ 
Sbjct: 1   MKALVAIKRVVDYNIQVRVKADGSNVDIDGVKMGVNPFDENAIEEAIRLKEKGIVTEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    +++L+++LAMGADR +LIE+++TL  L +AK+L+ +V++E P +++ GKQ  
Sbjct: 61  VTIGGAANQDILRHALAMGADRAMLIETSDTLHSLGVAKVLKAVVEREQPQLILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++ QTGQMLAAL++ PQAT+ S I I  N A V RE+  GT T+   LPAVIT DL L
Sbjct: 121 DDDAGQTGQMLAALLKLPQATYASQITIEGNQATVVREIDGGTETLAVSLPAVITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY+ LPN++ ARKK +E        + LT  ++ L+         G+ +    +L+ 
Sbjct: 181 NEPRYVKLPNLMMARKKPLENVPLDALNVSLTHNVQQLKVAAPPERPAGIMVKDVNELLS 240

Query: 241 ILKSKHDLL 249
            L++   ++
Sbjct: 241 KLRAHEGII 249


>gi|121998277|ref|YP_001003064.1| electron transfer flavoprotein beta-subunit [Halorhodospira
           halophila SL1]
 gi|121589682|gb|ABM62262.1| electron transfer flavoprotein beta-subunit [Halorhodospira
           halophila SL1]
          Length = 249

 Score =  228 bits (581), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 111/244 (45%), Positives = 164/244 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K VI+   +VR++ D SG++  + K++MNPFDE A+EE+++L+E G A+EV+ 
Sbjct: 1   MKILVTAKRVIDSTVRVRVRPDGSGVDKAHAKMAMNPFDETAVEEAVRLKEAGKASEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V++G    EEVL+ +LA G DR + +ES+E LEPL+++K L  +V++E P +V+ GKQ  
Sbjct: 61  VTLGDAGSEEVLRTALAFGVDRALRVESDEPLEPLAVSKALAALVEREQPDLVLMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQ GQMLA  + W QATF   + +      VTREV  G  T+   LPAV+T +L+L
Sbjct: 121 DDDSNQVGQMLAQHLGWGQATFACALAVGGEELQVTREVDGGRHTVAVRLPAVVTTELDL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N+PRYI LPNI+KA+KK I++    D  +D  PRL++L   E      G R+ S  +L++
Sbjct: 181 NQPRYIKLPNIMKAKKKPIDRVPLADLGVDGAPRLELLGVSEPPPRAAGERVESVAELVD 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 RLKN 244


>gi|302783701|ref|XP_002973623.1| hypothetical protein SELMODRAFT_232153 [Selaginella moellendorffii]
 gi|300158661|gb|EFJ25283.1| hypothetical protein SELMODRAFT_232153 [Selaginella moellendorffii]
          Length = 253

 Score =  228 bits (581), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 114/249 (45%), Positives = 171/249 (68%), Gaps = 4/249 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK++V +K V++Y  KVRIK D SG+ET NTK+SMNPF EIA+EE+L+++E G A+EV+V
Sbjct: 1   MKVMVAVKRVVDYAVKVRIKADKSGVETSNTKMSMNPFCEIAVEEALRIKEAGRASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRG--ILIESNETLEPLSIAKILREIVKKENPIIVIAGKQ 118
           VS+G  +  E ++  LAMGADRG  ++ + + +L PL++AK+L+ +V  E P +++ GKQ
Sbjct: 61  VSMGGEQCVETIRTGLAMGADRGLHVITQDSSSLFPLAVAKLLQALVSSEQPRLLLLGKQ 120

Query: 119 TTDNESNQTGQMLAALMRWPQATFVSNIKIIDN--HAIVTREVGHGTMTMETPLPAVITV 176
             D++ NQTGQM+A L+ WPQATF S + I D+     V REV  G  T++  LPAV+T 
Sbjct: 121 AIDDDCNQTGQMVAGLLGWPQATFASKVSISDDKESVCVEREVDGGIETIQLQLPAVVTA 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LN PRY +LPNI+KA+KK I++    +  + +   L+VL   E    + G+ + S  
Sbjct: 181 DLRLNTPRYATLPNIMKAKKKSIQRVTPEELNVVIGSDLEVLEVTEPPKRKAGVMVASVD 240

Query: 237 KLIEILKSK 245
           +L++ LK++
Sbjct: 241 ELLDKLKNE 249


>gi|328470912|gb|EGF41823.1| electron transfer flavoprotein subunit beta [Vibrio
           parahaemolyticus 10329]
          Length = 250

 Score =  228 bits (580), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 114/249 (45%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVPIK VI+   KVR+K D S +ET N K+++NPF EIA+EE+++L+E+GIA EVIV
Sbjct: 1   MKILVPIKRVIDPYIKVRVKPDNSDVETNNVKMTINPFCEIAVEEAVRLKEQGIAEEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR I I++ + +EPL ++K+L+ IV++E   +VI GKQ+ 
Sbjct: 61  VSAGGAQCQEQLRTALALGADRAIHIDTADKIEPLVVSKLLKAIVEQEQAQLVITGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQ  QMLAAL+ WPQATF S++KI D    V REV  G MT+   LPAVI+ DL L
Sbjct: 121 DTDNNQVAQMLAALLDWPQATFASDVKIEDQKVQVVREVDGGLMTVAMNLPAVISTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+ SLPNI+KA++K +E        +++     +         + G+++ S ++L++
Sbjct: 181 NEPRFASLPNIMKAKRKPLETITPESLGVEVVFSQTIAEVTPPAQRKAGIKVESVSELLD 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|221134564|ref|ZP_03560869.1| electron transfer flavoprotein, beta subunit [Glaciecola sp.
           HTCC2999]
          Length = 250

 Score =  228 bits (580), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 165/245 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K  I+YN KV++K D S ++  N K+S+NPF EIA+EE+++L+E G ATE++V
Sbjct: 1   MKILVPVKRAIDYNVKVKVKADESNVDLANVKMSINPFCEIAVEEAVRLKEAGSATEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+    E ++ +LA+GADRGI I ++  L+ L IAK+L+ +V +E P +VI GKQ  
Sbjct: 61  VSIGTVACVEQVRTALALGADRGIHINTDADLDSLQIAKLLKTVVDEETPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL    Q TF S + + D    VTRE+  G  T+   LPAV+T DL L
Sbjct: 121 DSDNNQTGQMLAALSGMGQGTFASEVAVADGKIAVTREIDGGLQTVSLSLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K +   +A    ++L   + +L+         G+++    +L+E
Sbjct: 181 NEPRYASLPNIMKAKRKPVATIEADSLGVNLKSNVSLLKVTAPSQRNGGIKVADVAELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKTE 245


>gi|302787747|ref|XP_002975643.1| hypothetical protein SELMODRAFT_232605 [Selaginella moellendorffii]
 gi|300156644|gb|EFJ23272.1| hypothetical protein SELMODRAFT_232605 [Selaginella moellendorffii]
          Length = 253

 Score =  228 bits (580), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 171/249 (68%), Gaps = 4/249 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK++V +K V++Y  KVRIK D SG+ET NTK+SMNPF EIA+EE+L+++E G A+EV+V
Sbjct: 1   MKVMVAVKRVVDYAVKVRIKADKSGVETSNTKMSMNPFCEIAVEEALRIKEAGRASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRG--ILIESNETLEPLSIAKILREIVKKENPIIVIAGKQ 118
           VS+G  +  E ++  LAMGADRG  ++ + + +L PL++AK+L+ +V  E P +++ GKQ
Sbjct: 61  VSMGGEQCVETIRTGLAMGADRGLHVITQDSSSLFPLAVAKLLQALVSSEQPRLLLLGKQ 120

Query: 119 TTDNESNQTGQMLAALMRWPQATFVSNIKIIDN--HAIVTREVGHGTMTMETPLPAVITV 176
             D++ NQTGQM+A L+ WPQATF S + + D+     V REV  G  T++  LPAV+T 
Sbjct: 121 AIDDDCNQTGQMVAGLLGWPQATFASKVSVSDDKESVCVEREVDGGIETIQLQLPAVVTA 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LN PRY +LPNI+KA+KK I++    +  + +   L+VL   E    + G+ + S  
Sbjct: 181 DLRLNTPRYATLPNIMKAKKKSIQRVTPEELNVVIGSDLEVLEVTEPPKRKAGVMVASVD 240

Query: 237 KLIEILKSK 245
           +L++ LK++
Sbjct: 241 ELLDKLKNE 249


>gi|254227659|ref|ZP_04921090.1| electron transfer flavoprotein, beta-subunit [Vibrio sp. Ex25]
 gi|262395707|ref|YP_003287560.1| electron transfer flavoprotein beta subunit [Vibrio sp. Ex25]
 gi|151939701|gb|EDN58528.1| electron transfer flavoprotein, beta-subunit [Vibrio sp. Ex25]
 gi|262339301|gb|ACY53095.1| electron transfer flavoprotein beta subunit [Vibrio sp. Ex25]
          Length = 250

 Score =  228 bits (580), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 171/245 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVPIK VI+   KVR+K D+S +ET N K+++NPF EIA+EE+++L+E+GIA EVIV
Sbjct: 1   MKILVPIKRVIDPYVKVRVKADHSDVETNNVKMTINPFCEIAVEEAVRLKEQGIADEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR I +++ + +EPL +AK+L+ +V++E   +VI GKQ+ 
Sbjct: 61  VSAGGSQCQEQLRTALALGADRAIHVDTEDKIEPLVVAKLLKALVEQEQAQLVITGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQ  QMLAAL+ WPQATF S++KI D    V REV  G MT+   LPAV++ DL L
Sbjct: 121 DTDNNQVAQMLAALLDWPQATFASDVKIEDQKVQVVREVDGGLMTVAMNLPAVVSTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+ SLPNI+KA++K ++        +++     +         + G+++ S ++L++
Sbjct: 181 NEPRFASLPNIMKAKRKPLDTITPDTLGVEVVFSQTIQEVTPPAQRKGGIKVESVSELLD 240

Query: 241 ILKSK 245
            L+++
Sbjct: 241 KLRNE 245


>gi|52841157|ref|YP_094956.1| electron transfer flavoprotein, beta subunit [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|54293897|ref|YP_126312.1| electron transfer flavoprotein subunit beta [Legionella pneumophila
           str. Lens]
 gi|52628268|gb|AAU27009.1| electron transfer flavoprotein, beta subunit [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|53753729|emb|CAH15187.1| Electron transfer flavoprotein beta-subunit (Beta-ETF) [Legionella
           pneumophila str. Lens]
          Length = 249

 Score =  228 bits (580), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 170/249 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+   K+R+K+D SG+ET+N K++MNPFDEIA+EE+L+LREK  ATEVI 
Sbjct: 1   MKILVAVKRVIDPYVKIRVKSDNSGVETQNIKMAMNPFDEIAIEEALRLREKNWATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIGS   +E L+++LA+GAD+ IL+ + ++ E L+IAKIL  IV  E P +V+ GKQ+ 
Sbjct: 61  VSIGSDSSQETLRHALALGADKAILVRTEKSFESLNIAKILNSIVANEKPDLVLMGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQT QMLAAL+ WPQAT  S I   +N+  V RE+  G  T++  LPAVI+ DL L
Sbjct: 121 DGDNNQTPQMLAALLNWPQATNASKIIPDNNNLEVVREIDGGLETLKVQLPAVISTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K ++        + L   +++L+         G+ L S   L++
Sbjct: 181 NEPRYASLPNIMKAKRKPLDIIDLDSLGLSLKQHVEILKVNAPATRSAGVILDSVAALLD 240

Query: 241 ILKSKHDLL 249
            L+ +  +L
Sbjct: 241 KLQHEAKVL 249


>gi|328865982|gb|EGG14368.1| electron transfer flavoprotein beta subunit [Dictyostelium
           fasciculatum]
          Length = 252

 Score =  228 bits (580), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 116/252 (46%), Positives = 172/252 (68%), Gaps = 5/252 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
            KILVP+K VI+Y  K+R++ D  G+ET N K+S+NPFDEIA+EE+++L+E  IA  V+ 
Sbjct: 3   FKILVPVKRVIDYAAKIRVRPDKLGVETNNVKMSINPFDEIAVEEAVRLKENTIADSVVA 62

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  +  E ++ SLAMGAD GI + ++  ++PL IAKIL+++V++E P +VI GKQ  
Sbjct: 63  VSIGPKESLETIRGSLAMGADAGIHVSASADMQPLGIAKILKKLVEQEKPKLVILGKQAI 122

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIID---NHAIVTREVGHGTMTMETPLPAVITVD 177
           D++SNQT QMLA L+ WPQATF S + ++D   +   VTRE+  G  T+E  LPA+I+ D
Sbjct: 123 DDDSNQTAQMLAGLLNWPQATFASKV-VVDKASDKVTVTREIDGGLETLEMKLPAIISCD 181

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LNEPRY  L NI+KA+K  +  K   +  +D++ +LK++  EE      G ++ S  +
Sbjct: 182 LRLNEPRYAKLQNIMKAKKIVVPTKTPEELGVDVSSKLKIVSVEEPAKRVGGSKVQSVDE 241

Query: 238 LIEILKSKHDLL 249
           ++  LK KH ++
Sbjct: 242 VVANLK-KHAII 252


>gi|254480463|ref|ZP_05093710.1| electron transfer flavoprotein domain protein [marine gamma
           proteobacterium HTCC2148]
 gi|214039046|gb|EEB79706.1| electron transfer flavoprotein domain protein [marine gamma
           proteobacterium HTCC2148]
          Length = 250

 Score =  227 bits (579), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 166/245 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR K D S ++  N K+++NPF EIA+EE+++L+E GIATEVI 
Sbjct: 1   MKVLVAVKRVVDYNVKVRAKADGSDVDLNNVKMAINPFCEIAVEEAVRLKEAGIATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G    +E ++ +LA+GADRGI +++   +EPL IAK+L+ +V KE P +VI GKQ+ 
Sbjct: 61  VSVGDKPCQEQIRTALALGADRGIQVQTEGAVEPLVIAKLLKGVVVKEEPQLVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQML AL   PQ TF S I I  +   VTREV  G  T+   LPA++T DL L
Sbjct: 121 DGDNNQTGQMLGALAGMPQGTFASEIVIDGDKMNVTREVDGGLQTLSLNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++     D  +++T  L  +  E     + G+++    +LI+
Sbjct: 181 NEPRYASLPNIMKAKKKPLDVFTPADLGVEVTSHLTQVGVEPPAERQAGIKVEDVDQLID 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|15836859|ref|NP_297547.1| electron transfer flavoprotein beta subunit [Xylella fastidiosa
           9a5c]
 gi|9105069|gb|AAF83067.1|AE003879_2 electron transfer flavoprotein beta subunit [Xylella fastidiosa
           9a5c]
          Length = 249

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 114/248 (45%), Positives = 165/248 (66%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ TE  K+S NPFDEIALEE+L+LR+ GIA+EV++
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVMTEGVKVSANPFDEIALEEALRLRDAGIASEVVI 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            ++    V   L+N LAMGA+R I I ++ T++PL+ A+ L ++V+KE P +VI GKQ  
Sbjct: 61  ATLAPNDVTAHLRNGLAMGANRAIHIVTHTTVQPLTAARALLKLVEKEQPALVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF S + I D  A VTREV  G  T+   LPAVIT DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFASKVTIADGKATVTREVDAGLETLHIDLPAVITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PR+I LP+I+KA+ K +E     D  +     L+   +   +   +G+ + + T+L+ 
Sbjct: 181 NAPRFIKLPDIMKAKSKPLETIAFADLGVTAHDSLQTTHYAPPKKRNQGVMVKNVTELVT 240

Query: 241 ILKSKHDL 248
           +LK++  L
Sbjct: 241 LLKNQGAL 248


>gi|167624859|ref|YP_001675153.1| electron transfer flavoprotein subunit alpha/beta [Shewanella
           halifaxensis HAW-EB4]
 gi|167354881|gb|ABZ77494.1| Electron transfer flavoprotein alpha/beta-subunit [Shewanella
           halifaxensis HAW-EB4]
          Length = 249

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 168/245 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++ N KVR+  D +G++T N K+++NPF EIA+EE+++L+E G A+E++V
Sbjct: 1   MKVLVPVKRVVDANVKVRVNADNTGVDTANLKMAINPFCEIAVEEAVRLKEAGSASEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           +S+G    +E L+ +LA+GADR I IE++E L PLSIAK++  + +KE   +VI GKQ+ 
Sbjct: 61  LSVGPKASQEQLRTALALGADRAIHIETDEDLVPLSIAKLIHAVQQKEQAQLVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAA+ + PQATF S +K   +  +VTRE+  G  T+   LPAV+T DL L
Sbjct: 121 DGDNNQTGQMLAAIAKMPQATFASEVKFDGDKLVVTREIDGGLQTVNLSLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  LPNI+KA++K +E     DF + L     +++         G+ + S  +L+E
Sbjct: 181 NEPRYAKLPNIMKAKRKPLETFTPADFDVTLKSHQTIIKVTPPAQRSGGVMVASVEELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|168004193|ref|XP_001754796.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162693900|gb|EDQ80250.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 251

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 112/247 (45%), Positives = 167/247 (67%), Gaps = 2/247 (0%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+V +K VI+Y  K+R+K D SG+ET N K++MNPF EIALEE+L+LRE G A EV+V
Sbjct: 1   MKIMVAVKRVIDYAVKIRVKADKSGVETTNVKMAMNPFCEIALEEALRLREAGHAKEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  +  E L+  LAMGADR I + + E L PL++AK+LR + + E P +++ GKQ  
Sbjct: 61  VSMGGPQCAETLRTGLAMGADRAIHVSTTELLHPLTVAKLLRGLAESEKPNMLLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKI--IDNHAIVTREVGHGTMTMETPLPAVITVDL 178
           D+++NQTGQM+A L+ WPQ TF S + +    +  +V REV  G  +++  LPAVIT DL
Sbjct: 121 DDDANQTGQMIAGLLHWPQGTFASKVAMEKGSDSVVVEREVDGGLESLKLQLPAVITADL 180

Query: 179 NLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKL 238
            LN+PRY +LPNI+KA+KK I +       + ++  L+++   E    + G+ + S  +L
Sbjct: 181 RLNQPRYATLPNIMKAKKKPISQVTPEQLGVKISRDLEIVEVIEPPKRKAGVMVASVDEL 240

Query: 239 IEILKSK 245
           ++ LK++
Sbjct: 241 LDKLKNE 247


>gi|88703275|ref|ZP_01100991.1| Electron transfer flavoprotein, beta subunit [Congregibacter
           litoralis KT71]
 gi|88701989|gb|EAQ99092.1| Electron transfer flavoprotein, beta subunit [Congregibacter
           litoralis KT71]
          Length = 249

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 169/249 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR K D S ++  N K+S+NPF EIA+EE+++L+E G ATE++ 
Sbjct: 1   MKVLVAVKRVVDYNVKVRAKADGSDVDLNNVKMSINPFCEIAVEEAVRLKEAGTATEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E ++ +LA+GADRGI +E     EPL IAK+L+ +V+KE+P ++I GKQ+ 
Sbjct: 61  VSIGEKSCQEQIRTALALGADRGIQVEVEGNPEPLVIAKLLKGVVEKESPDLIIMGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQML AL   PQ TF S IK+  +   VTREV  G  T+   LPA++T DL L
Sbjct: 121 DGDNNQTGQMLGALAGMPQGTFASEIKVDGDKLAVTREVDGGMQTISLNLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++     +  + +T  L +++ E       G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDVLTPDELGVQVTSHLTLVKVEPPPERSAGIKVESVEQLVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|91087539|ref|XP_970257.1| PREDICTED: similar to electron-transfer-flavoprotein beta
           polypeptide [Tribolium castaneum]
 gi|270009447|gb|EFA05895.1| hypothetical protein TcasGA2_TC008707 [Tribolium castaneum]
          Length = 253

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 113/246 (45%), Positives = 167/246 (67%), Gaps = 4/246 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  K+R+K D +G+ T+  K SMNPFDEIA+EE+++++EK +A+E+I V
Sbjct: 3   RVLVGVKRVIDYAVKIRVKPDKTGVVTDGVKHSMNPFDEIAVEEAVRMKEKKLASEIIAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIESN----ETLEPLSIAKILREIVKKENPIIVIAGK 117
           S G  + ++V++ +LAMG D+GI +E +    ETL+P+ ++KIL ++ +KE   ++I GK
Sbjct: 63  SCGPTQAQDVIRTALAMGVDKGIHVEVSGAEYETLQPIHVSKILAKLTEKEKADMIIVGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D++SNQT QM AA + WPQATF S I+  D    VTREV  G  T++  LPAVI+ D
Sbjct: 123 QAIDDDSNQTAQMTAAALDWPQATFASKIENGDKEITVTREVDGGLETIKCKLPAVISAD 182

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LNEPRY +LPNI+KA+KK I K    D  +D++PR+ V+  E+    + G  L     
Sbjct: 183 LRLNEPRYATLPNIMKAKKKPITKMTPKDLGVDVSPRITVVSVEDPPVRQAGAILPDVDA 242

Query: 238 LIEILK 243
           L+  LK
Sbjct: 243 LVGKLK 248


>gi|54296943|ref|YP_123312.1| electron transfer flavoprotein subunit beta [Legionella pneumophila
           str. Paris]
 gi|53750728|emb|CAH12135.1| Electron transfer flavoprotein beta-subunit (Beta-ETF) [Legionella
           pneumophila str. Paris]
          Length = 249

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 170/249 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+   K+R+K+D SG+ET+N K++MNPFDEIA+EE+L+LREK  ATEVI 
Sbjct: 1   MKILVAVKRVIDPYVKIRVKSDNSGVETQNIKMAMNPFDEIAIEEALRLREKNWATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIGS   +E L+++LA+GAD+ IL+ + ++ E L+IAKIL  IV  E P +V+ GKQ+ 
Sbjct: 61  VSIGSDSSQETLRHALALGADKAILVRTEKSFESLNIAKILNSIVANEKPDLVLMGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQT QMLAAL+ WPQAT  S I   +N+  V RE+  G  T++  LPAVI+ DL L
Sbjct: 121 DGDNNQTPQMLAALLNWPQATNASKIIPDNNNLEVVREIDGGLETLKVQLPAVISTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K ++        + L   +++L+         G+ L S   L++
Sbjct: 181 NEPRYASLPNIMKAKRKPLDIIDLDSLGLSLKQHVEILKVNAPATRSGGVILDSVAALLD 240

Query: 241 ILKSKHDLL 249
            L+ +  +L
Sbjct: 241 KLQHEAKVL 249


>gi|148360430|ref|YP_001251637.1| electron transfer flavoprotein subunit beta [Legionella pneumophila
           str. Corby]
 gi|296106505|ref|YP_003618205.1| electron transfer flavoprotein, beta subunit [Legionella
           pneumophila 2300/99 Alcoy]
 gi|148282203|gb|ABQ56291.1| electron transfer flavoprotein, beta subunit [Legionella
           pneumophila str. Corby]
 gi|295648406|gb|ADG24253.1| electron transfer flavoprotein, beta subunit [Legionella
           pneumophila 2300/99 Alcoy]
          Length = 249

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 170/249 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+   K+R+K+D SG+ET+N K++MNPFDEIA+EE+L+LREK  ATEVI 
Sbjct: 1   MKILVAVKRVIDPYVKIRVKSDNSGVETQNIKMAMNPFDEIAVEEALRLREKNWATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIGS   +E L+++LA+GAD+ IL+ + ++ E L+IAKIL  IV  E P +V+ GKQ+ 
Sbjct: 61  VSIGSDSSQETLRHALALGADKAILVRTEKSFESLNIAKILNSIVANEKPDLVLMGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQT QMLAAL+ WPQAT  S I   +N+  V RE+  G  T++  LPAVI+ DL L
Sbjct: 121 DGDNNQTPQMLAALLNWPQATNASKIIPDNNNLEVVREIDGGLETLKVQLPAVISTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K ++        + L   +++L+         G+ L S   L++
Sbjct: 181 NEPRYASLPNIMKAKRKPLDIIDLDSLGLSLKQHVEILKVNAPATRSGGVILDSVAALLD 240

Query: 241 ILKSKHDLL 249
            L+ +  +L
Sbjct: 241 KLQHEAKVL 249


>gi|78049266|ref|YP_365441.1| electron transfer flavoprotein subunit beta [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|78037696|emb|CAJ25441.1| Electron transfer flavoprotein beta subunit [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
          Length = 248

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 158/245 (64%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ TE  K+S NPFDEIALEE+L+LR+ GIATEV+V
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVVTEGVKLSPNPFDEIALEEALRLRDAGIATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            ++        L+N LAMGA+R I + ++  ++PL+ A+ L ++V+KE P +VI GKQ  
Sbjct: 61  ATLAPTDAAAHLRNGLAMGANRAIHVVTDAAVQPLTAARALLKLVEKEQPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF   + + D  A VTREV  G  T+E  LPAVIT DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFAGKLVVADGKATVTREVDAGLETLEVDLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LP+I+KA+ K +E     D  +D    L    +       +G+ +    +L+ 
Sbjct: 181 NEPRFIKLPDIMKAKSKPLETLAFADLGVDAHDSLTTTHYAAPSKRSRGVMVKDAAELVA 240

Query: 241 ILKSK 245
            LK K
Sbjct: 241 ALKQK 245


>gi|329894931|ref|ZP_08270730.1| Electron transfer flavoprotein, beta subunit [gamma proteobacterium
           IMCC3088]
 gi|328922660|gb|EGG29995.1| Electron transfer flavoprotein, beta subunit [gamma proteobacterium
           IMCC3088]
          Length = 250

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/249 (43%), Positives = 169/249 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR K D S ++  N K+++NPF EIA+EE+++L+E G+ATEV+ 
Sbjct: 1   MKVLVAVKRVVDYNVKVRAKADGSDVDLNNVKMAINPFCEIAVEEAVRLKEAGVATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G    +E L+ +LA+GADR I +E +  +EPL +AK+L+ +V+KE P +VI GKQ+ 
Sbjct: 61  VSVGPKACQEQLRTALALGADRAIQVEVDGVVEPLVVAKLLKGVVEKEAPQLVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQML AL    Q TF S +K+  +   VTRE+  G  T++  LPA++T DL L
Sbjct: 121 DGDNNQTGQMLGALTNMAQGTFASEVKVDGDSVTVTREIDGGLQTVKLALPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++   A D  + +T  +  ++ E     + G+++     L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDVLTADDLGVAVTTHVTQVKVEPPAERQAGIKVEDVATLVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|153836661|ref|ZP_01989328.1| electron transfer flavoprotein, beta-subunit [Vibrio
           parahaemolyticus AQ3810]
 gi|149750010|gb|EDM60755.1| electron transfer flavoprotein, beta-subunit [Vibrio
           parahaemolyticus AQ3810]
          Length = 250

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVPIK VI+   KVR+K D S +ET N K+++NPF EIA+EE+++L+E+GIA EVIV
Sbjct: 1   MKILVPIKRVIDPYIKVRVKPDNSDVETNNVKMTINPFCEIAVEEAVRLKEQGIAEEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR I I++ + +EPL ++K+L+ IV++E   +VI GKQ+ 
Sbjct: 61  VSAGGTQCQEQLRTALALGADRAIHIDTADKIEPLVVSKLLKAIVEQEQAQLVITGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQ  QMLAAL+ WPQATF S++KI D    V REV  G MT+   LPAVI+ DL L
Sbjct: 121 DTDNNQVAQMLAALLDWPQATFASDVKIEDQKVQVVREVDGGLMTVAMNLPAVISTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+ SLPNI+KA++K ++        +++     +         + G+++ S ++L++
Sbjct: 181 NEPRFASLPNIMKAKRKPLDTVTPESLGVEVVFSQTITEVTPPAQRKAGIKVESVSELLD 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|270157394|ref|ZP_06186051.1| electron transfer flavoprotein subunit beta [Legionella longbeachae
           D-4968]
 gi|289164211|ref|YP_003454349.1| Electron transfer flavoprotein beta-subunit (Beta-ETF) [Legionella
           longbeachae NSW150]
 gi|269989419|gb|EEZ95673.1| electron transfer flavoprotein subunit beta [Legionella longbeachae
           D-4968]
 gi|288857384|emb|CBJ11212.1| Electron transfer flavoprotein beta-subunit (Beta-ETF) [Legionella
           longbeachae NSW150]
          Length = 249

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+   K+R+K+D +G+ET+N K++MNPFDEIA+EE+L+LREK  ATEV+ 
Sbjct: 1   MKILVAVKRVIDPYVKIRVKSDNTGVETQNIKMAMNPFDEIAVEEALRLREKNWATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+++LA+G DR IL+ + ++ E L+IAKIL++I + E P +V+ GKQ  
Sbjct: 61  VSIGGDNSQETLRHALALGVDRAILVRTQDSFESLNIAKILKKISEDEKPDLVLMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQT QMLA+L+ WPQAT+ S I+       VTRE+  G  T+   LPA+++ DL L
Sbjct: 121 DDDSNQTPQMLASLLNWPQATYASKIEPNGTSLQVTREIDGGLETLSIHLPAIVSTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++  +  +  + L    +VL+         G+++ S T+L+ 
Sbjct: 181 NEPRYASLPNIMKAKKKPLDIIELENMGLALKKHSEVLKVTAPAIRSAGVKVESVTELLN 240

Query: 241 ILKSKHDLL 249
            L+ +  +L
Sbjct: 241 KLQHEAKVL 249


>gi|307609714|emb|CBW99225.1| electron transfer flavoprotein beta-subunit [Legionella pneumophila
           130b]
          Length = 249

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 170/249 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+   K+R+K+D SG+ET+N K++MNPFDEIA+EE+L+LREK  ATEVI 
Sbjct: 1   MKILVAVKRVIDPYVKIRVKSDNSGVETQNIKMAMNPFDEIAIEEALRLREKNWATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+   +E L+++LA+GAD+ IL+ + ++ E L+IAKIL  IV  E P +V+ GKQ+ 
Sbjct: 61  VSIGADSSQETLRHALALGADKAILVRTEKSFESLNIAKILNNIVANEKPDLVLMGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQT QMLAAL+ WPQAT  S I   +N+  V RE+  G  T++  LPAVI+ DL L
Sbjct: 121 DGDNNQTPQMLAALLNWPQATNASKIIPDNNNLEVVREIDGGLETLKVQLPAVISTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K ++        + L   +++L+         G+ L S   L++
Sbjct: 181 NEPRYASLPNIMKAKRKPLDIIDLDSLGLSLKQHVEILKVNAPATRSGGVILDSVAALLD 240

Query: 241 ILKSKHDLL 249
            L+ +  +L
Sbjct: 241 KLQHEAKVL 249


>gi|28901011|ref|NP_800666.1| electron transfer flavoprotein subunit beta [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|260366221|ref|ZP_05778681.1| electron transfer flavoprotein, beta subunit [Vibrio
           parahaemolyticus K5030]
 gi|260879862|ref|ZP_05892217.1| electron transfer flavoprotein, beta subunit [Vibrio
           parahaemolyticus AN-5034]
 gi|260894537|ref|ZP_05903033.1| electron transfer flavoprotein, beta subunit [Vibrio
           parahaemolyticus Peru-466]
 gi|260903074|ref|ZP_05911469.1| electron transfer flavoprotein, beta subunit [Vibrio
           parahaemolyticus AQ4037]
 gi|28809524|dbj|BAC62499.1| electron transfer flavoprotein, beta-subunit [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|308086404|gb|EFO36099.1| electron transfer flavoprotein, beta subunit [Vibrio
           parahaemolyticus Peru-466]
 gi|308092291|gb|EFO41986.1| electron transfer flavoprotein, beta subunit [Vibrio
           parahaemolyticus AN-5034]
 gi|308108379|gb|EFO45919.1| electron transfer flavoprotein, beta subunit [Vibrio
           parahaemolyticus AQ4037]
 gi|308114880|gb|EFO52420.1| electron transfer flavoprotein, beta subunit [Vibrio
           parahaemolyticus K5030]
          Length = 250

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 172/249 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVPIK VI+   KVR+K D S +ET N K+++NPF EIA+EE+++L+E+GIA EVIV
Sbjct: 1   MKILVPIKRVIDPYIKVRVKPDNSDVETNNVKMTINPFCEIAVEEAVRLKEQGIAEEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR I IE+ + +EPL ++K+L+ IV++E   +V+ GKQ+ 
Sbjct: 61  VSAGGTQCQEQLRTALALGADRAIHIETADKIEPLVVSKLLKAIVEQEQAQLVLTGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQ  QMLAAL+ WPQATF S++KI D    V REV  G MT+   LPAVI+ DL L
Sbjct: 121 DTDNNQVAQMLAALLDWPQATFASDVKIEDRKVQVVREVDGGLMTVAMNLPAVISTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+ SLPNI+KA++K ++        +++     +         + G+++ S ++L++
Sbjct: 181 NEPRFASLPNIMKAKRKPLDTITPESLGVEVVFSQTITEVTPPAQRKAGIKVESVSELLD 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|196003858|ref|XP_002111796.1| hypothetical protein TRIADDRAFT_37485 [Trichoplax adhaerens]
 gi|190585695|gb|EDV25763.1| hypothetical protein TRIADDRAFT_37485 [Trichoplax adhaerens]
          Length = 254

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 115/248 (46%), Positives = 170/248 (68%), Gaps = 4/248 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           +++LV  K VI+Y  KVR+K D +G+ T+  K SMNPFDEIA+EE+++L+EK +A+EV+ 
Sbjct: 3   LRVLVGCKRVIDYAVKVRVKPDKTGVVTDGVKHSMNPFDEIAIEEAVRLKEKKVASEVVA 62

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNE----TLEPLSIAKILREIVKKENPIIVIAG 116
           +S G  + +E L+ +LAMGADR I +E  E    TLEPL +AKI  ++ K E+  ++I G
Sbjct: 63  ISCGPKQCQETLRTALAMGADRAIHVEVPEPESHTLEPLGVAKIFSKLAKDEDVGLIIVG 122

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQ+ AAL+ WPQATF S I +  +   V REV  G  T++  +PAV++ 
Sbjct: 123 KQAIDDDCNQTGQLTAALLDWPQATFASEITVDGDSMKVIREVDGGLETIKVNMPAVVSA 182

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+I+ K   D  +D++PR + L  E+    + G ++   +
Sbjct: 183 DLRLNEPRYATLPNIMKAKKKKIDVKTPADLGVDISPRTETLSVEDPPVRQAGSKVEDVS 242

Query: 237 KLIEILKS 244
           +L+E LKS
Sbjct: 243 ELVEKLKS 250


>gi|92113737|ref|YP_573665.1| electron transfer flavoprotein beta-subunit [Chromohalobacter
           salexigens DSM 3043]
 gi|91796827|gb|ABE58966.1| electron transfer flavoprotein beta-subunit [Chromohalobacter
           salexigens DSM 3043]
          Length = 250

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 168/245 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+YN K+R+K D+S ++  N K++MNPF EIA+EE+++L+EKG+A+EV+ 
Sbjct: 1   MKVLVAVKRVIDYNVKIRVKPDHSDVDLTNVKMAMNPFCEIAVEEAVRLKEKGVASEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG    +E L+ +LA+GADR I IE+++ +E L+ AK+L+ +V  E P + I GKQ+ 
Sbjct: 61  VTIGPKAAQEQLRTALALGADRAIHIETDDKVESLTAAKLLKRVVDDEQPGLTILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAAL    Q TF S +++  +   VTRE+  G  T+   LPAVIT DL L
Sbjct: 121 DTDNNQTGQMLAALAGMGQGTFASEVQVEGDEVRVTREIDGGLQTVSLKLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  LP+I+KA+KK I+ +      + +T  L VL+ E     + G ++ S  +L++
Sbjct: 181 NEPRYAKLPDIMKAKKKPIDVQTPDALGVAVTSSLNVLKVESPAERQGGTKVASVDELVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|71898667|ref|ZP_00680837.1| Electron transfer flavoprotein beta-subunit [Xylella fastidiosa
           Ann-1]
 gi|71731614|gb|EAO33675.1| Electron transfer flavoprotein beta-subunit [Xylella fastidiosa
           Ann-1]
          Length = 249

 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 113/248 (45%), Positives = 165/248 (66%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ TE  K+S NPFDEIALEE+L+LR+ GIA+EV++
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVMTEGVKVSANPFDEIALEEALRLRDAGIASEVVI 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            ++    V   L+N LAMGA+R I I ++ T++PL+ A+ L ++V+KE P +VI GKQ  
Sbjct: 61  ATLAPNDVTAHLRNGLAMGANRAIHIVTHTTVQPLTAARALLKLVEKEQPALVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF S + I +  A VTREV  G  T+   LPAVIT DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFASKVTIANGKATVTREVDAGLETLHIDLPAVITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PR+I LP+I+KA+ K +E     D  +     L+   +   +   +G+ + + T+L+ 
Sbjct: 181 NAPRFIKLPDIMKAKSKPLETIAFADLGVTAQDSLQTTHYAPPKKRNQGVMVKNVTELVT 240

Query: 241 ILKSKHDL 248
           +LK++  L
Sbjct: 241 LLKNQGAL 248


>gi|157374584|ref|YP_001473184.1| electron transfer flavoprotein beta-subunit [Shewanella sediminis
           HAW-EB3]
 gi|157316958|gb|ABV36056.1| electron transfer flavoprotein beta-subunit [Shewanella sediminis
           HAW-EB3]
          Length = 249

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 170/245 (69%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++ N KVR+  D +G++T N K+++NPF EIA+EE+++L+E G+A+EV+V
Sbjct: 1   MKVLVPVKRVVDANVKVRVNADNTGVDTANLKMAINPFCEIAVEEAVRLKEAGVASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V++G    +E L+ ++A+GADRG+ IE++E L PLSIAK+L  +  +E   ++I GKQ+ 
Sbjct: 61  VTVGPKAAQEQLRTAMALGADRGVHIETDEELVPLSIAKLLNAVQSREEAQLIILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAAL + PQATF S +K+      +TRE+  G  ++  PLPAV+T DL L
Sbjct: 121 DGDNNQTGQMLAALGKMPQATFASEVKVEGGQLAITREIDGGLQSITLPLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  LPNI+KA++K ++     D  + L    KVL+       + G+ L S  +L+E
Sbjct: 181 NEPRYAKLPNIMKAKRKPLDTLSIDDLGVSLKSHQKVLKVTPPAERKGGVMLASVAELVE 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|12832367|dbj|BAB22076.1| unnamed protein product [Mus musculus]
          Length = 252

 Score =  224 bits (572), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 111/247 (44%), Positives = 163/247 (65%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           M+ LV +K VI++  K+R+K D SG+ T+  K SMNPF EIA+EE+++L+EK +  E+I 
Sbjct: 1   MRALVAVKRVIDFAVKIRVKPDKSGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEIIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + +E ++ +LAMGADRGI +E      E+L PL +A++L ++ +KE   ++  G
Sbjct: 61  VSCGPSQCQETIRTALAMGADRGIHVEIPGAQAESLGPLQVARVLAKLAEKEKVDLLFLG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQM A L+ WPQ TF S + +  +   V RE+  G  T+   LPAV+T 
Sbjct: 121 KQAIDDDCNQTGQMTAGLLDWPQGTFASQVTLEGDKVKVEREIDGGLETLRLKLPAVVTA 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+IE  KA D  +DLT ++ V+  EE      G+++ +T 
Sbjct: 181 DLRLNEPRYATLPNIMKAKKKKIEVVKAGDLGVDLTSKVSVISVEEPPQRSAGVKVETTE 240

Query: 237 KLIEILK 243
            L+  LK
Sbjct: 241 DLVAKLK 247


>gi|117619314|ref|YP_856507.1| electron transfer flavoprotein beta-subunit [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117560721|gb|ABK37669.1| electron transfer flavoprotein beta-subunit [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 252

 Score =  224 bits (572), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 110/243 (45%), Positives = 166/243 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V++YN KVR+K+D S +E  N K+ +NPF EIA+EE ++LRE G+A+E++V
Sbjct: 4   MKLLVAVKRVLDYNVKVRVKSDGSDVELANVKMGINPFCEIAVEEGVRLREAGVASELVV 63

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+ G     E L+++LA+GADR     + ETL PL++A+ L+++ + E P +V+ GKQ+ 
Sbjct: 64  VTFGPEAAAEQLRHALALGADRARHYVTGETLTPLTVARALQQVCELEQPDLVLLGKQSI 123

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ GQMLAAL  WP ATF S IK+++    VTRE+  G  T+  PLPAV+TVDL L
Sbjct: 124 DSDNNQVGQMLAALNDWPLATFASAIKLVEGELQVTREIDGGLETLGMPLPAVVTVDLRL 183

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+ SLPNI+KA++K +E    T   ++   + ++L      A   G+ + S  +L++
Sbjct: 184 NEPRFASLPNIMKAKRKPLESAPFTALGVEPAAQTRLLGVMAPAARSAGIMVGSVDELLD 243

Query: 241 ILK 243
            LK
Sbjct: 244 KLK 246


>gi|260940855|ref|XP_002615267.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
 gi|238850557|gb|EEQ40021.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
          Length = 255

 Score =  224 bits (572), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 173/246 (70%), Gaps = 3/246 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLRE--KGIATEV 58
           +KILVP+K VI++  K RI    +G+ET+  K S+NPF +IALEESL++RE  KG+  ++
Sbjct: 5   LKILVPVKRVIDFAIKPRINKAGTGVETKGVKFSINPFCDIALEESLKIREANKGLVEKI 64

Query: 59  IVVSIGSCKVEEVLKNSLAMGADRGILIESNET-LEPLSIAKILREIVKKENPIIVIAGK 117
             VSIG  K +++L+ +LA GAD   L++  +  +EPL++AK+L+++V++E   +VI GK
Sbjct: 65  HAVSIGPTKSQDILRTALAKGADTTTLVDVGDAEVEPLTVAKMLQKVVEREGSNLVILGK 124

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q+ D+++NQTGQ+LA L+ WPQAT  S ++I  +   VTREV  G  T++  LP +IT D
Sbjct: 125 QSIDDDANQTGQILAGLLNWPQATNASKVEIKGDKISVTREVDGGADTLQADLPMIITTD 184

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LNEPRY SLPNI+KA+KK +EK KA+D  I++  RL+ L+ EE  A   G+++ S  +
Sbjct: 185 LRLNEPRYASLPNIMKAKKKPLEKLKASDLGIEVVNRLETLKVEEPPARSAGVKVDSVDE 244

Query: 238 LIEILK 243
           L+  LK
Sbjct: 245 LVSKLK 250


>gi|145298839|ref|YP_001141680.1| electron transfer flavoprotein subunit beta [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142851611|gb|ABO89932.1| Electron transfer flavoprotein beta-subunit [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 250

 Score =  224 bits (571), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 169/249 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV IK V++YN K+R+K D S +E  N K+ +NPF EIA+EE ++LRE GIA E++V
Sbjct: 1   MKLLVAIKRVVDYNVKIRVKGDGSNVELANVKMGINPFCEIAVEEGVRLREAGIANELVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+ G     E L+++LA+GADR +   ++ETL PL++A+ L+++ ++E P +V+ GKQ+ 
Sbjct: 61  VTFGPEAAAEQLRHALALGADRALHYVTDETLTPLTVARALKKVCEQEQPSLVLLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ GQML+AL  WP ATF S IK+++    VTRE+  G  T+  PLPAV+TVDL L
Sbjct: 121 DSDNNQVGQMLSALTDWPLATFASAIKLVEEELQVTREIDGGLETLGMPLPAVVTVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+ SLPNI+KA++K +E        ++     ++L          G+++ S  +L++
Sbjct: 181 NEPRFASLPNIMKAKRKPLESAPFATLGVEPAGHTRLLGVMAPAVRSAGIKVGSVDELLD 240

Query: 241 ILKSKHDLL 249
            L+++  +L
Sbjct: 241 KLRNEAKVL 249


>gi|147900496|ref|NP_001080044.1| electron-transfer-flavoprotein, beta polypeptide [Xenopus laevis]
 gi|37590558|gb|AAH59787.1| MGC68596 protein [Xenopus laevis]
          Length = 254

 Score =  223 bits (569), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 111/247 (44%), Positives = 164/247 (66%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           ++ LV +K VI+Y  KVR+K D +G+ T+  K SMNPF EIA+EE+++L+EK I  E+I 
Sbjct: 3   LRALVGVKRVIDYAVKVRVKPDKTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKIVGEIIA 62

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNE----TLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + +E ++ +LAMGADRGI ++       +L P  ++KI+  + KKEN  +V+ G
Sbjct: 63  VSCGPQQCQETIRTALAMGADRGIHVDVPAKDVGSLGPFQVSKIMAALAKKENVNLVLLG 122

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ N+TGQM AAL+ WPQ TF S +K+      V REV  G  T+   LPAV+T 
Sbjct: 123 KQAIDDDCNETGQMTAALLDWPQGTFASEVKVEGEKLTVVREVDGGLETISLKLPAVVTA 182

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+IE  K +D  +D+T R+++L  E+    + G+++ +  
Sbjct: 183 DLRLNEPRYATLPNIMKAKKKKIETVKPSDLGVDITSRIRILSVEDPPQRQAGVKVETVE 242

Query: 237 KLIEILK 243
            L+  LK
Sbjct: 243 DLVSKLK 249


>gi|255711130|ref|XP_002551848.1| KLTH0B01320p [Lachancea thermotolerans]
 gi|238933226|emb|CAR21410.1| KLTH0B01320p [Lachancea thermotolerans]
          Length = 258

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 171/249 (68%), Gaps = 6/249 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKG--IATEV 58
           ++ILVP+K VI+Y  K RI    +G+E    K SMNPFD+IA+EE++++REK   +   +
Sbjct: 5   LRILVPVKRVIDYAIKPRINKAGTGVEKTGVKFSMNPFDDIAVEEAVRIREKHKKLVENI 64

Query: 59  IVVSIGSCKVEEVLKNSLAMGADRGILIESNET-LEPLSIAKILREIVKKENPIIVIAGK 117
             VSIG  K +++L+ +LA GAD    ++  E  LEPL++AKIL+E+V K+N  +VI GK
Sbjct: 65  HAVSIGPLKAQDILRTALAKGADTCSHVDVKEAELEPLAVAKILKEMVAKQNANLVILGK 124

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNH--AIVTREVGHGTMTMETPLPAVIT 175
           Q+ D++ N TGQMLA L+ WPQATF + ++I + +  A VTRE+  G  T+  PLP V+T
Sbjct: 125 QSIDDDCNNTGQMLAGLLNWPQATFAAKVEIDEANMTARVTREIDGGEETVSAPLPLVVT 184

Query: 176 VDLNLNEPRYISLPNIIKARKKRIEKKKATDFA-IDLTPRLKVLRFEENRAERKGLRLYS 234
            DL LN+PRY +LPN++KA+KK +EK   +DF+ +D  PRLKV++ EE      G+++ S
Sbjct: 185 TDLRLNQPRYATLPNLMKAKKKPLEKLSLSDFSKVDAEPRLKVMKVEEPPTRSAGIKVGS 244

Query: 235 TTKLIEILK 243
             +LIE LK
Sbjct: 245 VDELIEKLK 253


>gi|38142460|ref|NP_080971.2| electron transfer flavoprotein subunit beta [Mus musculus]
 gi|92090596|sp|Q9DCW4|ETFB_MOUSE RecName: Full=Electron transfer flavoprotein subunit beta;
           Short=Beta-ETF
 gi|29351581|gb|AAH49237.1| Electron transferring flavoprotein, beta polypeptide [Mus musculus]
 gi|47682625|gb|AAH69877.1| Electron transferring flavoprotein, beta polypeptide [Mus musculus]
 gi|74214062|dbj|BAE29447.1| unnamed protein product [Mus musculus]
          Length = 255

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 110/247 (44%), Positives = 163/247 (65%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           ++ LV +K VI++  K+R+K D SG+ T+  K SMNPF EIA+EE+++L+EK +  E+I 
Sbjct: 4   LRALVAVKRVIDFAVKIRVKPDKSGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEIIA 63

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + +E ++ +LAMGADRGI +E      E+L PL +A++L ++ +KE   ++  G
Sbjct: 64  VSCGPSQCQETIRTALAMGADRGIHVEIPGAQAESLGPLQVARVLAKLAEKEKVDLLFLG 123

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQM A L+ WPQ TF S + +  +   V RE+  G  T+   LPAV+T 
Sbjct: 124 KQAIDDDCNQTGQMTAGLLDWPQGTFASQVTLEGDKVKVEREIDGGLETLRLKLPAVVTA 183

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+IE  KA D  +DLT ++ V+  EE      G+++ +T 
Sbjct: 184 DLRLNEPRYATLPNIMKAKKKKIEVVKAGDLGVDLTSKVSVISVEEPPQRSAGVKVETTE 243

Query: 237 KLIEILK 243
            L+  LK
Sbjct: 244 DLVAKLK 250


>gi|21244311|ref|NP_643893.1| electron transfer flavoprotein beta subunit [Xanthomonas axonopodis
           pv. citri str. 306]
 gi|21109963|gb|AAM38429.1| electron transfer flavoprotein beta subunit [Xanthomonas axonopodis
           pv. citri str. 306]
          Length = 248

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 158/245 (64%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ TE  K+S NPFDEIALEE+L+LR+ GIATEV+V
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVVTEGVKLSPNPFDEIALEEALRLRDAGIATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            ++        L+N LAMGA+R I + ++  ++PL+ A+ L ++V+KE P +VI GKQ  
Sbjct: 61  ATLAPADAAAHLRNGLAMGANRAIHVVTDAAVQPLTAARALLKLVEKEQPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF   + + D  A VTREV  G  T+E  LPAVIT DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFAGKLVVADGKATVTREVDAGLETLEVDLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LP+I+KA+ K +E     D  ID    L    +       +G+ +    +L+ 
Sbjct: 181 NEPRFIKLPDIMKAKSKPLETLAFADLGIDAHDSLTTTHYAAPSKRSRGVMVKDAAELVA 240

Query: 241 ILKSK 245
            LK K
Sbjct: 241 ALKQK 245


>gi|285019458|ref|YP_003377169.1| electron transfer flavoprotein beta subunit [Xanthomonas
           albilineans GPE PC73]
 gi|283474676|emb|CBA17175.1| probable electron transfer flavoprotein beta subunit [Xanthomonas
           albilineans]
          Length = 248

 Score =  223 bits (567), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 161/245 (65%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ TE  K+S NPFDEIALEE+L+LR+ GIA+EV+V
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVVTEGVKLSANPFDEIALEEALRLRDAGIASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            +I        L+N LAMGA+R I + ++  ++PL+ A+ L ++V++E P +VI GKQ  
Sbjct: 61  ATIAPADAAAHLRNGLAMGANRAIHVVTDAAIQPLTAARTLLKLVEQEQPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF S + + D  A VTREV  G  TME  LPAVIT DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFASKLVVADGKATVTREVDAGLETMEVDLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LP+I+KA+ K ++    TD  +     L +  +       +G+ + +  +L+ 
Sbjct: 181 NEPRFIKLPDIMKAKSKPLQTLAFTDLGVQANDSLAITHYAPPAKRSRGVMVKNAAELVA 240

Query: 241 ILKSK 245
            LK K
Sbjct: 241 ALKQK 245


>gi|307545633|ref|YP_003898112.1| electron transfer flavoprotein subunit beta [Halomonas elongata DSM
           2581]
 gi|307217657|emb|CBV42927.1| K03521 electron transfer flavoprotein beta subunit [Halomonas
           elongata DSM 2581]
          Length = 250

 Score =  222 bits (566), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 171/249 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+YN K+R+K D S ++  N K++MNPF EIA+EE+++L+E G ATEV+ 
Sbjct: 1   MKVLVAVKRVIDYNVKIRVKPDNSDVDLTNVKMAMNPFCEIAVEEAVRLKEAGTATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V++G    +E L+ +LA+GADR I ++++E +E L  AK+L ++V++E P +VI GKQ  
Sbjct: 61  VTVGPKAAQEQLRTALALGADRAIHVQTDERVESLGAAKVLAKVVEEEQPELVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL    Q TF S + + D    VTRE+  G  T+   LPAV+T DL L
Sbjct: 121 DSDNNQTGQMLAALTGRAQGTFASEVAVEDGKLKVTREIDGGLQTLSLALPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  LP+I+KA+KK ++ K   +  +++  +LK++  E     + G+++ S  +L++
Sbjct: 181 NEPRYAKLPDIMKAKKKPLDTKTPEELGVEVAGKLKLVGVEPPAERQGGVKVGSVDELVD 240

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 241 KLKNEAKVI 249


>gi|21230095|ref|NP_636012.1| electron transfer flavoprotein beta subunit [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66769914|ref|YP_244676.1| electron transfer flavoprotein beta subunit [Xanthomonas campestris
           pv. campestris str. 8004]
 gi|188993130|ref|YP_001905140.1| hypothetical protein xccb100_3735 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|14090391|gb|AAK53467.1|AF204145_8 putative electron-transferring flavoprotein beta subunit
           [Xanthomonas campestris pv. campestris]
 gi|21111621|gb|AAM39936.1| electron transfer flavoprotein beta subunit [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66575246|gb|AAY50656.1| electron transfer flavoprotein beta subunit [Xanthomonas campestris
           pv. campestris str. 8004]
 gi|167734890|emb|CAP53102.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 248

 Score =  222 bits (566), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 159/245 (64%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ T+  K+S NPFDEIALEE+L+LR+ GIATEV+V
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVVTDGVKLSPNPFDEIALEEALRLRDAGIATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            ++        L+N LAMGA+R I + ++  ++PL+ A+ L ++V+KE P +VI GKQ  
Sbjct: 61  ATLAPADAAAHLRNGLAMGANRAIHVVTDAAIQPLTAARTLLKLVEKEQPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF   + + D  A VTREV  G  T+E  LPAVIT DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFAGKLVVADGKATVTREVDAGLETLEVDLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LP+I+KA+ K +E     D A+D    L    +       +G+ +    +L+ 
Sbjct: 181 NEPRFIKLPDIMKAKSKPLETLAFADLAVDSHDSLTTTHYAAPAKRSRGVMVKDAAELVA 240

Query: 241 ILKSK 245
            LK K
Sbjct: 241 ALKQK 245


>gi|303257142|ref|ZP_07343156.1| electron transfer flavoprotein, beta subunit [Burkholderiales
           bacterium 1_1_47]
 gi|302860633|gb|EFL83710.1| electron transfer flavoprotein, beta subunit [Burkholderiales
           bacterium 1_1_47]
          Length = 250

 Score =  222 bits (566), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 113/251 (45%), Positives = 173/251 (68%), Gaps = 3/251 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++ N KV++  D   ++  N K SMNPFDEIALE+++Q++EKGIA EVI 
Sbjct: 1   MKILVPVKRVVDANIKVKVGPD-GKLDVANLKHSMNPFDEIALEQAVQMKEKGIANEVIA 59

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLE--PLSIAKILREIVKKENPIIVIAGKQ 118
           VS+G  K +E L+ +LAMGAD+G+LI++++  E  PL++AK++   VK+ NP ++I GKQ
Sbjct: 60  VSVGDTKSQETLRTALAMGADKGVLIQTDKPFEAEPLNVAKLISAYVKQVNPDLIICGKQ 119

Query: 119 TTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDL 178
             DN+SNQ GQM+AA+  +PQAT VS   + +    VTRE+  G   ++  LPAV+T DL
Sbjct: 120 AVDNDSNQVGQMIAAMCEYPQATHVSAAVMKEGKLEVTREIDGGYEVLDLTLPAVVTADL 179

Query: 179 NLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKL 238
            LN PRY++LP ++KA++K  E  +A+    DL   ++V+ +E   A + G ++ +  +L
Sbjct: 180 RLNAPRYVTLPMMMKAKRKPQEVVQASALCPDLRAHVEVVGYEAPAARKVGRKVANVDEL 239

Query: 239 IEILKSKHDLL 249
           I+ LK++  +L
Sbjct: 240 IDKLKNEAKVL 250


>gi|294624386|ref|ZP_06703080.1| Electron transfer flavoprotein beta subunit [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|294665238|ref|ZP_06730535.1| Electron transfer flavoprotein beta subunit [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|292601320|gb|EFF45363.1| Electron transfer flavoprotein beta subunit [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|292604989|gb|EFF48343.1| Electron transfer flavoprotein beta subunit [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
          Length = 248

 Score =  222 bits (566), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 157/245 (64%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ TE  K+S NPFDEIALEE+L+LR+ GIATEV+V
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVVTEGVKLSPNPFDEIALEEALRLRDAGIATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            ++        L+N LAMGA+R I + +   ++PL+ A+ L ++V+KE P +VI GKQ  
Sbjct: 61  ATLAPADAAAHLRNGLAMGANRAIHVVTEAAIQPLTAARTLLKLVEKEQPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF   + + D  A VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFAGKLAVADGKATVTREVDAGLETLEVDLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LP+I+KA+ K +E     D  +D    L    +       +G+ +    +L+ 
Sbjct: 181 NEPRFIKLPDIMKAKSKPLETLAFADLGVDAHDSLTTTHYAAPSKRSRGVMVKDAAELVA 240

Query: 241 ILKSK 245
            LK K
Sbjct: 241 ALKQK 245


>gi|260828705|ref|XP_002609303.1| hypothetical protein BRAFLDRAFT_115002 [Branchiostoma floridae]
 gi|229294659|gb|EEN65313.1| hypothetical protein BRAFLDRAFT_115002 [Branchiostoma floridae]
          Length = 255

 Score =  222 bits (565), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 120/247 (48%), Positives = 174/247 (70%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           ++ILV +K VI+Y  K+R+K D SG+ T+  K SMNPF EIA+EE+++L+EK +A E+I 
Sbjct: 4   LRILVGVKRVIDYAVKIRVKPDNSGVVTDGVKHSMNPFCEIAMEEAVRLKEKKLAKEIIA 63

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESN----ETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + +E ++ +LAMGADRGI +E +    E + PL ++KIL ++ + +   +VI G
Sbjct: 64  VSCGPTQAQETIRTALAMGADRGIHVEVSGKEYENMTPLHVSKILAKLAQDQEANLVILG 123

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ+ D ++NQTGQM AAL+ WPQATF S +   ++H  V RE+  G  T++  LPAVIT 
Sbjct: 124 KQSIDGDNNQTGQMTAALLDWPQATFASEVTKENDHLKVIREIDGGLETVKVTLPAVITA 183

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+I K KA+DF +DL+P L+VL  E+    + G ++ ST 
Sbjct: 184 DLRLNEPRYATLPNIMKAKKKKIAKHKASDFGVDLSPTLEVLSVEDPPVRQAGQKVESTE 243

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 244 ELVAKLK 250


>gi|289668423|ref|ZP_06489498.1| electron transfer flavoprotein subunit beta [Xanthomonas campestris
           pv. musacearum NCPPB4381]
          Length = 248

 Score =  222 bits (565), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 158/245 (64%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ TE  K+S NPFDEIALEE+L+LR+ GIATEV+V
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVVTEGVKLSPNPFDEIALEEALRLRDAGIATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            ++        L+N LAMGA+R I + ++  ++PL+ A+ L ++V+KE P +VI GKQ  
Sbjct: 61  ATLAPADAAAHLRNGLAMGANRAIHVVTDAAVQPLTAARALLKLVEKEQPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF   + + D  A VTREV  G  T+E  LPAVIT DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFAGKLVVADGKATVTREVDAGLETLEIDLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LP+I+KA+ K +E     D  +D    L    +       +G+ +    +L+ 
Sbjct: 181 NEPRFIKLPDIMKAKSKPLETLAFADLGVDAHDSLTTTHYAAPSKRSRGVMVKDAAELVA 240

Query: 241 ILKSK 245
            LK K
Sbjct: 241 ALKQK 245


>gi|325920443|ref|ZP_08182371.1| Electron transfer flavoprotein, beta subunit [Xanthomonas gardneri
           ATCC 19865]
 gi|325549090|gb|EGD20016.1| Electron transfer flavoprotein, beta subunit [Xanthomonas gardneri
           ATCC 19865]
          Length = 248

 Score =  222 bits (565), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 158/245 (64%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ T+  K+S NPFDEIALEE+L+LR+ GIATEV+V
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVVTDGVKLSPNPFDEIALEEALRLRDAGIATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            ++        L+N LAMGA+R I + ++  ++PL+ A+ L ++V+KE P +VI GKQ  
Sbjct: 61  ATLAPADAAAHLRNGLAMGANRAIHVVTDAAIQPLTAARTLLKLVEKEQPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF   + + D  A VTREV  G  T+E  LPAVIT DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFAGKLVVADGKATVTREVDAGLETLEVDLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LP+I+KA+ K +E     D  +D    L    +       +G+ +    +L+ 
Sbjct: 181 NEPRFIKLPDIMKAKSKPLETLAFADLGVDAHDSLSTTHYAAPSKRSRGVMVKDAAELVA 240

Query: 241 ILKSK 245
            LK K
Sbjct: 241 ALKQK 245


>gi|294671170|ref|ZP_06736024.1| hypothetical protein NEIELOOT_02878 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307108|gb|EFE48351.1| hypothetical protein NEIELOOT_02878 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 208

 Score =  221 bits (564), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 145/198 (73%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D S ++  N K+SMNPFDEIA+EE+++L+E G  +E++ 
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEEAVRLKEAGKVSEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  K E+ L+ +LAMGADR I +E+   LEPL++AK+L+ +  KE P I++ GKQ  
Sbjct: 61  VSLGGKKCEDTLRTALAMGADRAIHVETEAALEPLAVAKLLKAVADKEQPQILLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQT QMLAALM  PQ TFV  ++I  + A+VTRE+  G  T+   LPAVI+ DL L
Sbjct: 121 DDDANQTAQMLAALMNAPQGTFVGKLEIDGSEAVVTREIDGGMETVALKLPAVISADLRL 180

Query: 181 NEPRYISLPNIIKARKKR 198
           NEPRY+ LP I++A+K R
Sbjct: 181 NEPRYVKLPQIMQAKKNR 198


>gi|4503609|ref|NP_001976.1| electron transfer flavoprotein subunit beta isoform 1 [Homo
           sapiens]
 gi|585110|sp|P38117|ETFB_HUMAN RecName: Full=Electron transfer flavoprotein subunit beta;
           Short=Beta-ETF
 gi|2781203|pdb|1EFV|B Chain B, Three-Dimensional Structure Of Human Electron Transfer
           Flavoprotein To 2.1 A Resolution
 gi|49259286|pdb|1T9G|S Chain S, Structure Of The Human Mcad:etf Complex
 gi|297902|emb|CAA50441.1| electron transfer flavoprotein beta subunit [Homo sapiens]
 gi|22652459|gb|AAN03713.1| electron transfer flavoprotein beta-subunit [Homo sapiens]
 gi|48145771|emb|CAG33108.1| ETFB [Homo sapiens]
 gi|62739640|gb|AAH93963.1| Electron-transfer-flavoprotein, beta polypeptide, isoform 1 [Homo
           sapiens]
 gi|62740056|gb|AAH93961.1| Electron-transfer-flavoprotein, beta polypeptide [Homo sapiens]
          Length = 255

 Score =  221 bits (564), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 110/247 (44%), Positives = 162/247 (65%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           +++LV +K VI+Y  K+R+K D +G+ T+  K SMNPF EIA+EE+++L+EK +  EVI 
Sbjct: 4   LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIA 63

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + +E ++ +LAMGADRGI +E      E L PL +A++L ++ +KE   +V+ G
Sbjct: 64  VSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLG 123

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQM A  + WPQ TF S + +  +   V RE+  G  T+   LPAV+T 
Sbjct: 124 KQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTA 183

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+IE  K  D  +DLT +L V+  E+      G+++ +T 
Sbjct: 184 DLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTE 243

Query: 237 KLIEILK 243
            L+  LK
Sbjct: 244 DLVAKLK 250


>gi|212711032|ref|ZP_03319160.1| hypothetical protein PROVALCAL_02101 [Providencia alcalifaciens DSM
           30120]
 gi|212686200|gb|EEB45728.1| hypothetical protein PROVALCAL_02101 [Providencia alcalifaciens DSM
           30120]
          Length = 251

 Score =  221 bits (563), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 103/202 (50%), Positives = 152/202 (75%), Gaps = 2/202 (0%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI++N KVR+K D SG+E  N K++MNPFDEIA+EE+++L+E G ATEV+ 
Sbjct: 1   MKILVAVKRVIDHNVKVRVKADGSGVELANVKMAMNPFDEIAVEEAVRLKEAGKATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE--SNETLEPLSIAKILREIVKKENPIIVIAGKQ 118
           VSIG    ++ L++++A+GADR ILI+  ++  LEPL IA++L+++V +E P +++ GKQ
Sbjct: 61  VSIGEASAQDTLRSAMAIGADRAILIQRPADLVLEPLDIARLLQQVVNQEQPDLILLGKQ 120

Query: 119 TTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDL 178
             D++ NQTGQML+AL+ + QATF S + +      VTRE+  G  T+   LPA++T DL
Sbjct: 121 AIDDDCNQTGQMLSALLGYAQATFASQVVVEGARLQVTREIDGGLETLSMGLPAIVTTDL 180

Query: 179 NLNEPRYISLPNIIKARKKRIE 200
            LNEPRY +LPNI+KA+KK+++
Sbjct: 181 RLNEPRYATLPNIMKAKKKQLD 202


>gi|119592410|gb|EAW72004.1| electron-transfer-flavoprotein, beta polypeptide [Homo sapiens]
          Length = 255

 Score =  221 bits (563), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 110/247 (44%), Positives = 162/247 (65%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           +++LV +K VI+Y  K+R+K D +G+ T+  K SMNPF EIA+EE+++L+EK +  EVI 
Sbjct: 4   LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIA 63

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + +E ++ +LAMGADRGI +E      E L PL +A++L ++ +KE   +V+ G
Sbjct: 64  VSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLG 123

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQM A  + WPQ TF S + +  +   V RE+  G  T+   LPAV+T 
Sbjct: 124 KQAIDDDCNQTGQMTAGFLDWPQGTFASQVMLEGDKLKVEREIDGGLETLRLKLPAVVTA 183

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+IE  K  D  +DLT +L V+  E+      G+++ +T 
Sbjct: 184 DLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTE 243

Query: 237 KLIEILK 243
            L+  LK
Sbjct: 244 DLVAKLK 250


>gi|315182723|gb|ADT89636.1| hypothetical electron transfer flavoprotein,beta subunit [Vibrio
           furnissii NCTC 11218]
          Length = 250

 Score =  221 bits (562), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 109/245 (44%), Positives = 166/245 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++   KVR+K+D SG+ET N K+++NPF EIA+EE+++LRE GIA EVIV
Sbjct: 1   MKILVAVKRVVDAYVKVRVKSDGSGVETHNVKMAINPFCEIAVEEAIRLREAGIAEEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G    +E L+ +LA+GADR I IE++   EPL++AK+L+ ++  E P +V+ GKQ+ 
Sbjct: 61  VSAGDASCQEQLRAALALGADRAIHIETDGAPEPLNVAKLLKAVMASEAPGLVLLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQ  QMLAAL   PQ TF S + +  +  +VTRE+  G  T++  LPA+I+ DL L
Sbjct: 121 DTDNNQVAQMLAALTERPQGTFASKVDVQGDAVLVTREIDGGLETLKLALPAIISTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K ++        + LT   +++        + G+ + S ++L++
Sbjct: 181 NEPRYASLPNIMKAKRKPLDVTTPDALGVTLTTHQQIMDVMPPPERKAGVMVASVSELVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|289662633|ref|ZP_06484214.1| electron transfer flavoprotein subunit beta [Xanthomonas campestris
           pv. vasculorum NCPPB702]
          Length = 248

 Score =  221 bits (562), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 158/245 (64%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ T+  K+S NPFDEIALEE+L+LR+ GIATEV+V
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVVTDGVKLSPNPFDEIALEEALRLRDAGIATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            ++        L+N LAMGA+R I + ++  ++PL+ A+ L ++V+KE P +VI GKQ  
Sbjct: 61  ATLAPADAAAHLRNGLAMGANRAIHVVTDAAVQPLTAARALLKLVEKEQPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF   + + D  A VTREV  G  T+E  LPAVIT DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFAGKLVVADGKATVTREVDAGLETLEVDLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LP+I+KA+ K +E     D  +D    L    +       +G+ +    +L+ 
Sbjct: 181 NEPRFIKLPDIMKAKSKPLETLAFADLGVDAHDSLTSTHYAAPSKRSRGVMVKDAAELVA 240

Query: 241 ILKSK 245
            LK K
Sbjct: 241 ALKQK 245


>gi|323499184|ref|ZP_08104162.1| electron transfer flavoprotein subunit beta [Vibrio sinaloensis DSM
           21326]
 gi|323315817|gb|EGA68850.1| electron transfer flavoprotein subunit beta [Vibrio sinaloensis DSM
           21326]
          Length = 250

 Score =  221 bits (562), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 105/245 (42%), Positives = 174/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K VI+  TK+R+K D +G+E  N K+++NPF EIA+EE+++L+E+G+A EVIV
Sbjct: 1   MKVLVAVKRVIDPYTKIRVKADGTGVEDGNVKMTINPFCEIAVEEAIRLKEQGVADEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            SIG  + +E L+ +LA+GADR + I +++  EPL +AKIL+ + ++E   +VI GKQ+ 
Sbjct: 61  TSIGEERCQEQLRAALALGADRAVHINTDQVCEPLCVAKILKAVFEREQVSLVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQ  QMLAAL+  PQATF S++    +  +VTRE+  G   ++  LPA+++ DL L
Sbjct: 121 DSDNNQVAQMLAALLERPQATFASSLDFDGDSLVVTREIDGGLERLKLMLPAIVSTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K +++  A +  +++T   ++L+       + G+R+ S+ +L++
Sbjct: 181 NEPRYASLPNIMKAKRKPMDELTAAELGVEVTSSQQILQVMPPPDRKPGIRVSSSAELVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKAE 245


>gi|325928548|ref|ZP_08189736.1| Electron transfer flavoprotein, beta subunit [Xanthomonas perforans
           91-118]
 gi|325541087|gb|EGD12641.1| Electron transfer flavoprotein, beta subunit [Xanthomonas perforans
           91-118]
          Length = 248

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 158/245 (64%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ TE  K+S NPFDEIALEE+L+LR+ GIATEV+V
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVVTEGVKLSPNPFDEIALEEALRLRDAGIATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            ++        L+N LAMGA+R I + ++  ++PL+ A+ L ++V+KE P +VI GKQ  
Sbjct: 61  ATLAPADAAAHLRNGLAMGANRAIHVVTDAAVQPLTAARALLKLVEKEQPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF   + + D  A VTREV  G  T+E  LPAVIT DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFAGKLVVADGKATVTREVDAGLETLEIDLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LP+I+KA+ K +E     D  +D    +    +       +G+ +    +L+ 
Sbjct: 181 NEPRFIKLPDIMKAKSKPLETLAFADLGVDAHDSVTTTHYAAPSKRSRGVMVKDAAELVA 240

Query: 241 ILKSK 245
            LK K
Sbjct: 241 ALKQK 245


>gi|253999635|ref|YP_003051698.1| electron transfer flavoprotein subunits alpha/beta [Methylovorus
           sp. SIP3-4]
 gi|313201675|ref|YP_004040333.1| electron transfer flavoprotein subunits alpha/beta [Methylovorus
           sp. MP688]
 gi|253986314|gb|ACT51171.1| Electron transfer flavoprotein alpha/beta-subunit [Methylovorus sp.
           SIP3-4]
 gi|312440991|gb|ADQ85097.1| Electron transfer flavoprotein alpha/beta-subunit [Methylovorus sp.
           MP688]
          Length = 249

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 106/243 (43%), Positives = 161/243 (66%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+V +K V++YN   R+K D S +E    K+ +NPFDEIA+EE+L+L+EKGIATE++ 
Sbjct: 1   MKIMVAVKHVVDYNIVPRVKQDGSDVEISGVKMGINPFDEIAVEEALRLKEKGIATEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+   ++ L+++LAMG DR +L+++   L+PL +AK+L+ +  +E P +++ GKQ  
Sbjct: 61  VSIGAENSKDTLRHALAMGVDRAVLVQAEGKLQPLGVAKLLKAVAGREQPDLILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++ Q GQMLAAL+   Q  F S IK+  N   V REV  GT T+   LPA++T DL L
Sbjct: 121 DDDAGQAGQMLAALLGVGQGLFASEIKVNGNEIEVNREVDGGTETVALQLPAIVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LPN++ A+KK I+    T+  +D    L +L   E    + G+ + S  +L+E
Sbjct: 181 NEPRFIKLPNMMMAKKKPIDVIAGTELGVDFASHLSLLNVAEPAPRKPGVIVNSVAELVE 240

Query: 241 ILK 243
            L+
Sbjct: 241 KLR 243


>gi|302565162|ref|NP_001181636.1| electron transfer flavoprotein subunit beta [Macaca mulatta]
          Length = 255

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 110/247 (44%), Positives = 161/247 (65%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           ++ LV +K VI+Y  K+R+K D +G+ T+  K SMNPF EIA+EE+++L+EK +  EVI 
Sbjct: 4   LRALVAVKRVIDYAVKIRVKPDKTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIA 63

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + +E ++ +LAMGADRGI +E      E L PL +A++L ++ +KE   +V+ G
Sbjct: 64  VSCGPAQCQETIRTALAMGADRGIHVEVPPAEAECLGPLQVARVLAKLAEKEKVDLVLLG 123

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQM A  + WPQ TF S + +  +   V RE+  G  T+   LPAV+T 
Sbjct: 124 KQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTA 183

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+IE  K  D  +DLT +L V+  E+      G+++ +T 
Sbjct: 184 DLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTE 243

Query: 237 KLIEILK 243
            L+  LK
Sbjct: 244 DLVAKLK 250


>gi|260777492|ref|ZP_05886386.1| electron transfer flavoprotein beta subunit [Vibrio coralliilyticus
           ATCC BAA-450]
 gi|260607158|gb|EEX33432.1| electron transfer flavoprotein beta subunit [Vibrio coralliilyticus
           ATCC BAA-450]
          Length = 249

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 167/249 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV IK VI+   KVR+K+D SG+ET N K+SMNPF EIA+EE+++L+E G+A EVIV
Sbjct: 1   MKVLVAIKRVIDPYVKVRVKSDGSGVETNNVKMSMNPFCEIAVEEAVRLKESGVAEEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+ +LA+GADR I +E++ + EPL +AK+L+ ++++E P IV+ GKQ+ 
Sbjct: 61  VSIGDAASQESLRGALALGADRAIHVEADGSPEPLVVAKLLKALMEQEQPGIVLLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQ  QML AL   PQ TF S + +      VTREV  G  T++  LPA+I+ DL L
Sbjct: 121 DTDNNQVAQMLGALTGRPQGTFASEVIVEGEQVSVTREVDGGLETVKLILPAIISTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++   A D  I L    +++          G  + S ++L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDVISADDLGIALVRSQEIIEIMAPAERSAGEMVTSVSELVD 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAKVL 249


>gi|325184775|emb|CCA19266.1| electron transfer flavoprotein subunit beta putativ [Albugo
           laibachii Nc14]
          Length = 254

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 120/256 (46%), Positives = 180/256 (70%), Gaps = 9/256 (3%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVPIK V++Y  K+R+     G++ +N K+SMNPF EIA+EE+++L+EK   +EVI 
Sbjct: 1   MKVLVPIKRVVDYAVKIRVAP--QGVDLKNVKMSMNPFCEIAVEEAIRLKEKKQVSEVIA 58

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESN----ETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E ++ +LAMGADRGI +E++    + L+PL++AKIL+ +V KE P +VI G
Sbjct: 59  VSIGPKQAQETIRTALAMGADRGIHVETDLRTDQELQPLAVAKILKALVDKEEPRLVICG 118

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKI---IDNHAIVTREVGHGTMTMETPLPAV 173
           KQ+ D+++ QTG +LA L+ W QATF S ++    + +  +VTRE   G   ++  LP+V
Sbjct: 119 KQSIDSDAAQTGPLLAGLLDWSQATFASKVEFKEELKDQFLVTRETDDGVQVLKLSLPSV 178

Query: 174 ITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLY 233
           +T DL LNEPRY +LPNI+KA+KK+IE   A    +DLTPR+KVL+ EE    + G++L 
Sbjct: 179 VTTDLRLNEPRYATLPNIMKAKKKKIEAIAADTLNVDLTPRIKVLQVEEPAIRKAGIKLG 238

Query: 234 STTKLIEILKSKHDLL 249
           S  +LI+ LK++  +L
Sbjct: 239 SIDELIDKLKNEVGVL 254


>gi|331000900|ref|ZP_08324537.1| electron transfer flavoprotein subunit beta [Parasutterella
           excrementihominis YIT 11859]
 gi|329569859|gb|EGG51616.1| electron transfer flavoprotein subunit beta [Parasutterella
           excrementihominis YIT 11859]
          Length = 250

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 112/251 (44%), Positives = 173/251 (68%), Gaps = 3/251 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILVP+K V++ N KV++  D   ++  N K SMNPFDEIALE+++Q++EKGIA EVI 
Sbjct: 1   MKILVPVKRVVDANIKVKVGPD-GKLDVANLKHSMNPFDEIALEQAVQMKEKGIANEVIA 59

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLE--PLSIAKILREIVKKENPIIVIAGKQ 118
           VS+G  K +E L+ +LAMGAD+G+LI++++  E  PL++AK++   VK+ NP ++I GKQ
Sbjct: 60  VSVGDTKSQETLRTALAMGADKGVLIQTDKPFEAEPLNVAKLISAYVKQVNPDLIICGKQ 119

Query: 119 TTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDL 178
             DN+SNQ GQM+AA+  +PQAT VS   + +    VTRE+  G   ++  LPAV+T DL
Sbjct: 120 AVDNDSNQVGQMIAAMCEYPQATHVSAAVMKEGKLEVTREIDGGYEVLDLTLPAVVTADL 179

Query: 179 NLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKL 238
            LN PRY++LP ++KA++K  E  +A+    +L   ++V+ +E   A + G ++ +  +L
Sbjct: 180 RLNAPRYVTLPMMMKAKRKPQEVVQASALCPELRAHVEVVGYEAPAARKVGRKVANVDEL 239

Query: 239 IEILKSKHDLL 249
           I+ LK++  +L
Sbjct: 240 IDKLKNEAKVL 250


>gi|197100991|ref|NP_001124625.1| electron transfer flavoprotein subunit beta [Pongo abelii]
 gi|62510586|sp|Q5RFK0|ETFB_PONAB RecName: Full=Electron transfer flavoprotein subunit beta;
           Short=Beta-ETF
 gi|55725182|emb|CAH89457.1| hypothetical protein [Pongo abelii]
          Length = 255

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 110/247 (44%), Positives = 161/247 (65%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           ++ LV +K VI+Y  K+R+K D +G+ T+  K SMNPF EIA+EE+++L+EK +  EVI 
Sbjct: 4   LRALVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIA 63

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + +E ++ +LAMGADRGI +E      E L PL +A++L ++ +KE   +V+ G
Sbjct: 64  VSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLG 123

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQM A  + WPQ TF S + +  +   V RE+  G  T+   LPAV+T 
Sbjct: 124 KQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTA 183

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+IE  K  D  +DLT +L V+  E+      G+++ +T 
Sbjct: 184 DLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTE 243

Query: 237 KLIEILK 243
            L+  LK
Sbjct: 244 DLVAKLK 250


>gi|325915777|ref|ZP_08178079.1| Electron transfer flavoprotein, beta subunit [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325538041|gb|EGD09735.1| Electron transfer flavoprotein, beta subunit [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 248

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 157/245 (64%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ TE  K+S NPFDEIALEE+L+LR+ GIATEV+V
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVVTEGVKLSPNPFDEIALEEALRLRDAGIATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            ++        L+N LAMGA+R I + ++  ++PL+ A+ L ++V+KE P +VI GKQ  
Sbjct: 61  ATLAPADAAAHLRNGLAMGANRAIHVVTDAAIQPLTAARALLKLVEKEQPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF   + + D  A VTREV  G  T+E  LPAVIT DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFAGKLVVADGKATVTREVDAGLETLEVDLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LP+I+KA+ K +E     D  +     L    +       +G+ +    +L+ 
Sbjct: 181 NEPRFIKLPDIMKAKSKPLETLAFADLGVAAHDSLTTTHYAAPSKRSRGVMVKDAAELVA 240

Query: 241 ILKSK 245
            LK K
Sbjct: 241 ALKQK 245


>gi|327280790|ref|XP_003225134.1| PREDICTED: electron transfer flavoprotein subunit beta-like [Anolis
           carolinensis]
          Length = 257

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 110/247 (44%), Positives = 161/247 (65%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           ++ +V +K VI+Y  KVR+K D +G+ T+  K SMNPF EIA+EE+++L+EK + +EVI 
Sbjct: 6   LRAMVGVKRVIDYAVKVRVKPDKTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVSEVIA 65

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + +E ++ +LAMGADRG+ +E      E+L P  ++KIL  + KKE   +++ G
Sbjct: 66  VSCGPQQCQETIRTALAMGADRGVHVEIPAKDYESLGPFQVSKILAALAKKEGVNLLLLG 125

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQM AA + WPQ TF S + +  +   V REV  G  T+   LP V+T 
Sbjct: 126 KQAIDDDCNQTGQMTAAFLDWPQGTFASQVTVDGDWLKVEREVDGGLETVRLKLPVVVTA 185

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+IE  K +D  +DLT R+K L  E+      G+++ +  
Sbjct: 186 DLRLNEPRYATLPNIMKAKKKKIEVVKPSDLGVDLTSRVKTLNVEDPPQRSAGVKVETVD 245

Query: 237 KLIEILK 243
            L+  LK
Sbjct: 246 DLVVKLK 252


>gi|261344950|ref|ZP_05972594.1| electron transfer flavoprotein, beta subunit [Providencia
           rustigianii DSM 4541]
 gi|282567092|gb|EFB72627.1| electron transfer flavoprotein, beta subunit [Providencia
           rustigianii DSM 4541]
          Length = 251

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 117/252 (46%), Positives = 171/252 (67%), Gaps = 9/252 (3%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI++N K+R+K D SG+E  N K+++NPFDEIA+EE+++L+E G ATEVI 
Sbjct: 1   MKILVAVKRVIDHNVKIRVKADGSGVELANVKMAINPFDEIAVEEAVRLKEAGKATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE--SNETLEPLSIAKILREIVKKENPIIVIAGKQ 118
           VSIG    +E L++++A+GADR IL++  +   LEPL IA++L++IV KE P +++ GKQ
Sbjct: 61  VSIGDATAQETLRSAMAIGADRAILVQRPTEMVLEPLDIARLLQKIVTKEQPDLILLGKQ 120

Query: 119 TTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDL 178
             D++ NQTGQML+AL+   QATF S I I      VTRE+  G  T+    PA++T DL
Sbjct: 121 AIDDDCNQTGQMLSALLGCAQATFASQIVIEGERVQVTREIDGGLETLSMGFPAIVTTDL 180

Query: 179 NLNEPRYISLPNIIKARKKRIEKKKATDFA-IDLTP--RLKVLRFEENRAERKGLRLYS- 234
            LNEPRY +LPNI+KA+KK +E     D A +D +P  ++K+L   E +       L++ 
Sbjct: 181 RLNEPRYATLPNIMKAKKKPLE---IIDVATLDFSPLGQVKILNVAEPKKRTGQCTLFND 237

Query: 235 TTKLIEILKSKH 246
            + L+  L++K 
Sbjct: 238 VSALVTELQAKE 249


>gi|51948412|ref|NP_001004220.1| electron transfer flavoprotein subunit beta [Rattus norvegicus]
 gi|81884360|sp|Q68FU3|ETFB_RAT RecName: Full=Electron transfer flavoprotein subunit beta;
           Short=Beta-ETF
 gi|51259425|gb|AAH79351.1| Electron-transfer-flavoprotein, beta polypeptide [Rattus
           norvegicus]
 gi|149056124|gb|EDM07555.1| electron-transfer-flavoprotein, beta polypeptide [Rattus
           norvegicus]
          Length = 255

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 110/247 (44%), Positives = 162/247 (65%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           ++ LV +K VI++  K+R+K D SG+ T+  K SMNPF EIA+EE+++L+EK +  E+I 
Sbjct: 4   LRALVAVKRVIDFAVKIRVKPDKSGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEIIA 63

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + +E ++ +LAMGADRGI +E      E L PL +A++L ++ +KE   ++  G
Sbjct: 64  VSCGPPQCQETIRTALAMGADRGIHVEVPGAEAENLGPLQVARVLAKLAEKEKVDLLFLG 123

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQM A L+ WPQ TF S + +  +   V RE+  G  T+   LPAV+T 
Sbjct: 124 KQAIDDDCNQTGQMTAGLLDWPQGTFASQVTLEGDKVKVEREIDGGLETIRLKLPAVVTA 183

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+IE  KA D  +DLT ++ V+  EE      G+++ +T 
Sbjct: 184 DLRLNEPRYATLPNIMKAKKKKIEVIKAGDLGVDLTSKVSVISVEEPPQRLAGVKVETTE 243

Query: 237 KLIEILK 243
            L+  LK
Sbjct: 244 DLVAKLK 250


>gi|71042617|pdb|2A1T|S Chain S, Structure Of The Human Mcad:etf E165betaa Complex
 gi|71042619|pdb|2A1U|B Chain B, Crystal Structure Of The Human Etf E165betaa Mutant
          Length = 255

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 109/247 (44%), Positives = 161/247 (65%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           +++LV +K VI+Y  K+R+K D +G+ T+  K SMNPF EIA+EE+++L+EK +  EVI 
Sbjct: 4   LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIA 63

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + +E ++ +LAMGADRGI +E      E L PL +A++L ++ +KE   +V+ G
Sbjct: 64  VSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLG 123

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQM A  + WPQ TF S + +  +   V R +  G  T+   LPAV+T 
Sbjct: 124 KQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVERAIDGGLETLRLKLPAVVTA 183

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+IE  K  D  +DLT +L V+  E+      G+++ +T 
Sbjct: 184 DLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTE 243

Query: 237 KLIEILK 243
            L+  LK
Sbjct: 244 DLVAKLK 250


>gi|307579231|gb|ADN63200.1| electron transfer flavoprotein alpha/beta-subunit [Xylella
           fastidiosa subsp. fastidiosa GB514]
          Length = 229

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 150/220 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ TE  K+S NPFDEIALEE+L+LR+ GIA+EV++
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVMTEGVKVSANPFDEIALEEALRLRDAGIASEVVI 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            ++    V   L+N LAMGA+R I I ++ T++PL+ A+ L ++V+KE+P +VI GKQ  
Sbjct: 61  ATLAPNDVTAHLRNGLAMGANRAIHIVTHTTVQPLTAARALLKLVEKEHPALVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF S + I D  A VTREV  G  T+   LPAVIT DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFASKVTIADGKATVTREVDAGLETLHIDLPAVITADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRF 220
           N PR+I LP+I+KA+ K +E     D  +     L+   +
Sbjct: 181 NAPRFIKLPDIMKAKSKPLETIAFADLGVTAHDSLQTTHY 220


>gi|109896982|ref|YP_660237.1| electron transfer flavoprotein beta-subunit [Pseudoalteromonas
           atlantica T6c]
 gi|109699263|gb|ABG39183.1| electron transfer flavoprotein beta-subunit [Pseudoalteromonas
           atlantica T6c]
          Length = 249

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 179/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+YN KVR+K+D + ++  N K++MNPF EIA+EE+++L+E G+A+EV+V
Sbjct: 1   MKILVAVKRVIDYNVKVRVKSDNTDVDLTNVKMAMNPFCEIAVEEAVRLKEVGVASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+   +E ++ +LA+GADRGI IE + + + LSIAK+L+ +V +E P +VI GKQ+ 
Sbjct: 61  VSIGAKACQEQIRTALALGADRGIQIELDTSADALSIAKLLKAVVDEEQPGLVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+  PQATF S +K+  +   VTRE+  G  T+E  +PA+IT DL L
Sbjct: 121 DSDNNQTGQMLAALLDQPQATFASEVKVDGDKVQVTREIDGGLQTLELDMPAIITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K +E K  +D  +++   + +         + G+++ S  +L+E
Sbjct: 181 NEPRYASLPNIMKAKRKPLEVKTPSDLGVEVRNNITLESVSAPAQRQAGIKVESVAELVE 240

Query: 241 ILKSKHDLL 249
            LK++  +L
Sbjct: 241 KLKNEAKVL 249


>gi|254282729|ref|ZP_04957697.1| electron transfer flavoprotein beta-subunit [gamma proteobacterium
           NOR51-B]
 gi|219678932|gb|EED35281.1| electron transfer flavoprotein beta-subunit [gamma proteobacterium
           NOR51-B]
          Length = 250

 Score =  219 bits (557), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 161/245 (65%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR K D S +E  N K+++NPF EIA+EE+++L+E G   E++V
Sbjct: 1   MKALVAVKRVVDYNVKVRAKADGSDVELNNVKMAINPFCEIAVEEAVRLKEAGTVEEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E ++ +LA+GADRGI +E +   EPL +AK+L+ +V KE P +VI GKQ+ 
Sbjct: 61  VSIGEKACQEQIRTALALGADRGIHVEVDGKPEPLEVAKLLKGVVDKEQPNLVILGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAAL    Q TF S IKI  +   VTRE+  G  T+   LPA++T DL L
Sbjct: 121 DGDNNQTGQMLAALTNMAQGTFASEIKIDGDKMNVTREIDGGMQTISLSLPAIVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK ++     DF +++   +  L          G+++    +L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLDVVTPADFGVEIQTHVTQLSVAPPPERAAGIKVEDVAQLVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|209515574|ref|ZP_03264439.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           H160]
 gi|209504041|gb|EEA04032.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           H160]
          Length = 249

 Score =  219 bits (557), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 172/245 (70%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+YN K  +K+D SG++  N K++MNPFDEIA+EE+++L+E G+A+EV+V
Sbjct: 1   MKILVAVKRVIDYNVKPWVKSDGSGVDLANVKMAMNPFDEIAVEEAVRLKEAGVASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G+ + +EVL+ +LAMGADR +L+ES+  L+PL++AK+L  +  +E P +V+ GKQ  
Sbjct: 61  VSAGTAQSQEVLRTALAMGADRAVLVESDVDLQPLAVAKLLAAVAARETPQLVLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           DN++ QTGQ LAAL+ WPQATF    ++     +VTRE+  G   +   LPAV+T DL L
Sbjct: 121 DNDAGQTGQKLAALLGWPQATFAFKAEVDGQKLLVTREIDGGLERVALDLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PRY++LPNI+KA+KK +E        +D+ PRLKVL   E  A + G+ +     LIE
Sbjct: 181 NSPRYVTLPNIMKAKKKPLETLNPEGLGVDVAPRLKVLEVTEPPARKGGVMVPDVAALIE 240

Query: 241 ILKSK 245
            L+++
Sbjct: 241 KLRNE 245


>gi|72040095|ref|XP_792626.1| PREDICTED: similar to Electron-transfer-flavoprotein, beta
           polypeptide [Strongylocentrotus purpuratus]
 gi|115970796|ref|XP_001188734.1| PREDICTED: similar to Electron-transfer-flavoprotein, beta
           polypeptide [Strongylocentrotus purpuratus]
          Length = 434

 Score =  219 bits (557), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 116/247 (46%), Positives = 170/247 (68%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           +++LV +K VI+Y  K+R+K D  G+ TE  K SMNPFDEIA+EE+++LREK +  E+I 
Sbjct: 3   LRVLVGVKRVIDYAVKIRVKPDNMGVVTEGVKHSMNPFDEIAVEEAVRLREKKLVKEIIA 62

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESN----ETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + +E L+ +LAMG DRGI +E +    E L P  ++KI+ ++ ++E+  +VI G
Sbjct: 63  VSCGPKQSQETLRTALAMGVDRGIHVEVSGAEYEGLAPFHVSKIIAKLAQEEDVNLVILG 122

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQM AAL+ WPQATF S +K+ D+   VTREV  G  T++  LPAV+T 
Sbjct: 123 KQAIDDDCNQTGQMTAALLDWPQATFASEVKVEDSKMEVTREVDGGLETIQVSLPAVLTA 182

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK I KK  +D  +D++PR++ +R E+      G ++ +  
Sbjct: 183 DLRLNEPRYATLPNIMKAKKKPIAKKTPSDLGVDVSPRVETVRVEDPPVRDAGQKVENVE 242

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 243 ELVSKLK 249


>gi|114053151|ref|NP_001040123.1| electron-transfer-flavoprotein beta polypeptide [Bombyx mori]
 gi|87248127|gb|ABD36116.1| electron-transfer-flavoprotein beta polypeptide [Bombyx mori]
          Length = 253

 Score =  219 bits (557), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 166/246 (67%), Gaps = 4/246 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  K+R+K D SG+ T+  K SMNPFDEIA+EE+++++EK +A+EVI V
Sbjct: 3   RVLVGVKRVIDYAVKIRVKPDKSGVVTDGVKHSMNPFDEIAVEEAVRMKEKKLASEVIAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAGK 117
           S G  + +E L+ +LAMGADR I +E      +TL+P+ +AKIL ++ + E   +VI GK
Sbjct: 63  SCGPSQAQETLRTALAMGADRAIHVEVAGAEYDTLQPIHVAKILAKLSQDEKADLVIVGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D++SNQT QM AAL+ WPQ TF S I+  D    +TRE+  G   ++T +PAV++ D
Sbjct: 123 QAIDDDSNQTAQMTAALLDWPQGTFASKIEKTDGALTITREIDGGLEVIKTKIPAVLSAD 182

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LNEPRY +LPNI+KA+KK ++K  A D  +DL PR+KV+  E+    + G  +     
Sbjct: 183 LRLNEPRYATLPNIMKAKKKPLKKVSAKDLGVDLAPRIKVVSVEDPPVRQAGSIIPDVDT 242

Query: 238 LIEILK 243
           L+  LK
Sbjct: 243 LVAKLK 248


>gi|163800427|ref|ZP_02194328.1| putative electron transfer flavoprotein,beta subunit [Vibrio sp.
           AND4]
 gi|159175870|gb|EDP60664.1| putative electron transfer flavoprotein,beta subunit [Vibrio sp.
           AND4]
          Length = 249

 Score =  219 bits (557), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 166/245 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV IK VI+   KVR+K+D SG+ET N K++MNPF EIA+EE+++L+E GIA EV+V
Sbjct: 1   MKVLVAIKRVIDPYVKVRVKSDGSGVETNNVKMTMNPFCEIAVEEAVRLKECGIAEEVLV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+++LA+GADR I I  +   EPL++AK+L+ ++++E   +V+ GKQ+ 
Sbjct: 61  VSIGDASCQEQLRSALALGADRAIHINVDLPPEPLAVAKLLKAVMQQEQAKLVLLGKQSV 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQ  QMLAAL   PQ TFVS +K+     ++TRE+  G  T++  LPA+I+ DL L
Sbjct: 121 DTDNNQVAQMLAALTNRPQGTFVSEVKVEGETVLITREIDGGLETLKLDLPAIISTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +    A  F + +    +VL          G  L S ++L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLSVMTADCFGVSVERSQQVLEVMAPPVREAGEMLASVSELVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|166713454|ref|ZP_02244661.1| electron transfer flavoprotein beta subunit [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 248

 Score =  219 bits (557), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 110/245 (44%), Positives = 157/245 (64%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ T+  K+S NPFDEIALEE+L+LR+ G ATEV+V
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVVTDGVKLSPNPFDEIALEEALRLRDAGTATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            ++        L+N LAMGA+R I + ++  ++PL+ A+ L ++V+KE P +VI GKQ  
Sbjct: 61  ATLAPADAAAHLRNGLAMGANRAIHVVTDTAVQPLTAARALLKLVEKEQPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF   + + D  A VTREV  G  T+E  LPAV+T DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFAGKLVVADGKATVTREVDAGLETLEVDLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LP+I+KA+ K +E     D  +D    L    +       +G+ +    +L+ 
Sbjct: 181 NEPRFIKLPDIMKAKSKPLETLAFADLGVDAHDSLTTTHYAAPSKRSRGVMVKDAAELVA 240

Query: 241 ILKSK 245
            LK K
Sbjct: 241 ALKQK 245


>gi|301785113|ref|XP_002927967.1| PREDICTED: electron transfer flavoprotein subunit beta-like isoform
           1 [Ailuropoda melanoleuca]
          Length = 255

 Score =  218 bits (556), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 108/247 (43%), Positives = 164/247 (66%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           ++ LV +K VI++  K+R+K D +G+ T+  K SMNPF EIA+EE+++L+EK +  EVI 
Sbjct: 4   LRALVAVKRVIDFAVKIRVKPDKTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIA 63

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESN----ETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + +E ++ +LAMGADRGI +E +    + L PL +A++L ++ +KE   +++ G
Sbjct: 64  VSCGPTQCQETIRTALAMGADRGIHVEVSAAEADRLGPLQVARVLAKLAEKEKVDLLLLG 123

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQM A L+ WPQ TF S + +  +   V RE+  G  T+   LPAV+T 
Sbjct: 124 KQAIDDDCNQTGQMTAGLLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTA 183

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+IE  K TD  +DLT +L V+  E+      G+++ +T 
Sbjct: 184 DLRLNEPRYATLPNIMKAKKKKIEVIKPTDLGVDLTSKLSVVSVEDPPQRMAGVKVETTE 243

Query: 237 KLIEILK 243
            L+  L+
Sbjct: 244 DLVAKLR 250


>gi|298714226|emb|CBJ27362.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 258

 Score =  218 bits (556), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 107/257 (41%), Positives = 171/257 (66%), Gaps = 8/257 (3%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           M+++V +K V++Y  KVRI+ D +G+E +N K+SMNPF E A+EE+++L+E   A+EVI 
Sbjct: 1   MRVMVGVKRVVDYAVKVRIQPDKAGVELKNVKMSMNPFCENAMEEAVKLKETKAASEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGI------LIESNETLEPLSIAKILREIVKKENPIIVI 114
           VSIG    ++ L+ +LAMGADRG+       + +++ LEPL++A +L+++V+++   +V+
Sbjct: 61  VSIGPKAAKDTLRTALAMGADRGVHVMTDDAVRTDQGLEPLAVAGLLKKVVEEQKVDLVL 120

Query: 115 AGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIID--NHAIVTREVGHGTMTMETPLPA 172
            GKQ+ D + +QTG MLA ++ WPQATF + + +++      V RE   GT  +  PLPA
Sbjct: 121 LGKQSIDGDCSQTGPMLAGMLGWPQATFAAKVTVVEAGKQLEVERETDTGTQVLSVPLPA 180

Query: 173 VITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRL 232
           V+T DL LNEPRY +LPNI+KA+KK ++   A D  +DL PR  V+        + G+ +
Sbjct: 181 VVTADLRLNEPRYATLPNIMKAKKKTVDVLTAADMGVDLKPRTTVIEVVPPPVRQGGVIV 240

Query: 233 YSTTKLIEILKSKHDLL 249
            S  +LI+ LK++  +L
Sbjct: 241 ESVDELIDKLKTEAGVL 257


>gi|58580414|ref|YP_199430.1| electron transfer flavoprotein beta subunit [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|84622376|ref|YP_449748.1| electron transfer flavoprotein beta subunit [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|58425008|gb|AAW74045.1| electron transfer flavoprotein beta subunit [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|84366316|dbj|BAE67474.1| electron transfer flavoprotein beta subunit [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
          Length = 248

 Score =  218 bits (555), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 110/245 (44%), Positives = 156/245 (63%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ T+  K+S NPFDEIALEE+L+LR+ G ATEV+V
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVVTDGVKLSPNPFDEIALEEALRLRDAGTATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            ++        L+N LAMGA+R I + ++  ++PL+ A+ L ++V+KE P +VI GKQ  
Sbjct: 61  ATLAPADAAAHLRNGLAMGANRAIHVVTDTAVQPLTAARALLKLVEKEQPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF   + + D    VTREV  G  T+E  LPAVIT DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFAGKLTVADGKVTVTREVDAGLETLEVDLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LP+I+KA+ K +E     D  +D    L    +       +G+ +    +L+ 
Sbjct: 181 NEPRFIKLPDIMKAKSKPLETLAFADLGVDAHDSLTTTHYAAPSKRSRGVMVKDAAELVA 240

Query: 241 ILKSK 245
            LK K
Sbjct: 241 ALKQK 245


>gi|167841027|ref|ZP_02467711.1| electron transfer flavoprotein, beta subunit [Burkholderia
           thailandensis MSMB43]
          Length = 174

 Score =  218 bits (555), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 99/174 (56%), Positives = 133/174 (76%)

Query: 14  NTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLK 73
           N KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI VS+G  + +E L+
Sbjct: 1   NVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIAVSVGVAQAQETLR 60

Query: 74  NSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAA 133
            +LA+GADR IL+ESN+ ++PLS+AKIL+ +V KE P +VI GKQ  D++SNQTGQMLAA
Sbjct: 61  TALAIGADRAILVESNDEVQPLSVAKILKALVDKEQPQLVILGKQAIDDDSNQTGQMLAA 120

Query: 134 LMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYIS 187
           L   PQATF S + + D  A V REV  G  T+   LPAV+T DL LNEPRY++
Sbjct: 121 LANLPQATFASKVTVADGKATVAREVDGGAETLSLTLPAVVTTDLRLNEPRYVT 174


>gi|84370201|ref|NP_001033671.1| electron transfer flavoprotein subunit beta [Bos taurus]
 gi|91206619|sp|Q2TBV3|ETFB_BOVIN RecName: Full=Electron transfer flavoprotein subunit beta;
           Short=Beta-ETF
 gi|83638648|gb|AAI09604.1| Electron-transfer-flavoprotein, beta polypeptide [Bos taurus]
 gi|296477386|gb|DAA19501.1| electron transfer flavoprotein subunit beta [Bos taurus]
          Length = 255

 Score =  218 bits (554), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 108/247 (43%), Positives = 161/247 (65%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           ++ LV +K VI++  K+R+K D +G+ T+  K SMNPF EIA+EE+++L+EK +  E+I 
Sbjct: 4   LRALVAVKRVIDFAVKIRVKPDKTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEIIA 63

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + +E ++ +LAMGADRGI +E        L PL +A++L ++ +KE   +V+ G
Sbjct: 64  VSCGPAQCQETIRTALAMGADRGIHVEVPAAEANHLGPLQVARVLAKLAEKEKVDLVLLG 123

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQM A  + WPQ TF S + +  +   V RE+  G  T+   LPAV+T 
Sbjct: 124 KQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKIKVEREIDGGLETLRLKLPAVVTA 183

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+IE  KA D  +DLT +L V+  E+      G+++ +T 
Sbjct: 184 DLRLNEPRYATLPNIMKAKKKKIEVIKAGDLGVDLTSKLSVISVEDPPQRTAGVKVETTE 243

Query: 237 KLIEILK 243
            L+  LK
Sbjct: 244 DLVAKLK 250


>gi|207856290|ref|YP_002242941.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|206708093|emb|CAR32384.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
          Length = 249

 Score =  218 bits (554), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 110/246 (44%), Positives = 166/246 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V+++N ++RIK D+S ++  ++K+S+NPFDEIA+EE+++L+E+G+ +EV+V
Sbjct: 1   MKALVCVKQVVDHNVRIRIKRDHSDVDISDSKLSINPFDEIAVEEAVRLKERGLISEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+  V +VL+ +LA GADR I I +  +L PL +AK +  I + E P I++ GKQ  
Sbjct: 61  VSIGNTGVGDVLRTALAAGADRAIYILTKNSLTPLIVAKTITAITRNEKPDIILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQ GQMLAAL+  PQAT VS I I DN     REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDCNQVGQMLAALLDLPQATNVSEITISDNSLTAVREVDGGLETLNLSLPAVLTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PR ISLPN+IKA+KK +++       I+ + RL +++ +E    + G+ +     L++
Sbjct: 181 NTPRNISLPNVIKAKKKPVKEIDFDSLGINPSSRLTIIKVDEPARRKAGIIVPDINTLLD 240

Query: 241 ILKSKH 246
            LK++ 
Sbjct: 241 KLKNEE 246


>gi|167522677|ref|XP_001745676.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163776025|gb|EDQ89647.1| predicted protein [Monosiga brevicollis MX1]
          Length = 256

 Score =  218 bits (554), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 110/252 (43%), Positives = 168/252 (66%), Gaps = 4/252 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           + LV  K VI+Y  K+R+K D SG+ TE  K SMNPFDE+A+EE+++++E     EV+VV
Sbjct: 5   RALVGCKRVIDYAVKIRVKPDKSGVVTEGVKHSMNPFDELAVEEAVRMKEGKKLDEVVVV 64

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIESNET--LEPLSIAKILREIVKKENPIIVIAGKQT 119
           S G    ++VLK +LAMGADR I +  ++   LEPL +AKI  ++V++E P +V+ GKQ 
Sbjct: 65  SCGPKGAQDVLKTALAMGADRAIHVSYDQVDKLEPLGVAKIFAKLVQEETPDLVLLGKQA 124

Query: 120 TDNESNQTGQMLAALMRWPQATFVSNIKIIDN--HAIVTREVGHGTMTMETPLPAVITVD 177
            D+++NQT QML+ L+ W QATF   I + D+     V RE+  G  T++  LP+V++ D
Sbjct: 125 IDDDANQTAQMLSGLLDWSQATFAYKIDLADDGKQLTVVREIDGGLETIDVKLPSVVSTD 184

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LNEPRY +LPNI+KA+KK ++     +  +D++PRL++L   E  A   G+++ S  +
Sbjct: 185 LRLNEPRYATLPNIMKAKKKPMKTTTPEELGVDVSPRLELLSVAEPPARSAGIKVESVDE 244

Query: 238 LIEILKSKHDLL 249
           LI+ LK++  +L
Sbjct: 245 LIDKLKNEAKVL 256


>gi|158257194|dbj|BAF84570.1| unnamed protein product [Homo sapiens]
          Length = 255

 Score =  217 bits (553), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 109/247 (44%), Positives = 161/247 (65%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           +++LV +K VI+Y  K+R+K D +G+ T+  K SMNPF EIA+EE+++L+EK +  EVI 
Sbjct: 4   LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIA 63

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + +E ++ +LAMGADRGI +E      E L PL +A++L ++ +KE   +V+ G
Sbjct: 64  VSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLG 123

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ   ++ NQTGQM A  + WPQ TF S + +  +   V RE+  G  T+   LPAV+T 
Sbjct: 124 KQAIYDDCNQTGQMTAGFLDWPQGTFASQVMLEGDKLKVEREIDGGLETLRLKLPAVVTA 183

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+IE  K  D  +DLT +L V+  E+      G+++ +T 
Sbjct: 184 DLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTE 243

Query: 237 KLIEILK 243
            L+  LK
Sbjct: 244 DLVAKLK 250


>gi|156362308|ref|XP_001625721.1| predicted protein [Nematostella vectensis]
 gi|156212567|gb|EDO33621.1| predicted protein [Nematostella vectensis]
          Length = 255

 Score =  217 bits (553), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 111/248 (44%), Positives = 171/248 (68%), Gaps = 4/248 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           +++LV  K VI+Y  K+R+K D +G+ T+  K SMNPFDEIA+EE+++L+EK IA+E++ 
Sbjct: 4   LRVLVGCKRVIDYAVKIRVKPDKTGVVTDGVKHSMNPFDEIAVEEAVRLKEKKIASEIVA 63

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  K EE L+ +LAMGADRG+ +    +  E L+PL++AK+L ++V++E P +VI G
Sbjct: 64  VSCGPAKSEETLRTALAMGADRGVHVVLGDKEYEGLQPLAVAKLLAKVVEQEQPGLVILG 123

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQT QML+A++ WPQA + S ++  D    V RE+  G  T+   LP V++ 
Sbjct: 124 KQAIDDDCNQTSQMLSAILNWPQAMYASKLEPKDGKLDVVREIDGGLETITVKLPCVVST 183

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+I+KK   D  +D+TPR+++L  ++      G+++ +  
Sbjct: 184 DLRLNEPRYATLPNIMKAKKKKIDKKTPEDLGVDVTPRIQILNVQDPPVREAGIKVETVD 243

Query: 237 KLIEILKS 244
            L+  LK 
Sbjct: 244 DLVAKLKD 251


>gi|46136079|ref|XP_389731.1| hypothetical protein FG09555.1 [Gibberella zeae PH-1]
          Length = 258

 Score =  217 bits (553), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 112/250 (44%), Positives = 166/250 (66%), Gaps = 7/250 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREK----GIAT 56
           ++ILVP+K VI+Y  K R+    +G+E    K SMNPFDE+++EES+++REK    G   
Sbjct: 4   LRILVPVKRVIDYAVKPRVNKSQTGVEKAGVKHSMNPFDELSVEESVRIREKKRAPGGVE 63

Query: 57  EVIVVSIGSCKVEEVLKNSLAMGADRGILIE--SNETLEPLSIAKILREIVKKENPIIVI 114
           ++ V+S G  K ++VL+ ++AMGADR I +E    E +EPL++AK+L++ V+++   +V+
Sbjct: 64  DICVISAGPPKAQDVLRTAMAMGADRAIHVELKEGEEIEPLTVAKLLQKAVEQQKSNLVV 123

Query: 115 AGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAI-VTREVGHGTMTMETPLPAV 173
            GKQ+ D+++NQTGQMLA L+ WPQAT  S ++   N  + VT+EV  G  T+   LP +
Sbjct: 124 LGKQSIDDDANQTGQMLAGLLGWPQATQASKVEFGANDEVTVTKEVDGGVETVRAKLPMI 183

Query: 174 ITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLY 233
           IT DL LNEPRY SLPNI+KA+KK ++K K  DF +D   RLK L+  E  A + G ++ 
Sbjct: 184 ITTDLRLNEPRYASLPNIMKAKKKNLQKTKLEDFGLDGVNRLKTLKVVEPPARQGGGKVE 243

Query: 234 STTKLIEILK 243
               L+  LK
Sbjct: 244 DVGGLVSKLK 253


>gi|167550441|ref|ZP_02344198.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|168236795|ref|ZP_02661853.1| electron transfer flavoprotein subunit beta (beta-etf) [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|168263629|ref|ZP_02685602.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|168819986|ref|ZP_02831986.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|194736689|ref|YP_002113947.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|198245349|ref|YP_002214821.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|204930045|ref|ZP_03221066.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|194712191|gb|ACF91412.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197290084|gb|EDY29441.1| electron transfer flavoprotein subunit beta (beta-etf) [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|197939865|gb|ACH77198.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|204321039|gb|EDZ06240.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205324592|gb|EDZ12431.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|205343245|gb|EDZ30009.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|205347840|gb|EDZ34471.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
          Length = 249

 Score =  217 bits (553), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 110/246 (44%), Positives = 166/246 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V+++N ++RIK D+S ++  ++K+S+NPFDEIA+EE+++L+E+G+ +EV+V
Sbjct: 1   MKALVCVKQVVDHNVRIRIKQDHSDVDISDSKLSINPFDEIAVEEAVRLKERGLISEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+  V +VL+ +LA GADR I I +  +L PL +AK +  I + E P I++ GKQ  
Sbjct: 61  VSIGNTGVGDVLRTALAAGADRAIHILTKNSLTPLIVAKTITAITRNEKPDIILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQ GQMLAAL+  PQAT VS I I DN     REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDCNQVGQMLAALLDLPQATNVSEITISDNSLTAVREVDGGLETLNLSLPAVLTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PR ISLPN+IKA+KK +++       I+ + RL +++ +E    + G+ +     L++
Sbjct: 181 NTPRNISLPNVIKAKKKPVKEIDFDSLGINPSSRLTIIKVDEPARRKAGIIVPDINTLLD 240

Query: 241 ILKSKH 246
            LK++ 
Sbjct: 241 KLKNEE 246


>gi|161614885|ref|YP_001588850.1| hypothetical protein SPAB_02639 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167992103|ref|ZP_02573201.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168240732|ref|ZP_02665664.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168466469|ref|ZP_02700331.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|194443754|ref|YP_002040096.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194447896|ref|YP_002044886.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|197265846|ref|ZP_03165920.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|200389545|ref|ZP_03216156.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|161364249|gb|ABX68017.1| hypothetical protein SPAB_02639 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402417|gb|ACF62639.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194406200|gb|ACF66419.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|195630919|gb|EDX49505.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|197244101|gb|EDY26721.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|199601990|gb|EDZ00536.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|205329584|gb|EDZ16348.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205340280|gb|EDZ27044.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|312911879|dbj|BAJ35853.1| putative electron transfer flavoprotein beta subunit [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           T000240]
 gi|321226436|gb|EFX51487.1| Electron transfer flavoprotein, beta subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
          Length = 249

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 110/246 (44%), Positives = 166/246 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V+++N ++RIK D+S ++  ++K+S+NPFDEIA+EE+++L+E+G+ +EV+V
Sbjct: 1   MKALVCVKQVVDHNVRIRIKRDHSDVDISDSKLSINPFDEIAVEEAVRLKERGLISEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+  V +VL+ +LA GADR I I +  +L PL +AK +  I + E P I++ GKQ  
Sbjct: 61  VSIGNTGVGDVLRTALAAGADRAIHILTKNSLTPLIVAKTITAITRNEKPDIILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQ GQMLAAL+  PQAT VS I I DN     REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDCNQVGQMLAALLDLPQATNVSEITISDNSLTAVREVDGGLETLNLSLPAVLTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PR ISLPN+IKA+KK +++       I+ + RL +++ +E    + G+ +     L++
Sbjct: 181 NTPRNISLPNVIKAKKKPVKEIDFDSLGINPSSRLTIIKVDEPARRKAGIIVPDINTLLD 240

Query: 241 ILKSKH 246
            LK++ 
Sbjct: 241 KLKNEE 246


>gi|149911156|ref|ZP_01899781.1| electron transfer flavoprotein beta-subunit [Moritella sp. PE36]
 gi|149805757|gb|EDM65754.1| electron transfer flavoprotein beta-subunit [Moritella sp. PE36]
          Length = 250

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 164/246 (66%), Gaps = 1/246 (0%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V+++   VR+K D +GIET N K+ +NPF EIA+E++++ +E+G A EV++
Sbjct: 1   MKILVAVKRVVDHKVNVRVKTDETGIETANVKMVINPFCEIAIEQAVRFKEQGSADEVVL 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V IG  + E  L+  LA+ ADR ILI ++E ++ L +AK+L ++V+++ P +V+ GKQ  
Sbjct: 61  VCIGPKEAEVQLRAGLALDADRAILIRTDEEVQSLDVAKLLHKVVQEQLPDLVLLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIK-IIDNHAIVTREVGHGTMTMETPLPAVITVDLN 179
           D ++NQTGQMLAAL   PQ TF S+I  I+ N   VTREV  G +T+   LPAVITVDL 
Sbjct: 121 DTDNNQTGQMLAALTNMPQGTFASDIVFIVPNKVKVTREVDGGLVTLALNLPAVITVDLR 180

Query: 180 LNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLI 239
           LN PRY SLPNI+KA++K I         + L+PRL  L+ E     + G+++     L+
Sbjct: 181 LNTPRYASLPNIMKAKRKIITMVSPDSLGVSLSPRLTTLKVESPPVRQAGVKVADVADLV 240

Query: 240 EILKSK 245
           + L+ +
Sbjct: 241 DKLQQQ 246


>gi|224090825|ref|XP_002334993.1| predicted protein [Populus trichocarpa]
 gi|222832520|gb|EEE70997.1| predicted protein [Populus trichocarpa]
          Length = 195

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 144/196 (73%), Gaps = 4/196 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKI+V IK V++Y  K+R+K+D SG+ET+N K+SMNPF EIALEE+L++++ G+A+EV+ 
Sbjct: 1   MKIMVAIKRVVDYAVKIRVKSDKSGVETQNVKMSMNPFCEIALEEALRIKQSGLASEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  +  + L+  LAMGADRGI +ES   L PL++AK+L+ +V+ E P ++I GKQ  
Sbjct: 61  VSMGPTQCVDTLRTGLAMGADRGIHVESTAALFPLTVAKLLKALVEVEKPGLIILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNH---AIVTREVGHGTMTMETPLPAVITVD 177
           D++ NQTGQM+A L+ WPQ TF S + ++D     A V REV  G  T+   LPAVIT D
Sbjct: 121 DDDCNQTGQMVAGLLGWPQGTFASKV-LLDTEKQVATVEREVDGGLETLCLDLPAVITTD 179

Query: 178 LNLNEPRYISLPNIIK 193
           L LN+PRY +LPNIIK
Sbjct: 180 LRLNQPRYATLPNIIK 195


>gi|323450841|gb|EGB06720.1| hypothetical protein AURANDRAFT_28553 [Aureococcus anophagefferens]
          Length = 255

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 109/251 (43%), Positives = 161/251 (64%), Gaps = 6/251 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           M++LV +K VI+Y  +VR+  D SG+E  N K+SMNPF EIA EE++QL+EK +A+EV+ 
Sbjct: 1   MRVLVGVKRVIDYAVRVRVAGDKSGVELANVKMSMNPFCEIACEEAIQLKEKKVASEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIES----NETLEPLSIAKILREIVKKENPIIVIAG 116
           VSIG  + +E L+++LAMG DR I + +    ++ L PL++A++L ++V  E P +VI G
Sbjct: 61  VSIGPKQAQETLRSALAMGCDRAIHVATDLRLDQELNPLAVARLLAKVVADEQPDLVIVG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAI--VTREVGHGTMTMETPLPAVI 174
           KQ+ D ++  TG MLA L+ W QATF +   +  + A   V RE   GT  ++  LP V+
Sbjct: 121 KQSIDGDNGTTGPMLAELLGWSQATFAAKFDVAGDGATAEVERETDTGTEVVKVKLPTVL 180

Query: 175 TVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYS 234
           T DL LN PRY  LPNI+KA+KK +E K A D+ +DL P + V       A   G+ + S
Sbjct: 181 TADLRLNTPRYPKLPNIMKAKKKPLESKDAADYGVDLAPSIVVEAVASPEARAAGITVDS 240

Query: 235 TTKLIEILKSK 245
              L++ LK++
Sbjct: 241 VDTLVDKLKNE 251


>gi|322616329|gb|EFY13238.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315996572]
 gi|322619579|gb|EFY16454.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-1]
 gi|322622725|gb|EFY19570.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-3]
 gi|322628637|gb|EFY25424.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-4]
 gi|322631574|gb|EFY28330.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-1]
 gi|322637101|gb|EFY33804.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-2]
 gi|322641699|gb|EFY38335.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str. 531954]
 gi|322644507|gb|EFY41047.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322648440|gb|EFY44892.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           OH_2009072675]
 gi|322654175|gb|EFY50498.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322658090|gb|EFY54357.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str. 19N]
 gi|322663564|gb|EFY59766.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           81038-01]
 gi|322670300|gb|EFY66440.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MD_MDA09249507]
 gi|322671536|gb|EFY67658.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str. 414877]
 gi|322676892|gb|EFY72959.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str. 366867]
 gi|322682817|gb|EFY78836.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str. 413180]
 gi|322686496|gb|EFY82478.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str. 446600]
 gi|323194607|gb|EFZ79800.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           609458-1]
 gi|323196803|gb|EFZ81947.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           556150-1]
 gi|323204815|gb|EFZ89810.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str. 609460]
 gi|323208957|gb|EFZ93894.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           507440-20]
 gi|323213942|gb|EFZ98712.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str. 556152]
 gi|323215206|gb|EFZ99951.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB101509-0077]
 gi|323222432|gb|EGA06808.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB102109-0047]
 gi|323227532|gb|EGA11692.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB110209-0055]
 gi|323229884|gb|EGA14007.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB111609-0052]
 gi|323233109|gb|EGA17205.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009083312]
 gi|323240844|gb|EGA24886.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009085258]
 gi|323243161|gb|EGA27181.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315731156]
 gi|323248702|gb|EGA32630.1| putative electron transfer flavoprotein subunit beta [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323251704|gb|EGA35571.1| putative electron transfer flavoprotein subunit beta [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323257518|gb|EGA41206.1| putative electron transfer flavoprotein subunit beta [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323261481|gb|EGA45062.1| putative electron transfer flavoprotein subunit beta [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008284]
 gi|323267912|gb|EGA51391.1| putative electron transfer flavoprotein subunit beta [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323272021|gb|EGA55436.1| putative electron transfer flavoprotein subunit beta [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
          Length = 249

 Score =  216 bits (551), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 166/246 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V+++N ++RIK D+S ++  ++K+S+NPFDEIA+EE+++L+E+G+ +E++V
Sbjct: 1   MKALVCVKQVVDHNVRIRIKQDHSDVDISDSKLSINPFDEIAVEEAVRLKERGLISEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+  V +VL+ +LA GADR I I +  +L PL +AK +  I + E P I++ GKQ  
Sbjct: 61  VSIGNTGVGDVLRTALAAGADRAIHILTKNSLTPLIVAKTITAITRNEKPDIILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQ GQMLAAL+  PQAT VS I I DN     REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDCNQVGQMLAALLDLPQATNVSEITISDNSLTAVREVDGGLETLNLSLPAVLTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PR ISLPN+IKA+KK +++       I+ + RL +++ +E    + G+ +     L++
Sbjct: 181 NTPRNISLPNVIKAKKKPVKEIDFDSLGINPSSRLTIIKVDEPARRKAGIIVPDINTLLD 240

Query: 241 ILKSKH 246
            LK++ 
Sbjct: 241 KLKNEE 246


>gi|328550534|ref|NP_001192208.1| electron transfer flavoprotein subunit beta [Sus scrofa]
 gi|75053043|sp|Q6UAQ8|ETFB_PIG RecName: Full=Electron transfer flavoprotein subunit beta;
           Short=Beta-ETF
 gi|35384838|gb|AAQ84565.1| electron transfer flavoprotein beta subunit precursor [Sus scrofa]
          Length = 255

 Score =  216 bits (551), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 107/247 (43%), Positives = 160/247 (64%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           ++ LV +K VI++  K+R+K D +G+  +  K SMNPF EIA+EE+++L+EK +  EVI 
Sbjct: 4   LRALVAVKRVIDFAVKIRVKPDRTGVVMDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIA 63

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + +E ++ +LAMGADRGI +E        L PL +A++L ++ +KE   +V+ G
Sbjct: 64  VSCGPAQCQETIRTALAMGADRGIHVEVPAAEAHHLGPLQVARVLAKLAQKEKVDLVLLG 123

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQM A  + WPQ TF S + +  +   V RE+  G  T+   LPAV+T 
Sbjct: 124 KQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKVKVEREIDGGLETLRLKLPAVVTA 183

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+IE  KA D  +DLT +L V+  E+      G+++ +T 
Sbjct: 184 DLRLNEPRYATLPNIMKAKKKKIEVIKAGDLGVDLTSKLSVVSVEDPPQRVAGVKVETTE 243

Query: 237 KLIEILK 243
            L+  L+
Sbjct: 244 DLVAKLR 250


>gi|291242781|ref|XP_002741278.1| PREDICTED: electron-transfer-flavoprotein, beta polypeptide-like
           [Saccoglossus kowalevskii]
          Length = 255

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 114/248 (45%), Positives = 166/248 (66%), Gaps = 4/248 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           +++LV  K VI+Y  KVR++ D  G+ T+  K SMNPFDEIA+EE+++L+EK IA E++ 
Sbjct: 4   LRVLVGCKRVIDYAVKVRVRPDKLGVVTDGVKHSMNPFDEIAIEEAVRLKEKKIAKEIVA 63

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  K +E L+ +LAMGADR I +E      E + PL ++K+L ++ K E+  + I G
Sbjct: 64  VSCGPAKCQETLRTALAMGADRAIHVEIAEKEYEGIGPLQVSKMLAKLAKDEDANLFIVG 123

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQMLA+ + WPQATF S + + D    VTREV  G  T++  +P VIT 
Sbjct: 124 KQAIDDDCNQTGQMLASYLDWPQATFASEVVVEDGDLKVTREVDGGLETVKVKMPCVITA 183

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK + KKK  D  +D+TP ++VL+ ++      G+++ S  
Sbjct: 184 DLRLNEPRYATLPNIMKAKKKPMLKKKPADLGVDMTPHVEVLKVDDPPTREAGVKVESAE 243

Query: 237 KLIEILKS 244
           +L+  LK 
Sbjct: 244 ELVSKLKD 251


>gi|296234472|ref|XP_002762471.1| PREDICTED: electron transfer flavoprotein subunit beta-like
           [Callithrix jacchus]
          Length = 255

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 108/247 (43%), Positives = 160/247 (64%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           ++ LV +K VI+Y  K+R+K D +G+ T+  K SMNPF EIA+EE+++L+EK +  EVI 
Sbjct: 4   LRALVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLLKEVIA 63

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + + + + +LAMGADRGI +E      E L PL +A++L ++ +KE   +V+ G
Sbjct: 64  VSCGPAQCQVLFRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLG 123

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQM A  + WPQ TF S + +  +   V RE+  G  T+   LPAV+T 
Sbjct: 124 KQAIDDDCNQTGQMTAGFLDWPQGTFASQVTVEGDKLKVEREIDGGLETLRLKLPAVVTA 183

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+IE  K  D  +DLT +L V+  E+      G+++ +T 
Sbjct: 184 DLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRMAGVKVETTE 243

Query: 237 KLIEILK 243
            L+  L+
Sbjct: 244 DLVAKLR 250


>gi|153833118|ref|ZP_01985785.1| electron transfer flavoprotein, beta-subunit [Vibrio harveyi HY01]
 gi|148870548|gb|EDL69456.1| electron transfer flavoprotein, beta-subunit [Vibrio harveyi HY01]
          Length = 249

 Score =  216 bits (549), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 167/245 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV IK V++   KVR+K+D SG+ET N K++MNPF EIA+EE+++L+E G+A EV+V
Sbjct: 1   MKVLVAIKRVVDPYVKVRVKSDGSGVETNNVKMTMNPFCEIAVEEAVRLKESGVAEEVLV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+++LA+GADR I I+     EPL++AK+L+ ++++E   +V+ GKQ+ 
Sbjct: 61  VSIGDTSCQEQLRSALALGADRAIHIDVELPPEPLAVAKLLKAVMEQEQAQLVLLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQ  QMLAAL   PQ TF S +K+    A+VTRE+  G  T++  LPA+I+ DL L
Sbjct: 121 DTDNNQVAQMLAALTNRPQGTFASEVKVEGETALVTREIDGGLETLKLDLPAIISTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +       F + +    +VL      A + G  + S ++L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLSVMTPDFFDVSVERSQQVLEVMTPPARKAGEMVGSVSELVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|326622573|gb|EGE28918.1| putative electron transfer protein beta subunit [Salmonella
           enterica subsp. enterica serovar Dublin str. 3246]
          Length = 284

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 168/249 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V+++N ++RIK D+S ++  ++K+S+NPFDEIA+EE+++L+E+G+ +EV+V
Sbjct: 36  MKALVCVKQVVDHNVRIRIKQDHSDVDISDSKLSINPFDEIAVEEAVRLKERGLISEVVV 95

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+  V +VL+ +LA GADR I I +  +L PL +AK +  I + E P I++ GKQ  
Sbjct: 96  VSIGNTGVGDVLRTALAAGADRAIHILTKNSLTPLIVAKTITAITRNEKPDIILLGKQAI 155

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQ GQMLAAL+  PQAT VS I I DN     REV  G  T+   LPAV+T DL L
Sbjct: 156 DDDCNQVGQMLAALLDLPQATNVSEITISDNSLTAVREVDGGLETLNLSLPAVLTTDLRL 215

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PR ISLPN+IKA+KK +++       I+ + RL +++ +E    + G+ +     L++
Sbjct: 216 NTPRNISLPNVIKAKKKPVKEIDFDSLGINPSSRLTIIKVDEPARRKAGIIVPDINTLLD 275

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 276 KLKNEEKVI 284


>gi|320085129|emb|CBY94916.1| Electron transfer flavoprotein subunit beta, mitochondrial
           Beta-ETF; Flags: Precursor [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
          Length = 279

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 168/249 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V+++N ++RIK D+S ++  ++K+S+NPFDEIA+EE+++L+E+G+ +EV+V
Sbjct: 31  MKALVCVKQVVDHNVRIRIKQDHSDVDISDSKLSINPFDEIAVEEAVRLKERGLISEVVV 90

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+  V +VL+ +LA GADR I I +  +L PL +AK +  I + E P I++ GKQ  
Sbjct: 91  VSIGNTGVGDVLRTALAAGADRAIHILTKNSLTPLIVAKTITAITRNEKPDIILLGKQAI 150

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQ GQMLAAL+  PQAT VS I I DN     REV  G  T+   LPAV+T DL L
Sbjct: 151 DDDCNQVGQMLAALLDLPQATNVSEITISDNSLTAVREVDGGLETLNLSLPAVLTTDLRL 210

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PR ISLPN+IKA+KK +++       I+ + RL +++ +E    + G+ +     L++
Sbjct: 211 NTPRNISLPNVIKAKKKPVKEIDFDSLGINPSSRLTIIKVDEPARRKAGIIVPDINTLLD 270

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 271 KLKNEEKVI 279


>gi|330829956|ref|YP_004392908.1| electron transfer flavoprotein subunit beta [Aeromonas veronii
           B565]
 gi|328805092|gb|AEB50291.1| Electron transfer flavoprotein beta-subunit [Aeromonas veronii
           B565]
          Length = 255

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 109/254 (42%), Positives = 170/254 (66%), Gaps = 5/254 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV IK V++YN K+R+K D S +E  N K+ +NPF EIA+EE ++LRE G+A+E++V
Sbjct: 1   MKLLVAIKRVVDYNVKIRVKGDGSDVELANVKMGINPFCEIAVEEGVRLREAGVASELVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRG---ILIES--NETLEPLSIAKILREIVKKENPIIVIA 115
           V+ G     E L++ LA+GADR    I  ES  +ETL PL++A+ LR++ ++E P +V+ 
Sbjct: 61  VTFGPDAAAEQLRHGLALGADRALHYITGESVTDETLTPLTVARALRKVCEQEQPDLVLL 120

Query: 116 GKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVIT 175
           GKQ+ D+++NQ  QMLAAL  WP AT  S +K+     +VTRE+  G  T+  PLPAV++
Sbjct: 121 GKQSIDSDNNQVAQMLAALNDWPLATCASALKVEAGELLVTREIDGGLETLGMPLPAVVS 180

Query: 176 VDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYST 235
            DL LNEPR+ SLPNI+KA++K ++    +  A+++  + ++L      A   G+++ S 
Sbjct: 181 ADLRLNEPRFASLPNIMKAKRKPLDSAPFSTLAVEVANQTRLLGVMAPPARSAGIKVGSV 240

Query: 236 TKLIEILKSKHDLL 249
            +L++ LK +  +L
Sbjct: 241 DELVDKLKHEAKVL 254


>gi|261246111|emb|CBG23914.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           D23580]
          Length = 284

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 168/249 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V+++N ++RIK D+S ++  ++K+S+NPFDEIA+EE+++L+E+G+ +EV+V
Sbjct: 36  MKALVCVKQVVDHNVRIRIKRDHSDVDISDSKLSINPFDEIAVEEAVRLKERGLISEVVV 95

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+  V +VL+ +LA GADR I I +  +L PL +AK +  I + E P I++ GKQ  
Sbjct: 96  VSIGNTGVGDVLRTALAAGADRAIHILTKNSLTPLIVAKTITAITRNEKPDIILLGKQAI 155

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQ GQMLAAL+  PQAT VS I I DN     REV  G  T+   LPAV+T DL L
Sbjct: 156 DDDCNQVGQMLAALLDLPQATNVSEITISDNSLTAVREVDGGLETLNLSLPAVLTTDLRL 215

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PR ISLPN+IKA+KK +++       I+ + RL +++ +E    + G+ +     L++
Sbjct: 216 NTPRNISLPNVIKAKKKPVKEIDFNSLGINPSSRLTIIKVDEPARRKAGIIVPDINTLLD 275

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 276 KLKNEEKVI 284


>gi|224582668|ref|YP_002636466.1| electron transfer flavoprotein beta subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|224467195|gb|ACN45025.1| putative electron transfer flavoprotein beta subunit [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
          Length = 254

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 110/246 (44%), Positives = 165/246 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V+++N ++RIK D+S ++  ++K+S+NPFDEIA+EE+++L+E+G+ +EV+V
Sbjct: 6   MKALVCVKQVVDHNVRIRIKRDHSDVDISDSKLSINPFDEIAVEEAVRLKERGLISEVVV 65

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+  V +VL  +LA GADR I I +  +L PL +AK +  I + E P I++ GKQ  
Sbjct: 66  VSIGNTGVGDVLCTALAAGADRAIHILTKNSLTPLIVAKTITAITRNEKPDIILLGKQAI 125

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQ GQMLAAL+  PQAT VS I I DN     REV  G  T+   LPAV+T DL L
Sbjct: 126 DDDCNQVGQMLAALLDLPQATNVSEITISDNSLTAVREVDGGLETLNLSLPAVLTTDLRL 185

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PR ISLPN+IKA+KK +++       I+ + RL +++ +E    + G+ +     L++
Sbjct: 186 NTPRNISLPNVIKAKKKPVKEIDFDSLGINPSSRLTIIKVDEPARRKAGIIVPDINTLLD 245

Query: 241 ILKSKH 246
            LK++ 
Sbjct: 246 KLKNEE 251


>gi|16764217|ref|NP_459832.1| electron transfer protein beta subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|62179418|ref|YP_215835.1| putative electron transfer flavoprotein beta subunit [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|205352108|ref|YP_002225909.1| electron transfer flavoprotein subunit beta [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|16419362|gb|AAL19791.1| putative electron transfer flavoprotein beta subunit [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|62127051|gb|AAX64754.1| putative electron transfer flavoprotein beta subunit [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|205271889|emb|CAR36729.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|267992614|gb|ACY87499.1| putative electron transfer protein beta subunit [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           14028S]
 gi|301157439|emb|CBW16928.1| putative electron transfer flavoprotein (beta subunit) [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           SL1344]
 gi|322713888|gb|EFZ05459.1| putative electron transfer protein beta subunit [Salmonella
           enterica subsp. enterica serovar Choleraesuis str. A50]
 gi|323129162|gb|ADX16592.1| putative electron transfer protein beta subunit [Salmonella
           enterica subsp. enterica serovar Typhimurium str. 4/74]
 gi|326627150|gb|EGE33493.1| putative electron transfer protein beta subunit [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 9]
 gi|332987786|gb|AEF06769.1| putative electron transfer protein beta subunit [Salmonella
           enterica subsp. enterica serovar Typhimurium str. UK-1]
          Length = 284

 Score =  215 bits (547), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 168/249 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V+++N ++RIK D+S ++  ++K+S+NPFDEIA+EE+++L+E+G+ +EV+V
Sbjct: 36  MKALVCVKQVVDHNVRIRIKRDHSDVDISDSKLSINPFDEIAVEEAVRLKERGLISEVVV 95

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG+  V +VL+ +LA GADR I I +  +L PL +AK +  I + E P I++ GKQ  
Sbjct: 96  VSIGNTGVGDVLRTALAAGADRAIHILTKNSLTPLIVAKTITAITRNEKPDIILLGKQAI 155

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQ GQMLAAL+  PQAT VS I I DN     REV  G  T+   LPAV+T DL L
Sbjct: 156 DDDCNQVGQMLAALLDLPQATNVSEITISDNSLTAVREVDGGLETLNLSLPAVLTTDLRL 215

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PR ISLPN+IKA+KK +++       I+ + RL +++ +E    + G+ +     L++
Sbjct: 216 NTPRNISLPNVIKAKKKPVKEIDFDSLGINPSSRLTIIKVDEPARRKAGIIVPDINTLLD 275

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 276 KLKNEEKVI 284


>gi|323304796|gb|EGA58555.1| YGR207C-like protein [Saccharomyces cerevisiae FostersB]
          Length = 261

 Score =  214 bits (546), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 168/250 (67%), Gaps = 7/250 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREK--GIATEV 58
           ++ILVP+K V+++  K R+    +GIET   K S+NPFD+IA+EE+++++EK   +    
Sbjct: 7   LRILVPVKRVVDFQIKPRVNKTLTGIETSGIKFSINPFDDIAVEEAIRIKEKNKSLVEST 66

Query: 59  IVVSIGSCKVEEVLKNSLAMGADRGILIES--NETLEPLSIAKILREIVKKENPIIVIAG 116
             VSIGS K +++L+N LA G D   LI+S   E +EPL+IAKIL+ +V+K+   +V+ G
Sbjct: 67  HAVSIGSAKAQDILRNCLAKGIDTCSLIDSVGKENIEPLAIAKILKAVVEKKGSNLVLMG 126

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAI-VTREVGHGTMTMETPLPAVIT 175
           KQ  D++ N TGQMLA L+ WPQAT  + +K +DN  + VTRE+  G   +E  LP VIT
Sbjct: 127 KQAIDDDCNNTGQMLAGLLNWPQATNAAKVKFLDNGKVQVTREIDDGEEVIEASLPMVIT 186

Query: 176 VDLNLNEPRYISLPNIIKARKKRIEKKK-ATDFA-IDLTPRLKVLRFEENRAERKGLRLY 233
            DL LN PRY+ LP ++KA+KK IEK   A DF  I++ P+LK++  EE + +  G++L 
Sbjct: 187 TDLRLNTPRYVGLPKLMKAKKKPIEKLDIAKDFPEINIEPQLKIVSMEEPKTKSPGVKLN 246

Query: 234 STTKLIEILK 243
           S  +LIE LK
Sbjct: 247 SVDELIEKLK 256


>gi|302848366|ref|XP_002955715.1| hypothetical protein VOLCADRAFT_96652 [Volvox carteri f.
           nagariensis]
 gi|300258908|gb|EFJ43140.1| hypothetical protein VOLCADRAFT_96652 [Volvox carteri f.
           nagariensis]
          Length = 263

 Score =  214 bits (546), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 111/263 (42%), Positives = 164/263 (62%), Gaps = 14/263 (5%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV IK VI+Y   VR+K D SG+E    K+SMNPF EIALEE+++L+EKG+A EV+ 
Sbjct: 1   MKVLVAIKRVIDYAVPVRVKPDKSGVEALIPKMSMNPFCEIALEEAVRLKEKGVAGEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADR---------GILIESNETLEPLSIAKILREIVKKENPI 111
           VS+G    +E L+ +LAMGADR         G+  +  E  +PL +A++L  + K+EN  
Sbjct: 61  VSLGPQHFQETLRTALAMGADRAVHVSSEACGLSAQGGEQPQPLGVARVLAALAKRENAG 120

Query: 112 IVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKII--DNHAIVTREVGHGTMTMETP 169
           +V+ GKQ  D++ NQTGQM+A L+ WPQATF S ++    D    VTREV  G   +  P
Sbjct: 121 LVLLGKQAIDDDCNQTGQMVAGLLGWPQATFASKLEAAKGDPRVRVTREVDGGLEVLSLP 180

Query: 170 LPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDF---AIDLTPRLKVLRFEENRAE 226
           LPAV++ DL LN PR+++LP +++A+K+ IE          A D+ P+L+ +  EE    
Sbjct: 181 LPAVVSADLRLNTPRFVTLPAMMRAKKRPIESATLEQLGLSAADVAPQLRTVVVEEPPRR 240

Query: 227 RKGLRLYSTTKLIEILKSKHDLL 249
           + G R+    +L+  L+ +  +L
Sbjct: 241 KAGSRVADVGELVRRLREEARVL 263


>gi|188578649|ref|YP_001915578.1| electron transfer flavoprotein beta subunit [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|188523101|gb|ACD61046.1| electron transfer flavoprotein beta subunit [Xanthomonas oryzae pv.
           oryzae PXO99A]
          Length = 248

 Score =  214 bits (546), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 109/245 (44%), Positives = 155/245 (63%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV  K V++YN ++++K D SG+ T+  K+S NPFDEIALEE+L+LR+ G ATEV+V
Sbjct: 1   MKILVAYKRVVDYNVRIQVKPDGSGVVTDGVKLSPNPFDEIALEEALRLRDAGTATEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            ++        L+N LAMGA+R I + ++  ++ L+ A+ L ++V+KE P +VI GKQ  
Sbjct: 61  ATLAPADAAAHLRNGLAMGANRAIHVVTDTAVQALTAARALLKLVEKEQPDLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLA L   PQATF   + + D    VTREV  G  T+E  LPAVIT DL L
Sbjct: 121 DDDANQTGQMLATLWGRPQATFAGKLTVADGKVTVTREVDAGLETLEVDLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LP+I+KA+ K +E     D  +D    L    +       +G+ +    +L+ 
Sbjct: 181 NEPRFIKLPDIMKAKSKPLETLAFADLGVDAHDSLTTTHYAAPSKRSRGVMVKDAAELVA 240

Query: 241 ILKSK 245
            LK K
Sbjct: 241 ALKQK 245


>gi|152995604|ref|YP_001340439.1| electron transfer flavoprotein subunit alpha/beta [Marinomonas sp.
           MWYL1]
 gi|150836528|gb|ABR70504.1| Electron transfer flavoprotein alpha/beta-subunit [Marinomonas sp.
           MWYL1]
          Length = 250

 Score =  214 bits (545), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 176/245 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K VI+YN KVR+K+D++ ++  N K+SMNPF EIA+EE+++L+EKG+A+EV+V
Sbjct: 1   MKILVSVKRVIDYNVKVRVKSDHTAVDLTNVKMSMNPFCEIAVEEAIRLKEKGVASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+GS   +E L+ ++A+GADR I +E+ + L+ LS+AK++ ++ ++E   +VI GKQ  
Sbjct: 61  VSVGSKSCQETLRTAMALGADRAIQVEAEDGLDSLSVAKLIAKVAQEEAADLVIMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQM+AAL+ +PQATF S + I +  A VTRE+  G  T+   LPAV+T DL L
Sbjct: 121 DSDNNQTGQMVAALLDYPQATFASEVVIENGEAQVTREIDGGLQTLAITLPAVVTTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+ SLPNI+KA+KK ++ K   D  +++   + ++          G+++ S  +L++
Sbjct: 181 NEPRFASLPNIMKAKKKPLDVKTPADLGVEVGSNVSIVSVTPPPQRAGGIKVGSVAELVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|167590237|ref|ZP_02382625.1| Electron transfer flavoprotein beta-subunit [Burkholderia ubonensis
           Bu]
          Length = 180

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 135/180 (75%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V + N KVR+K D SG++  N K+S+NPFDEIA+EE+++L+E G+ATE++ 
Sbjct: 1   MKVLVAVKRVADANVKVRVKADGSGVDLANIKMSINPFDEIAVEEAVRLKEAGVATEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+ +LA+GADR IL+ESN+++EPL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSVGVAQAQETLRTALAIGADRAILVESNDSVEPLAVAKVLKALVDKEQPQLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++SNQTGQMLAAL   PQATF S + I D  A V REV  G  T+   LPAV+T DL L
Sbjct: 121 DDDSNQTGQMLAALAGLPQATFASKVTIADGRATVAREVDGGAETLSLQLPAVVTTDLRL 180


>gi|269961918|ref|ZP_06176274.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269833366|gb|EEZ87469.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 266

 Score =  213 bits (543), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 168/245 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           +K+LV IK VI+   KVR+K++ SG+ET N K++MNPF EIA+EE+++L+E G+A EV+V
Sbjct: 18  VKVLVAIKRVIDPYVKVRVKSNGSGVETNNVKMTMNPFCEIAVEEAVRLKEAGVAEEVLV 77

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+++LA+GADR I I+  ++ EPL++AK+L+ ++++E   +V+ GKQ+ 
Sbjct: 78  VSIGDTSCQEQLRSALALGADRAIHIDVEQSPEPLAVAKLLKAVMEQEQAQLVLLGKQSI 137

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQ  QM+AAL   PQ TF S +K+     +VTRE+  G  T++  LPA+I+ DL L
Sbjct: 138 DTDNNQVAQMMAALTNRPQGTFASEVKVEGETVLVTREIDGGLETLKLDLPAIISTDLRL 197

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +       F + +    +VL      A + G  + S ++L++
Sbjct: 198 NEPRYASLPNIMKAKKKPLSVMTPDFFGVSVERSQQVLEVMTPPARKAGEMVGSVSELVD 257

Query: 241 ILKSK 245
            LK++
Sbjct: 258 KLKNE 262


>gi|321477010|gb|EFX87969.1| hypothetical protein DAPPUDRAFT_305476 [Daphnia pulex]
          Length = 254

 Score =  213 bits (543), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 113/248 (45%), Positives = 166/248 (66%), Gaps = 4/248 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           ++ILV +K VI+Y  K+R+K D SG+ TE  K SMNPFDEIA+EE+++++EK IA E++ 
Sbjct: 3   LRILVGVKRVIDYAVKIRVKPDKSGVITEGVKHSMNPFDEIAIEEAVRMKEKKIAKEIVA 62

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAG 116
            S G  + +E L+ +LAMGADRGI +E      +TL+PL I+K+L ++ K E   ++I G
Sbjct: 63  FSCGPAQCQETLRTALAMGADRGIHVEVAGPQFDTLQPLHISKMLAQLAKDEQIDLIIVG 122

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQT QM AAL+ WPQAT  S I+  D    V RE+  G  T++  LP V++ 
Sbjct: 123 KQAIDDDCNQTAQMTAALLDWPQATSASKIEAKDGSLQVVREIDGGLETIKVKLPTVVSA 182

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK I+K    D  +D++PR++V+  EE      G ++ +  
Sbjct: 183 DLRLNEPRYATLPNIMKAKKKPIKKLTPKDLGVDVSPRIEVVTVEEPPVRLAGAKVENVD 242

Query: 237 KLIEILKS 244
            ++E LK+
Sbjct: 243 MMVEKLKA 250


>gi|294140039|ref|YP_003556017.1| electron transfer flavoprotein subunit beta [Shewanella violacea
           DSS12]
 gi|293326508|dbj|BAJ01239.1| electron transfer flavoprotein, beta subunit [Shewanella violacea
           DSS12]
          Length = 249

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 166/245 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++ N KVR+  D + ++T N K+++NPF EIA+EE+++L+E G+ +E++V
Sbjct: 1   MKVLVPVKRVVDANVKVRVNADNTDVDTANLKMAINPFCEIAVEEAVRLKEAGVVSEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V++G    +E L+ ++A+GADRGI IE+ E L PLSIAK+L  + +KE   ++I GKQT 
Sbjct: 61  VTVGPKAAQEQLRTAMALGADRGIHIETEEALVPLSIAKLLNAVQEKEQAQLIILGKQTI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQMLAAL   PQATF S +K+  +   VTREV  G  ++  PLPAV+TVDL L
Sbjct: 121 DGDNNQTGQMLAALANMPQATFASEVKVEGDCLAVTREVDGGLQSISIPLPAVVTVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PRY  LPNI+KA++K +E     D  + L     VL+       + G+ + S  +L +
Sbjct: 181 NVPRYAKLPNIMKAKRKPLETLAIDDLGVSLKQHQTVLKVTPPAKRKAGVMVASVAELAD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|118788476|ref|XP_316741.3| AGAP004653-PA [Anopheles gambiae str. PEST]
 gi|116126229|gb|EAA11983.3| AGAP004653-PA [Anopheles gambiae str. PEST]
          Length = 254

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 167/247 (67%), Gaps = 4/247 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  K+R+K D SG+ TE  K SMNPFDEIA+EE+++L+EK IATEV+VV
Sbjct: 3   RVLVGVKRVIDYAVKIRVKPDKSGVVTEGVKHSMNPFDEIAVEEAVKLKEKKIATEVVVV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAGK 117
           S+G  + +EVL+ +LAMGADRGI +E      + L+P+ ++KIL ++ + E   +VI GK
Sbjct: 63  SVGPSQSQEVLRTALAMGADRGIHVEVAGKEFDLLQPIHVSKILAKLAQDEKADLVILGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D++ NQT QM AA++ WPQATF S ++   +   V REV  G  T++T +PAV++ D
Sbjct: 123 QAIDDDCNQTAQMTAAVLDWPQATFASKVEKEGDTLKVVREVDGGLETIKTKMPAVVSAD 182

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LN PRY +LPNI+KA+KK I+K    D  +D TPR++++  E+    + G  L     
Sbjct: 183 LRLNTPRYATLPNIMKAKKKPIKKLAPKDLGVDTTPRIEIVSIEDPPVRQAGSILPDVDT 242

Query: 238 LIEILKS 244
           L+  L+ 
Sbjct: 243 LLTKLRD 249


>gi|190406783|gb|EDV10050.1| electron transfer flavoprotein beta-subunit [Saccharomyces
           cerevisiae RM11-1a]
 gi|207344982|gb|EDZ71948.1| YGR207Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|256271490|gb|EEU06539.1| YGR207C-like protein [Saccharomyces cerevisiae JAY291]
 gi|259146709|emb|CAY79966.1| EC1118_1G1_5380p [Saccharomyces cerevisiae EC1118]
 gi|323333375|gb|EGA74771.1| YGR207C-like protein [Saccharomyces cerevisiae AWRI796]
 gi|323337492|gb|EGA78740.1| YGR207C-like protein [Saccharomyces cerevisiae Vin13]
 gi|323348464|gb|EGA82709.1| YGR207C-like protein [Saccharomyces cerevisiae Lalvin QA23]
 gi|323354868|gb|EGA86701.1| YGR207C-like protein [Saccharomyces cerevisiae VL3]
          Length = 261

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 114/250 (45%), Positives = 168/250 (67%), Gaps = 7/250 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREK--GIATEV 58
           ++ILVP+K V+++  K R+    +GIET   K S+NPFD+IA+EE+++++EK   +    
Sbjct: 7   LRILVPVKRVVDFQIKPRVNKTLTGIETSGIKFSINPFDDIAVEEAIRIKEKNKSLVEST 66

Query: 59  IVVSIGSCKVEEVLKNSLAMGADRGILIES--NETLEPLSIAKILREIVKKENPIIVIAG 116
             VSIGS K +++L+N LA G D   LI+S   E +EPL+IAKIL+ +V+K+   +V+ G
Sbjct: 67  HAVSIGSAKAQDILRNCLAKGIDTCSLIDSVGKENIEPLAIAKILKAVVEKKGSNLVLMG 126

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAI-VTREVGHGTMTMETPLPAVIT 175
           KQ  D++ N TGQMLA L+ WPQAT  + ++ +DN  + VTRE+  G   +E  LP VIT
Sbjct: 127 KQAIDDDCNNTGQMLAGLLNWPQATNAAKVEFLDNGKVQVTREIDDGEEVIEASLPMVIT 186

Query: 176 VDLNLNEPRYISLPNIIKARKKRIEKKK-ATDFA-IDLTPRLKVLRFEENRAERKGLRLY 233
            DL LN PRY+ LP ++KA+KK IEK   A DF  I++ P+LK++  EE + +  G++L 
Sbjct: 187 TDLRLNTPRYVGLPKLMKAKKKPIEKLDIAKDFPEINIEPQLKIVSMEEPKTKSPGVKLN 246

Query: 234 STTKLIEILK 243
           S  +LIE LK
Sbjct: 247 SVDELIEKLK 256


>gi|156976773|ref|YP_001447679.1| electron transfer flavoprotein subunit beta [Vibrio harveyi ATCC
           BAA-1116]
 gi|156528367|gb|ABU73452.1| hypothetical protein VIBHAR_05548 [Vibrio harveyi ATCC BAA-1116]
          Length = 249

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 165/245 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV IK V++   KVR+K+D SG+ET N K++MNPF EIA+EE+++L+E G+A EV+V
Sbjct: 1   MKVLVAIKRVVDPYVKVRVKSDGSGVETNNVKMTMNPFCEIAVEEAVRLKESGVAEEVLV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    +E L+++LA+GADR I I+     EPL +AK+L+ ++++E   +V+ GKQ+ 
Sbjct: 61  VSIGDTSCQEQLRSALALGADRAIHIDVELPPEPLVVAKLLKVVMEQEQAQLVLLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQ  QMLAAL   PQ TF S +K+    A VTRE+  G  T++  LPA+I+ DL L
Sbjct: 121 DTDNNQVAQMLAALTNRPQGTFASEVKVEGETAFVTREIDGGLETLKLDLPAIISTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +       F + +    +VL      A + G  + S ++L++
Sbjct: 181 NEPRYASLPNIMKAKKKPLSVMTPDFFDVSVERSQQVLEVMTPPARKAGEMVGSVSELVD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|73946970|ref|XP_533603.2| PREDICTED: similar to electron-transfer-flavoprotein, beta
           polypeptide isoform 1 isoform 1 [Canis familiaris]
          Length = 255

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 106/247 (42%), Positives = 159/247 (64%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           ++ LV +K VI++  K+R+K D  G+ T+  K SMNPF EIA+EE+++L+EK +  EVI 
Sbjct: 4   LRALVAVKRVIDFAVKIRVKPDKMGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIA 63

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + +E ++ +LAMGADRGI +E      + L PL +A++L ++ +KE   +++ G
Sbjct: 64  VSCGPAQCQETIRTALAMGADRGIHVEVPAAEADRLGPLQVARVLAKLAEKEKVDLLLLG 123

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQM A  + WPQ TF S + +  +   V REV  G  T+   LPAV+T 
Sbjct: 124 KQAIDDDCNQTGQMTAGFLDWPQGTFASQVTVEGDKLKVEREVDGGLETVRLKLPAVVTA 183

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+IE  K  D  +DLT +L ++  E+      G+++ +  
Sbjct: 184 DLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSIVSVEDPPQRTAGIKVETVE 243

Query: 237 KLIEILK 243
            L+  LK
Sbjct: 244 DLVAKLK 250


>gi|6321646|ref|NP_011723.1| Cir1p [Saccharomyces cerevisiae S288c]
 gi|1169560|sp|P42940|ETFB_YEAST RecName: Full=Probable electron transfer flavoprotein subunit beta;
           Short=Beta-ETF
 gi|790498|emb|CAA89000.1| electron-transferring flavoprotein beta chain [Saccharomyces
           cerevisiae]
 gi|1323371|emb|CAA97234.1| ETF-BETA [Saccharomyces cerevisiae]
 gi|45270646|gb|AAS56704.1| YGR207C [Saccharomyces cerevisiae]
 gi|151943484|gb|EDN61795.1| conserved protein [Saccharomyces cerevisiae YJM789]
 gi|285812401|tpg|DAA08301.1| TPA: Cir1p [Saccharomyces cerevisiae S288c]
          Length = 261

 Score =  213 bits (541), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 114/250 (45%), Positives = 168/250 (67%), Gaps = 7/250 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREK--GIATEV 58
           ++ILVP+K V+++  K R+    +GIET   K S+NPFD+IA+EE+++++EK   +    
Sbjct: 7   LRILVPVKRVVDFQIKPRVNKTLTGIETSGIKFSINPFDDIAVEEAIRIKEKNKSLVEST 66

Query: 59  IVVSIGSCKVEEVLKNSLAMGADRGILIES--NETLEPLSIAKILREIVKKENPIIVIAG 116
             VSIGS K +++L+N LA G D   LI+S   E +EPL+IAKIL+ +V+K+   +V+ G
Sbjct: 67  HAVSIGSAKAQDILRNCLAKGIDTCSLIDSVGKENIEPLAIAKILKAVVEKKGSNLVLMG 126

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAI-VTREVGHGTMTMETPLPAVIT 175
           KQ  D++ N TGQMLA L+ WPQAT  + ++ +DN  + VTRE+  G   +E  LP VIT
Sbjct: 127 KQAIDDDCNNTGQMLAGLLNWPQATNAAKVEFLDNGRVQVTREIDDGEEVIEASLPMVIT 186

Query: 176 VDLNLNEPRYISLPNIIKARKKRIEKKK-ATDFA-IDLTPRLKVLRFEENRAERKGLRLY 233
            DL LN PRY+ LP ++KA+KK IEK   A DF  I++ P+LK++  EE + +  G++L 
Sbjct: 187 TDLRLNTPRYVGLPKLMKAKKKPIEKLDIAKDFPEINIEPQLKIVSMEEPKTKSPGVKLN 246

Query: 234 STTKLIEILK 243
           S  +LIE LK
Sbjct: 247 SVDELIEKLK 256


>gi|161504463|ref|YP_001571575.1| hypothetical protein SARI_02576 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865810|gb|ABX22433.1| hypothetical protein SARI_02576 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 254

 Score =  213 bits (541), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 164/249 (65%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K V+++N ++RIK D+S ++  + K+S+NPFDEIA+EE+++L+E+G+ +E++ 
Sbjct: 6   MKVLVCVKQVVDHNVRIRIKQDHSDVDISDCKLSINPFDEIAVEEAVRLKERGVISEIVA 65

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG   V +VL+ +LA GADR I I + ++L+PL +AK +  I K E P I++ GKQ  
Sbjct: 66  VSIGYKGVGDVLRTALAYGADRAIHILTEKSLDPLIVAKTITAITKNEKPDIILLGKQAI 125

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D++ NQ GQMLAAL+  PQAT +S + + DN     RE+  G  T+   LPAV+T DL L
Sbjct: 126 DDDCNQVGQMLAALLDLPQATNISKVTVSDNLLTAVREIDGGAETLSLSLPAVLTTDLRL 185

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PR ISLPN IKA+KK +E+       I  + +L  ++ +E      G+ +   + L+ 
Sbjct: 186 NTPRNISLPNFIKAKKKTVEEINFDSLGISPSSKLTTIKVDEPATREAGIIVPDISTLLN 245

Query: 241 ILKSKHDLL 249
            LK++  ++
Sbjct: 246 KLKNEEKII 254


>gi|312090906|ref|XP_003146790.1| electron transfer flavoprotein beta-subunit [Loa loa]
 gi|307758046|gb|EFO17280.1| electron transfer flavoprotein beta-subunit [Loa loa]
          Length = 253

 Score =  213 bits (541), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 107/234 (45%), Positives = 156/234 (66%), Gaps = 5/234 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           M+ LV +K V++Y  K+R+K D SG+  +N + SMNPFDEIALEE+++L+EK I  EV+ 
Sbjct: 1   MRALVAVKRVVDYAIKIRVKPDKSGVIKQNVQHSMNPFDEIALEEAVRLKEKQIVKEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETL----EPLSIAKILREIVKKENPIIVIAG 116
           VS+GS K +E L+ +LA GADR I +E  E +    EPL +AKILR+I + E P +++ G
Sbjct: 61  VSLGSSKSQETLRTALAKGADRAIHVEVEEAMAEKIEPLLVAKILRKIAEAEKPDLILLG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNI-KIIDNHAIVTREVGHGTMTMETPLPAVIT 175
           KQ  D++  QT Q+LA L+ WPQA + S + +  D   IVTREV  G  ++    PAVI+
Sbjct: 121 KQAIDDDCGQTAQLLAGLLNWPQAMYASVVEQESDKTFIVTREVDGGRESIRIKTPAVIS 180

Query: 176 VDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKG 229
            DL LNEPRY +LPNI+KA+ K +EKK  +D+ +++  + ++L   E    + G
Sbjct: 181 ADLRLNEPRYATLPNIMKAKNKPLEKKTPSDYGVEVAQQTQILEVTEPPVRKSG 234


>gi|194745558|ref|XP_001955254.1| GF16327 [Drosophila ananassae]
 gi|190628291|gb|EDV43815.1| GF16327 [Drosophila ananassae]
          Length = 253

 Score =  212 bits (540), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 166/246 (67%), Gaps = 4/246 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  KVR+K D +G+ T+  K SMNPFDEIA+EE+++L+EK +ATEVI V
Sbjct: 3   RVLVGVKRVIDYAVKVRVKPDKTGVVTQGVKHSMNPFDEIAVEEAVKLKEKKLATEVIAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAGK 117
           S+G  + +EV++ +LAMGADRG+ +E      E L+P+ ++KIL ++   E   +VI GK
Sbjct: 63  SVGPTQSQEVIRTALAMGADRGVHVEVPAAEYELLQPIHVSKILAKLALDEKADLVILGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D+++NQT QM AA++ WPQ TF + I+  D    +TRE+  G  T++T  PAV++ D
Sbjct: 123 QAIDDDANQTAQMTAAVLDWPQGTFCNKIEKTDAGLTITREIDGGLETIKTKTPAVLSAD 182

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LN PRY +LPNI+KA+KK ++K  A D  +D TPR++V+  E+    + G  +     
Sbjct: 183 LRLNTPRYATLPNIMKAKKKPLKKVTAKDLGVDTTPRIEVVSVEDPPVRKAGATVADVDA 242

Query: 238 LIEILK 243
           L+  LK
Sbjct: 243 LVAKLK 248


>gi|226941826|ref|YP_002796900.1| electron transfer flavoprotein, beta subunit [Laribacter
           hongkongensis HLHK9]
 gi|226716753|gb|ACO75891.1| probable electron transfer flavoprotein, beta subunit [Laribacter
           hongkongensis HLHK9]
          Length = 215

 Score =  212 bits (540), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 149/215 (69%)

Query: 35  MNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEP 94
           MNPFDEIA+EE+++ +E G  +E++VVS+G  + EE L+ +LAMGADR + +E++  L+P
Sbjct: 1   MNPFDEIAVEEAVRQKEAGKVSEIVVVSLGVKQCEETLRTALAMGADRAVHVETDAELQP 60

Query: 95  LSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAI 154
           L++AK+L++IV KE P +V  GKQ  D++SNQTGQMLAALM   Q TF S + +      
Sbjct: 61  LAVAKLLKKIVDKEAPRLVFLGKQAIDDDSNQTGQMLAALMNVGQGTFASRVDLSAESVT 120

Query: 155 VTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPR 214
           VTRE+  G  T++  LPAV++VDL LNEPRY+ LPNI+ A+KK +EK    D  +D+ PR
Sbjct: 121 VTREIDGGLETVKLALPAVLSVDLRLNEPRYVKLPNIMAAKKKPLEKVSPADLGVDIAPR 180

Query: 215 LKVLRFEENRAERKGLRLYSTTKLIEILKSKHDLL 249
           LK L+  E      G+++ S  +L+  LK++  +L
Sbjct: 181 LKTLKVAEPAKRSAGVKVGSVAELVAKLKNEAKVL 215


>gi|221117102|ref|XP_002156937.1| PREDICTED: similar to electron-transfer-flavoprotein, beta
           polypeptide [Hydra magnipapillata]
          Length = 259

 Score =  212 bits (539), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 107/249 (42%), Positives = 163/249 (65%), Gaps = 4/249 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           +K+LV  K VI+Y  K+R+K D +GI T+  K SMNPFDEIA+EE+++L+EK IA E+I 
Sbjct: 4   LKVLVGCKRVIDYAVKIRVKPDKTGIVTDGVKHSMNPFDEIAVEEAIRLKEKNIANEIIA 63

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           +S G  K EE L+ +LAMG DRGI +    +  ETL+PL++AK++ ++ +     ++I G
Sbjct: 64  ISCGPAKNEETLRTALAMGMDRGIHVVVGDKDYETLQPLAVAKLIAKVAQDIKADLIILG 123

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQ+L+A+M  PQAT  S ++  +    V+REV  G   +   LP V+T 
Sbjct: 124 KQAIDDDCNQTGQLLSAIMNVPQATCTSKLEFNNGRLKVSREVDGGLENLSVKLPCVVTA 183

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPR+ +LPNI+KA+KK+I+  K  D A+D+ P ++ +   +      G+++    
Sbjct: 184 DLRLNEPRFATLPNIMKAKKKKIDVMKVDDLAVDIKPHIETVSVVDPPVRSAGIKVEDVD 243

Query: 237 KLIEILKSK 245
            LI+ LK +
Sbjct: 244 TLIKKLKEQ 252


>gi|170035148|ref|XP_001845433.1| electron transfer flavoprotein subunit beta [Culex
           quinquefasciatus]
 gi|167876985|gb|EDS40368.1| electron transfer flavoprotein subunit beta [Culex
           quinquefasciatus]
          Length = 254

 Score =  212 bits (539), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 108/232 (46%), Positives = 161/232 (69%), Gaps = 4/232 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  K+R+K D SG+ TE  K SMNPFDEIA+EE+++++EK +A+EV+ V
Sbjct: 3   RVLVGVKRVIDYAVKIRVKPDKSGVVTEGVKHSMNPFDEIAVEEAVKMKEKKLASEVVAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAGK 117
           S+G  + +EVL+ +LAMGADRGI IE      + L+P+ ++KIL ++ + E   +VI GK
Sbjct: 63  SVGPAQAQEVLRTALAMGADRGIHIEVTGKDYDLLQPIHVSKILAKLAQDEKADLVILGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D++ NQT QM AAL+ WPQAT+ S ++   +   V RE+  G  T++T +PAVI+ D
Sbjct: 123 QAIDDDCNQTAQMTAALLDWPQATYASKVEKTGDGLTVVREIDGGLETIKTTVPAVISAD 182

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKG 229
           L LN PRY +LPNI+KA+KK I+K    D  +D TPR++++  E+    + G
Sbjct: 183 LRLNTPRYATLPNIMKAKKKPIKKVAPKDLGVDTTPRIEIVSVEDPPVRQAG 234


>gi|187608475|ref|NP_001120179.1| hypothetical protein LOC100145220 [Xenopus (Silurana) tropicalis]
 gi|156230084|gb|AAI52230.1| Etfb protein [Danio rerio]
 gi|166797052|gb|AAI59288.1| LOC100145220 protein [Xenopus (Silurana) tropicalis]
          Length = 254

 Score =  212 bits (539), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 110/246 (44%), Positives = 165/246 (67%), Gaps = 4/246 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  K+R+K D++G+ T+  K SMNPF EIA+EE+ +L+EK +  EV+ V
Sbjct: 4   RVLVGVKRVIDYAVKIRVKPDHTGVVTDGVKHSMNPFCEIAVEEAGKLKEKKLIKEVVAV 63

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIESN----ETLEPLSIAKILREIVKKENPIIVIAGK 117
           S G  +V+E ++ +LAMGADRGI +E +    ETL PL ++KIL  + KKE   ++I GK
Sbjct: 64  SCGPQQVQETIRTALAMGADRGIHVEVSGKDYETLGPLQVSKILAALAKKEEASLIILGK 123

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D++ NQTGQM AAL+ WPQ TF S +    +   V RE+  G  T++  +PAV+T D
Sbjct: 124 QAIDDDCNQTGQMTAALLDWPQGTFASELAFEADKLKVVREIDGGLETIKIKMPAVVTAD 183

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LN PRY +LPNI+KA+K++I   K  D  +D++ RL+VL+ +E    + G+++ +   
Sbjct: 184 LRLNTPRYATLPNIMKAKKRKIAMVKPADLGVDVSSRLEVLKVDEPPTRQAGVKVETVED 243

Query: 238 LIEILK 243
           L+  LK
Sbjct: 244 LVGKLK 249


>gi|154283929|ref|XP_001542760.1| electron transfer flavoprotein beta-subunit [Ajellomyces capsulatus
           NAm1]
 gi|150410940|gb|EDN06328.1| electron transfer flavoprotein beta-subunit [Ajellomyces capsulatus
           NAm1]
          Length = 261

 Score =  211 bits (538), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 113/253 (44%), Positives = 165/253 (65%), Gaps = 10/253 (3%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLRE-KG--IATE 57
           ++ILVP+K VI++  K RI    +G+ET   K S+NPFDE+++EE+++LRE KG    ++
Sbjct: 4   LRILVPVKRVIDFAIKPRINKSQTGVETAGVKHSLNPFDELSIEEAVRLRERKGPMSVSD 63

Query: 58  VIVVSIGSCKVEEVLKNSLAMGADRGILIESNE-----TLEPLSIAKILREIVKKENPII 112
           ++ +S G  K  + L+ ++AMGADR I ++  E      LEPL++AK+L+ +V++EN  +
Sbjct: 64  ILAISAGGPKCVDTLRTAMAMGADRSIHVDIPEKPDQAGLEPLTVAKLLKNVVQRENINL 123

Query: 113 VIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIV--TREVGHGTMTMETPL 170
           V+ GKQ  D +  QTGQMLA L+ WPQAT  S + + D+  IV  TREV  G  T+   L
Sbjct: 124 VLLGKQAIDGDQGQTGQMLAGLLGWPQATQASKVDVKDDAGIVEVTREVDGGVETLRAKL 183

Query: 171 PAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGL 230
           P VIT DL LNEPRY SLPNI+KA++K +EKK   D+ ++ T RLK L+  E  A + G 
Sbjct: 184 PMVITTDLRLNEPRYASLPNIMKAKRKPLEKKTLADYEVEDTKRLKTLKVTEPPARQGGG 243

Query: 231 RLYSTTKLIEILK 243
           ++     +I  LK
Sbjct: 244 KVEDVDGMISKLK 256


>gi|117923837|ref|YP_864454.1| electron transfer flavoprotein beta-subunit [Magnetococcus sp.
           MC-1]
 gi|117607593|gb|ABK43048.1| electron transfer flavoprotein beta-subunit [Magnetococcus sp.
           MC-1]
          Length = 251

 Score =  211 bits (538), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 152/243 (62%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           M ILVPIK V +  T +R   D  G++  ++K  +NPFDEIALE +LQL+E G A +VI 
Sbjct: 1   MNILVPIKQVADPATPIRWYPDGGGVDASDSKAIINPFDEIALEAALQLKEAGHAQQVIC 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            SIG     + L+ +LA+GADR I +     LEPL IA++L ++V +++  +VIAGKQ  
Sbjct: 61  CSIGPECWNDALRTALAIGADRAIRLHGPADLEPLVIARLLAQVVNQQSCSLVIAGKQAV 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D + +Q GQ++A L+ W QATF +++ + D   +V RE   G   +  PLPAVIT DL L
Sbjct: 121 DQDDSQVGQLVAGLLGWSQATFAAHLAVADGELLVQRETDDGQERLSLPLPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N PRY SLPNI+KA++K +E+  A  F +DLTP+ + L+ +       G  + S   L  
Sbjct: 181 NTPRYASLPNIVKAKRKPLEQLDAAAFGVDLTPQWQRLQQQPPPMRPMGQWVDSVEALHA 240

Query: 241 ILK 243
           +L+
Sbjct: 241 MLR 243


>gi|163750391|ref|ZP_02157631.1| electron transfer flavoprotein, beta subunit [Shewanella benthica
           KT99]
 gi|161329881|gb|EDQ00867.1| electron transfer flavoprotein, beta subunit [Shewanella benthica
           KT99]
          Length = 249

 Score =  211 bits (537), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 165/245 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LVP+K V++ N KVR+  D + ++T N K+++NPF EIA+EE+++L+E G+ +E++V
Sbjct: 1   MKVLVPVKRVVDANVKVRVNADNTDVDTANLKMAINPFCEIAVEEAVRLKEAGVVSEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V++G    +E L+ ++A+GADRGI I++ E L PLSIAK+L  + KKE   ++I GKQT 
Sbjct: 61  VTVGPKAAQEQLRTAMALGADRGIHIQTEEALVPLSIAKLLNAVQKKEQAQLIILGKQTI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQTGQML+AL   PQATF S IK+  +   VTREV  G   +   LPAV+TVDL L
Sbjct: 121 DGDNNQTGQMLSALANMPQATFASEIKVDGDSLAVTREVDGGLQNVTISLPAVVTVDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  LPNI+KA++K +E     D  + L     VL+       + G+ + S  +L +
Sbjct: 181 NEPRYAKLPNIMKAKRKPLETLSIDDLGVSLKLHQTVLKVTPPAERKAGIMVASVAELAD 240

Query: 241 ILKSK 245
            LK++
Sbjct: 241 KLKNE 245


>gi|302895543|ref|XP_003046652.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256727579|gb|EEU40939.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 258

 Score =  211 bits (537), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 117/250 (46%), Positives = 170/250 (68%), Gaps = 7/250 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREK----GIAT 56
           ++ILVP+K VI+Y  K R+    +G+ET   K SMNPFDE+++EES+++REK    G   
Sbjct: 4   LRILVPVKRVIDYAVKPRVNKAQTGVETAGVKHSMNPFDELSVEESVRIREKKRAPGGVE 63

Query: 57  EVIVVSIGSCKVEEVLKNSLAMGADRGILIE--SNETLEPLSIAKILREIVKKENPIIVI 114
           ++ V+S G  K ++VL+ ++AMGADRGI +E    E LEPL++AK+LR+  +++   +V+
Sbjct: 64  DICVISAGPPKAQDVLRTAMAMGADRGIHVEIKDGEELEPLTVAKLLRQAAEQQKSNLVV 123

Query: 115 AGKQTTDNESNQTGQMLAALMRWPQATFVSNIKI-IDNHAIVTREVGHGTMTMETPLPAV 173
            GKQ+ D+++NQTGQMLA L+ WPQAT  S ++    +  IVT+EV  G  T++  LP V
Sbjct: 124 LGKQSIDDDANQTGQMLAGLLGWPQATQASKVEFGAGDEVIVTKEVDGGVETVKAKLPLV 183

Query: 174 ITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLY 233
           IT DL LNEPRY SLPNI+KA+KK++EK K +DF +D   RLKVL+  E    + G ++ 
Sbjct: 184 ITTDLRLNEPRYASLPNIMKAKKKKLEKVKLSDFGLDNEKRLKVLKVAEPPTRQGGGKVE 243

Query: 234 STTKLIEILK 243
               L+  LK
Sbjct: 244 DVGGLVSKLK 253


>gi|240273052|gb|EER36575.1| electron transfer flavoprotein beta-subunit [Ajellomyces capsulatus
           H143]
          Length = 261

 Score =  211 bits (537), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 113/253 (44%), Positives = 165/253 (65%), Gaps = 10/253 (3%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLRE-KG--IATE 57
           ++ILVP+K VI++  K RI    +G+ET   K S+NPFDE+++EE+++LRE KG    ++
Sbjct: 4   LRILVPVKRVIDFAIKPRINKSQTGVETAGVKHSLNPFDELSIEEAVRLRERKGPMSVSD 63

Query: 58  VIVVSIGSCKVEEVLKNSLAMGADRGILIESNE-----TLEPLSIAKILREIVKKENPII 112
           ++ +S G  K  + L+ ++AMGADR I ++  E      LEPL++AK+L+ +V+KEN  +
Sbjct: 64  ILAISAGGPKCADTLRTAMAMGADRSIHVDVPEKPDQAGLEPLTVAKLLKNVVQKENINL 123

Query: 113 VIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDN--HAIVTREVGHGTMTMETPL 170
           V+ GKQ  D +  QTGQMLA L+ WPQAT  S + + D+  +  VTREV  G  T+   L
Sbjct: 124 VLLGKQAIDGDQGQTGQMLAGLLGWPQATQASKVDVKDDAGNVEVTREVDGGVETLRAKL 183

Query: 171 PAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGL 230
           P VIT DL LNEPRY SLPNI+KA++K +EKK   D+ ++ T RLK L+  E  A + G 
Sbjct: 184 PMVITTDLRLNEPRYASLPNIMKAKRKPLEKKTLADYEVEDTKRLKTLKVTEPPARQGGG 243

Query: 231 RLYSTTKLIEILK 243
           ++     +I  LK
Sbjct: 244 KVEDVDGMISKLK 256


>gi|323308959|gb|EGA62190.1| YGR207C-like protein [Saccharomyces cerevisiae FostersO]
          Length = 261

 Score =  211 bits (537), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 113/250 (45%), Positives = 167/250 (66%), Gaps = 7/250 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREK--GIATEV 58
           ++ILVP+K V+++  K R+    +GI T   K S+NPFD+IA+EE+++++EK   +    
Sbjct: 7   LRILVPVKRVVDFQIKPRVNKTLTGIATSGIKFSINPFDDIAVEEAIRIKEKNKSLVEST 66

Query: 59  IVVSIGSCKVEEVLKNSLAMGADRGILIES--NETLEPLSIAKILREIVKKENPIIVIAG 116
             VSIGS K +++L+N LA G D   LI+S   E +EPL+IAKIL+ +V+K+   +V+ G
Sbjct: 67  HAVSIGSAKAQDILRNCLAKGIDTCSLIDSVGKENIEPLAIAKILKAVVEKKGSNLVLMG 126

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAI-VTREVGHGTMTMETPLPAVIT 175
           KQ  D++ N TGQMLA L+ WPQAT  + ++ +DN  + VTRE+  G   +E  LP VIT
Sbjct: 127 KQAIDDDCNNTGQMLAGLLNWPQATNAAKVEFLDNGKVQVTREIDDGEEVIEASLPMVIT 186

Query: 176 VDLNLNEPRYISLPNIIKARKKRIEKKK-ATDFA-IDLTPRLKVLRFEENRAERKGLRLY 233
            DL LN PRY+ LP ++KA+KK IEK   A DF  I++ P+LK++  EE + +  G++L 
Sbjct: 187 TDLRLNTPRYVGLPKLMKAKKKPIEKLDIAKDFPEINIEPQLKIVSMEEPKTKSPGVKLN 246

Query: 234 STTKLIEILK 243
           S  +LIE LK
Sbjct: 247 SVDELIEKLK 256


>gi|302689301|ref|XP_003034330.1| hypothetical protein SCHCODRAFT_14779 [Schizophyllum commune H4-8]
 gi|300108025|gb|EFI99427.1| hypothetical protein SCHCODRAFT_14779 [Schizophyllum commune H4-8]
          Length = 269

 Score =  211 bits (537), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 117/255 (45%), Positives = 165/255 (64%), Gaps = 12/255 (4%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLRE--KGIATEV 58
           + ILVP+K  ++Y  K+R+    +GI+T N K SMNPFDEIA+EE+++LRE  K     +
Sbjct: 9   LNILVPVKRAVDYAVKIRVNPQQTGIDT-NVKHSMNPFDEIAVEEAVRLRERLKSEVKSI 67

Query: 59  IVVSIGSCKVEEVLKNSLAMGADRGILIESNETL---EPLSIAKILREIVKKEN---PI- 111
            V++IG  K  E L+ +LAMGAD  I IE  E     EPL +AK LR ++++EN   P+ 
Sbjct: 68  KVITIGPPKSVETLRTALAMGADSAIHIEVPENAPAPEPLGVAKALRAVIERENEKTPVD 127

Query: 112 IVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKI--IDNHAIVTREVGHGTMTMETP 169
           +VI GKQ  D+++ QTGQMLA L+ WPQATF+S + +      A+VTRE+  G   ++  
Sbjct: 128 LVILGKQAIDDDAGQTGQMLAGLLDWPQATFISKLDVDPAKKEALVTREIDGGGEELKCR 187

Query: 170 LPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKG 229
           LP V+T DL LNEPRY SLPNI+KA+KK +EK  A D  +DLTP L+ L+  E      G
Sbjct: 188 LPLVVTTDLRLNEPRYASLPNIMKAKKKPVEKLTAQDLGVDLTPALETLKVTEPPKRVGG 247

Query: 230 LRLYSTTKLIEILKS 244
            ++ +  +L++ LK 
Sbjct: 248 GKVANVDELVQKLKD 262


>gi|225562083|gb|EEH10363.1| electron transfer flavoprotein beta-subunit [Ajellomyces capsulatus
           G186AR]
          Length = 261

 Score =  211 bits (536), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 113/253 (44%), Positives = 165/253 (65%), Gaps = 10/253 (3%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLRE-KG--IATE 57
           ++ILVP+K VI++  K RI    +G+ET   K S+NPFDE+++EE+++LRE KG    ++
Sbjct: 4   LRILVPVKRVIDFAIKPRINKSQTGVETAGVKHSLNPFDELSIEEAVRLRERKGPMSVSD 63

Query: 58  VIVVSIGSCKVEEVLKNSLAMGADRGILIESNE-----TLEPLSIAKILREIVKKENPII 112
           ++ +S G  K  + L+ ++AMGADR I ++  E      LEPL++AK+L+ +V+KEN  +
Sbjct: 64  ILAISAGGPKCTDTLRTAMAMGADRSIHVDVPEKPDQAGLEPLTVAKLLKNVVQKENINL 123

Query: 113 VIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDN--HAIVTREVGHGTMTMETPL 170
           V+ GKQ  D +  QTGQMLA L+ WPQAT  S + + D+  +  VTREV  G  T+   L
Sbjct: 124 VLLGKQAIDGDQGQTGQMLAGLLGWPQATQASKVDVKDDAGNVEVTREVDGGVETLRAKL 183

Query: 171 PAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGL 230
           P VIT DL LNEPRY SLPNI+KA++K +EKK   D+ ++ T RLK L+  E  A + G 
Sbjct: 184 PMVITTDLRLNEPRYASLPNIMKAKRKPLEKKTLADYEVEDTKRLKTLKVTEPPARQGGG 243

Query: 231 RLYSTTKLIEILK 243
           ++     +I  LK
Sbjct: 244 KVEDVDGMISKLK 256


>gi|125775543|ref|XP_001358978.1| GA20618 [Drosophila pseudoobscura pseudoobscura]
 gi|54638719|gb|EAL28121.1| GA20618 [Drosophila pseudoobscura pseudoobscura]
          Length = 253

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 166/246 (67%), Gaps = 4/246 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  KVR+K D +G+ T+  K SMNPFDEIA+EE+++++EK +ATEVI V
Sbjct: 3   RVLVGVKRVIDYAVKVRVKPDKTGVVTQGVKHSMNPFDEIAVEEAVKMKEKKLATEVIAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAGK 117
           S+G  +  EV++ ++AMGADRG+ ++      E L+P+ I+KIL ++   E   +VI GK
Sbjct: 63  SVGPAQSAEVIRTAMAMGADRGVHVDVPQAEYELLQPIHISKILAKLALDEKADLVILGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D+++NQT QM AA++ WPQ TF + I+  D    +TRE+  G  T++T +PAV++ D
Sbjct: 123 QAIDDDANQTAQMTAAVLDWPQGTFCNKIEKTDAGLTITREIDGGLETIKTKIPAVLSAD 182

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LN PRY +LPNI+KA+KK ++K  A D  +D TPR++V+  E+    + G  +     
Sbjct: 183 LRLNTPRYATLPNIMKAKKKPLKKVTAKDLGVDTTPRIEVISVEDPPVRQAGATVADVDA 242

Query: 238 LIEILK 243
           L+  LK
Sbjct: 243 LVAKLK 248


>gi|194906083|ref|XP_001981309.1| GG12001 [Drosophila erecta]
 gi|195503164|ref|XP_002098536.1| GE10427 [Drosophila yakuba]
 gi|190655947|gb|EDV53179.1| GG12001 [Drosophila erecta]
 gi|194184637|gb|EDW98248.1| GE10427 [Drosophila yakuba]
          Length = 253

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 110/246 (44%), Positives = 165/246 (67%), Gaps = 4/246 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  KVR+K D SG+ T+  K SMNPFDEIA+EE+++L+EK +A EVI V
Sbjct: 3   RVLVGVKRVIDYAVKVRVKPDKSGVVTQGVKHSMNPFDEIAVEEAVKLKEKKLAEEVIAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAGK 117
           S+G  + +EV++ +LAMGADRG+ +E      E L+P+ ++KIL ++   E   +VI GK
Sbjct: 63  SVGPAQSQEVIRTALAMGADRGVHVEIPAAEYELLQPIHVSKILAKLALDEKADLVILGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D+++NQT QM AA++ WPQ TF + I+  D    +TRE+  G  T++T  PAV++ D
Sbjct: 123 QAIDDDANQTAQMTAAVLDWPQGTFCNKIEKTDAGLTITREIDGGLETIKTKTPAVLSAD 182

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LN PRY +LPNI+KA+KK ++K  A D  +D +PR++V+  E+    + G  +     
Sbjct: 183 LRLNTPRYATLPNIMKAKKKPLKKVTAKDLGVDTSPRIEVISVEDPPVRQAGATVADVDA 242

Query: 238 LIEILK 243
           L+  LK
Sbjct: 243 LVAKLK 248


>gi|195144462|ref|XP_002013215.1| GL24008 [Drosophila persimilis]
 gi|194102158|gb|EDW24201.1| GL24008 [Drosophila persimilis]
          Length = 253

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 165/246 (67%), Gaps = 4/246 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  KVR+K D +G+ T+  K SMNPFDEIA+EE+++++EK +ATEVI V
Sbjct: 3   RVLVGVKRVIDYAVKVRVKPDKTGVVTQGVKHSMNPFDEIAVEEAVKMKEKKLATEVIAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAGK 117
           S+G  +  EV++ ++AMGADRG+ ++      E L+P+ I+KIL ++   E   +VI GK
Sbjct: 63  SVGPAQSAEVIRTAMAMGADRGVHVDVPQAEYELLQPIHISKILAKLALDEKADLVILGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D+++NQT QM AA++ WPQ TF + I+  D    +TRE+  G  T++T +PAV++ D
Sbjct: 123 QAIDDDANQTAQMTAAVLDWPQGTFCNKIEKTDAGLTITREIDGGLETIKTKIPAVLSAD 182

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LN PRY +LPNI+KA+KK ++K  A D  +D TPR+ V+  E+    + G  +     
Sbjct: 183 LRLNTPRYATLPNIMKAKKKPLKKVTAKDLGVDTTPRIDVISVEDPPVRQAGATVADVDA 242

Query: 238 LIEILK 243
           L+  LK
Sbjct: 243 LVAKLK 248


>gi|149235167|ref|XP_001523462.1| electron transfer flavoprotein beta-subunit [Lodderomyces
           elongisporus NRRL YB-4239]
 gi|146452871|gb|EDK47127.1| electron transfer flavoprotein beta-subunit [Lodderomyces
           elongisporus NRRL YB-4239]
          Length = 257

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 115/247 (46%), Positives = 172/247 (69%), Gaps = 4/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLRE--KGIATEV 58
           +KILVP+K VI+Y  K RI   ++G+ET+N K S+NPF +IALEESL+LRE  KGI   +
Sbjct: 6   LKILVPVKRVIDYAIKPRINKTHTGVETKNVKFSINPFCDIALEESLRLREAHKGIVDSI 65

Query: 59  IVVSIGSCKVEEVLKNSLAMGADRGILIE-SNETLEPLSIAKILREIVKKENPIIVIAGK 117
             VSIG  K +++L+ ++A GAD   L++  +E +EPL +AK+L+ +V+K+   +V+ GK
Sbjct: 66  HAVSIGPTKAQDILRTAMAKGADTSTLVDVGDEIVEPLQVAKMLKSVVEKQGLNLVVLGK 125

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D+++NQTGQMLA L+ WPQAT  S +++ D    VTRE+  G  T++  LP +ITVD
Sbjct: 126 QAIDDDANQTGQMLAGLLGWPQATNASKVELKDEEVFVTREIDGGAETLKAKLPMIITVD 185

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAID-LTPRLKVLRFEENRAERKGLRLYSTT 236
           L LNEPRY +LPN++KA+KK +EK K  D   + +  RL+V++ EE  A + G+++ +  
Sbjct: 186 LRLNEPRYATLPNVMKAKKKPLEKLKPKDLGFESIENRLEVVKVEEPPARQAGVKVENVD 245

Query: 237 KLIEILK 243
           +L+  LK
Sbjct: 246 ELVAKLK 252


>gi|323493380|ref|ZP_08098502.1| electron transfer flavoprotein subunit beta [Vibrio brasiliensis
           LMG 20546]
 gi|323312203|gb|EGA65345.1| electron transfer flavoprotein subunit beta [Vibrio brasiliensis
           LMG 20546]
          Length = 250

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 107/249 (42%), Positives = 168/249 (67%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV IK VI+   KVRIK+D SG+ET+N K+++NPF EIA+EE+++L+E G A E+IV
Sbjct: 1   MKVLVAIKRVIDPYAKVRIKSDGSGVETDNVKMAINPFCEIAVEEAIRLKEAGTAEEIIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G  + +E L+++LA+GADR I +   +T +PLS+AK+L+ +++KE   IV+ GKQ+ 
Sbjct: 61  VSLGGDECQEQLRSALALGADRAIHVSVTQTCQPLSVAKVLKALMEKEQAGIVLLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQ  QMLAAL   PQATF S + I   +  V REV  G   ++  LPA+++ DL L
Sbjct: 121 DTDNNQVAQMLAALTGRPQATFASKLTIDGEYIEVEREVDGGLERLKLALPAIVSTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K +E     + ++ +     V+          G+++ S  +L++
Sbjct: 181 NEPRYASLPNIMKAKRKPMETMTPDELSVVIRDSQTVIEVMAPAVRSAGVKVTSVDELVD 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|170590712|ref|XP_001900115.1| Electron transfer flavoprotein beta-subunit [Brugia malayi]
 gi|158592265|gb|EDP30865.1| Electron transfer flavoprotein beta-subunit, putative [Brugia
           malayi]
          Length = 253

 Score =  209 bits (533), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 109/234 (46%), Positives = 154/234 (65%), Gaps = 5/234 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           M+ LV +K VI+Y  K+R+K D +G+  EN + SMNPFDEIALEE+++L+EK I  EV+ 
Sbjct: 1   MRALVAVKRVIDYAIKIRVKPDKTGVIKENVQHSMNPFDEIALEEAVRLKEKQILKEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETL----EPLSIAKILREIVKKENPIIVIAG 116
           VS+G  K +E L+ +LA GADR I +E  E +    EPL  AKIL+ I + E P ++  G
Sbjct: 61  VSLGPFKSQETLRTALAKGADRAIHVEVEEVMAEKIEPLLAAKILKRIAEAEKPDLIFLG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNI-KIIDNHAIVTREVGHGTMTMETPLPAVIT 175
           KQ  D++  QT Q+LA L+ WPQA + S I +  D   IVTREV  G  ++   +PAVI+
Sbjct: 121 KQAIDDDCGQTAQLLAGLLNWPQAMYASVIEQESDKTFIVTREVDGGRESIRIKIPAVIS 180

Query: 176 VDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKG 229
            DL LNEPRY +LPNI+KA+ K +EKKK +D+ I++  + ++L   E    + G
Sbjct: 181 ADLRLNEPRYATLPNIMKAKNKLLEKKKPSDYGIEIAQQTQILEVMEPLVRKSG 234


>gi|254585831|ref|XP_002498483.1| ZYRO0G11374p [Zygosaccharomyces rouxii]
 gi|238941377|emb|CAR29550.1| ZYRO0G11374p [Zygosaccharomyces rouxii]
          Length = 259

 Score =  209 bits (532), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 110/250 (44%), Positives = 170/250 (68%), Gaps = 6/250 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIAT--EV 58
           ++ILVP+K VI+Y  + R+    + IET   K S+NPFD+IALEE+L+++EK  AT   +
Sbjct: 6   LRILVPVKRVIDYQIRPRVNKTKTAIETTGVKFSINPFDDIALEEALRIKEKKKATVDAI 65

Query: 59  IVVSIGSCKVEEVLKNSLAMGADRGILIES-NETLEPLSIAKILREIVKKENPIIVIAGK 117
             +SIG  K +++L+N LA GAD   L+++ ++ LEPL++AKIL+++V+K+   +VI GK
Sbjct: 66  HAISIGPSKSQDILRNCLAKGADTSTLVDAGSQELEPLAVAKILKQVVEKQGSNLVILGK 125

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIID--NHAIVTREVGHGTMTMETPLPAVIT 175
           Q  D+++N TGQMLA ++ WPQAT  +N++  +  +   +TREV  G   +  PLP VIT
Sbjct: 126 QAIDDDNNNTGQMLAGMLNWPQATNAANVEFENGGDRIKITREVDGGEEIVSAPLPLVIT 185

Query: 176 VDLNLNEPRYISLPNIIKARKKRIEKKKATDFA-IDLTPRLKVLRFEENRAERKGLRLYS 234
            DL LN+PRY+ L N++KA+KK ++K K  DFA +DL  RLK+L+  E      G+++ S
Sbjct: 186 TDLRLNQPRYVGLQNLMKAKKKPMDKLKLKDFADLDLESRLKLLQVVEPEPRSPGIKVGS 245

Query: 235 TTKLIEILKS 244
             +L++ LK 
Sbjct: 246 VDELVQNLKD 255


>gi|254507898|ref|ZP_05120027.1| electron transfer flavoprotein, beta subunit [Vibrio
           parahaemolyticus 16]
 gi|219549134|gb|EED26130.1| electron transfer flavoprotein, beta subunit [Vibrio
           parahaemolyticus 16]
          Length = 250

 Score =  209 bits (532), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 107/245 (43%), Positives = 162/245 (66%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV IK VI+  TKVR+K D SG+E  N K+++NPF EIA+EE+++L+E G A+EVIV
Sbjct: 1   MKVLVAIKRVIDPYTKVRVKADGSGVEDTNVKMTINPFCEIAVEEAIRLKEAGHASEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G    +E L+++LA+GADR I ++ + T +PL +AKIL  ++ KE P +V+ GKQ+ 
Sbjct: 61  VSLGDEACQEQLRSALALGADRAIHVQVDNTCQPLGVAKILNALMSKEQPALVLLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQ  QMLAAL + PQATF S + I  ++  V REV  G   +   LPA+++ DL L
Sbjct: 121 DTDNNQVAQMLAALSQRPQATFASKLNIDGDYVEVEREVDGGLEQLRLTLPAIVSTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA++K +E        +   P   +        ++ G+ + S  +L++
Sbjct: 181 NEPRYASLPNIMKAKRKPMEVLSLEALGVSYQPTQTIEAVMAPPVKQAGVMVSSVEELVD 240

Query: 241 ILKSK 245
            L+++
Sbjct: 241 KLRNE 245


>gi|24651145|ref|NP_651727.1| CG7834, isoform A [Drosophila melanogaster]
 gi|24651147|ref|NP_733307.1| CG7834, isoform B [Drosophila melanogaster]
 gi|195341303|ref|XP_002037250.1| GM12220 [Drosophila sechellia]
 gi|195574851|ref|XP_002105397.1| GD17660 [Drosophila simulans]
 gi|7301831|gb|AAF56940.1| CG7834, isoform B [Drosophila melanogaster]
 gi|23172599|gb|AAN14188.1| CG7834, isoform A [Drosophila melanogaster]
 gi|194131366|gb|EDW53409.1| GM12220 [Drosophila sechellia]
 gi|194201324|gb|EDX14900.1| GD17660 [Drosophila simulans]
 gi|220944626|gb|ACL84856.1| CG7834-PA [synthetic construct]
 gi|220954410|gb|ACL89748.1| CG7834-PA [synthetic construct]
          Length = 253

 Score =  209 bits (532), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 165/246 (67%), Gaps = 4/246 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  KVR+K D +G+ T+  K SMNPFDEIA+EE+++L+EK +A EVI V
Sbjct: 3   RVLVGVKRVIDYAVKVRVKPDKTGVVTQGVKHSMNPFDEIAVEEAVKLKEKKLAEEVIAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAGK 117
           S+G  + +EV++ +LAMGADRG+ +E      E L+P+ ++KIL ++   E   +VI GK
Sbjct: 63  SVGPAQSQEVIRTALAMGADRGVHVEIPAAEYELLQPIHVSKILAKLALDEKADLVILGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D+++NQT QM AA++ WPQ TF + I+  D    +TRE+  G  T++T  PAV++ D
Sbjct: 123 QAIDDDANQTAQMTAAVLDWPQGTFCNKIEKTDAGLTITREIDGGLETIKTKTPAVLSAD 182

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LN PRY +LPNI+KA+KK ++K  A D  +D +PR++V+  E+    + G  +     
Sbjct: 183 LRLNTPRYATLPNIMKAKKKPLKKVTAKDLGVDTSPRIEVISVEDPPVRQAGATVADVDA 242

Query: 238 LIEILK 243
           L+  LK
Sbjct: 243 LVAKLK 248


>gi|21483298|gb|AAM52624.1| GH14462p [Drosophila melanogaster]
          Length = 254

 Score =  209 bits (531), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 165/246 (67%), Gaps = 4/246 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  KVR+K D +G+ T+  K SMNPFDEIA+EE+++L+EK +A EVI V
Sbjct: 4   RVLVGVKRVIDYAVKVRVKPDKTGVVTQGVKHSMNPFDEIAVEEAVKLKEKKLAEEVIAV 63

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAGK 117
           S+G  + +EV++ +LAMGADRG+ +E      E L+P+ ++KIL ++   E   +VI GK
Sbjct: 64  SVGPAQSQEVIRTALAMGADRGVHVEIPAAEYELLQPIHVSKILAKLALDEKADLVILGK 123

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D+++NQT QM AA++ WPQ TF + I+  D    +TRE+  G  T++T  PAV++ D
Sbjct: 124 QAIDDDANQTAQMTAAVLDWPQGTFCNKIEKTDAGLTITREIDGGLETIKTKTPAVLSAD 183

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LN PRY +LPNI+KA+KK ++K  A D  +D +PR++V+  E+    + G  +     
Sbjct: 184 LRLNTPRYATLPNIMKAKKKPLKKVTAKDLGVDTSPRIEVISVEDPPVRQAGATVADVDA 243

Query: 238 LIEILK 243
           L+  LK
Sbjct: 244 LVAKLK 249


>gi|325091532|gb|EGC44842.1| electron transfer flavoprotein beta-subunit [Ajellomyces capsulatus
           H88]
          Length = 899

 Score =  209 bits (531), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 113/253 (44%), Positives = 165/253 (65%), Gaps = 10/253 (3%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLRE-KGI--ATE 57
           ++ILVP+K VI++  K RI    +G+ET   K S+NPFDE+++EE+++LRE KG    ++
Sbjct: 642 LRILVPVKRVIDFAIKPRINKSQTGVETAGVKHSLNPFDELSIEEAVRLRERKGPMSVSD 701

Query: 58  VIVVSIGSCKVEEVLKNSLAMGADRGILIESNE-----TLEPLSIAKILREIVKKENPII 112
           ++ +S G  K  + L+ ++AMGADR I ++  E      LEPL++AK+L+ +V+KEN  +
Sbjct: 702 ILAISAGGPKCADTLRTAMAMGADRSIHVDVPEKPDQAGLEPLTVAKLLKNVVQKENINL 761

Query: 113 VIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDN--HAIVTREVGHGTMTMETPL 170
           V+ GKQ  D +  QTGQMLA L+ WPQAT  S + + D+  +  VTREV  G  T+   L
Sbjct: 762 VLLGKQAIDGDQGQTGQMLAGLLGWPQATQASKVDVKDDAGNVEVTREVDGGVETLRAKL 821

Query: 171 PAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGL 230
           P VIT DL LNEPRY SLPNI+KA++K +EKK   D+ ++ T RLK L+  E  A + G 
Sbjct: 822 PMVITTDLRLNEPRYASLPNIMKAKRKPLEKKTLADYEVEDTKRLKTLKVTEPPARQGGG 881

Query: 231 RLYSTTKLIEILK 243
           ++     +I  LK
Sbjct: 882 KVEDVDGMISKLK 894


>gi|192360314|ref|YP_001983066.1| electron transfer flavoprotein subunit beta [Cellvibrio japonicus
           Ueda107]
 gi|190686479|gb|ACE84157.1| electron transfer flavoprotein beta subunit [Cellvibrio japonicus
           Ueda107]
          Length = 249

 Score =  208 bits (530), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 101/248 (40%), Positives = 162/248 (65%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K  +++N K  +      ++    + +MNPFDEI+LEE+++L+E+G+ ++++ 
Sbjct: 1   MKVLVAVKHTVDHNLKPLVDPASGLVDLSQARRAMNPFDEISLEEAVRLKERGLVSDILA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG    ++ L+++ AMGADR +L+E+   L+PL++AKILR +V++E P ++  GKQ  
Sbjct: 61  VSIGGPDAKDSLRHAYAMGADRALLVETASPLQPLAVAKILRVMVEREQPGLIFVGKQAV 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
             +  QTGQMLAAL+     TF S I++  N   VTRE+  GT T+E  LPAV+T DL L
Sbjct: 121 GEDYGQTGQMLAALLGVGLGTFASRIELDGNVVRVTREIEKGTQTIELQLPAVVTSDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPR+I LPN++ A+KK IE     +  +D+ PR +V++  E  A+    +L S  +L++
Sbjct: 181 NEPRFIKLPNLMMAKKKNIETLGVAELGVDIAPRFRVIKSAEPAAKPGARQLGSVAELVK 240

Query: 241 ILKSKHDL 248
           +L  +  L
Sbjct: 241 VLDEQEVL 248


>gi|167586548|ref|ZP_02378936.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia
           ubonensis Bu]
          Length = 171

 Score =  208 bits (529), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 94/171 (54%), Positives = 130/171 (76%)

Query: 10  VINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVE 69
           +++YN KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATE++ VS+G  + +
Sbjct: 1   MVDYNVKVRVKSDNTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEIVAVSVGVAQAQ 60

Query: 70  EVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQ 129
           E L+ +LA+GADR IL+ESN+ +EPL++AKIL+ +V KE P +VI GKQ  D++SNQTGQ
Sbjct: 61  ETLRTALAIGADRAILVESNDGVEPLAVAKILKALVDKEQPQLVILGKQAIDDDSNQTGQ 120

Query: 130 MLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           MLAAL   PQATF S + I D  A V REV  G  T+   LPAV+T DL L
Sbjct: 121 MLAALAGLPQATFASKVTIADGRATVAREVDGGAETLSLTLPAVVTTDLRL 171


>gi|257455323|ref|ZP_05620558.1| electron transfer flavoprotein subunit beta [Enhydrobacter
           aerosaccus SK60]
 gi|257447285|gb|EEV22293.1| electron transfer flavoprotein subunit beta [Enhydrobacter
           aerosaccus SK60]
          Length = 249

 Score =  207 bits (528), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 112/249 (44%), Positives = 177/249 (71%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK LV +K V++YN KVR+K D +G++  N K+S+NPFDEIA+EE+++L+E G+ +E++V
Sbjct: 1   MKALVAVKRVVDYNVKVRVKADNTGVDLTNVKMSVNPFDEIAVEEAVRLQEAGVVSEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VSIG  + +E ++ ++A+GADRGIL+E+ +T+ PL +AKIL+ I + E   I++ GKQ  
Sbjct: 61  VSIGPKEAQEQIRGAMALGADRGILVETTDTVRPLQVAKILKAIAQAEAADIILLGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++NQTGQMLAAL+   QATF S +K+      VTRE+  G  T++  LPAVIT DL L
Sbjct: 121 DDDNNQTGQMLAALLDVGQATFASQVKVDGGSVNVTREIDGGLQTVQLALPAVITTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY  LPNI+KA+KK +E+KK  D+ +     +++++       + G+++ S  +LI+
Sbjct: 181 NEPRYAKLPNIMKAKKKPLEEKKPEDYGVSTASNIQIVKVTPPAERKAGVKVKSVDELID 240

Query: 241 ILKSKHDLL 249
            L+++  ++
Sbjct: 241 KLRNEAKVI 249


>gi|242025168|ref|XP_002432998.1| Electron transfer flavoprotein subunit beta, putative [Pediculus
           humanus corporis]
 gi|212518507|gb|EEB20260.1| Electron transfer flavoprotein subunit beta, putative [Pediculus
           humanus corporis]
          Length = 254

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 108/246 (43%), Positives = 165/246 (67%), Gaps = 4/246 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  K+R+K+D +G+ T+  K SMNPFDEIA+EE+++++EK +A+EVI V
Sbjct: 3   RVLVGVKRVIDYAVKIRVKSDKTGVVTDGVKHSMNPFDEIAVEEAVRMKEKKLASEVIAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAGK 117
           S G    ++V++ +LAMGADRGI +E      E ++PL ++KIL ++   E   +VI GK
Sbjct: 63  SCGPANAQDVIRTALAMGADRGIHVEMAQNEYEQMQPLHVSKILAKLATDEKADLVIVGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D++ NQT QM+AAL+ WPQ TF S + +      +TRE+  G   ++   PAV++ D
Sbjct: 123 QAIDDDCNQTAQMIAALLEWPQGTFCSKVDVNGKEVSITREIDGGLEQIKLNAPAVLSAD 182

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LNEPRY +LPNI+KA+KK ++K  A D  +DLT R++VL  E+    + G  + +  +
Sbjct: 183 LRLNEPRYATLPNIMKAKKKPLKKVAAKDLGVDLTSRIEVLSVEDPPVRQGGSLVENVDE 242

Query: 238 LIEILK 243
           L+  LK
Sbjct: 243 LLGKLK 248


>gi|261197626|ref|XP_002625215.1| electron transfer flavoprotein beta-subunit [Ajellomyces
           dermatitidis SLH14081]
 gi|239595178|gb|EEQ77759.1| electron transfer flavoprotein beta-subunit [Ajellomyces
           dermatitidis SLH14081]
 gi|239607593|gb|EEQ84580.1| electron transfer flavoprotein beta-subunit [Ajellomyces
           dermatitidis ER-3]
 gi|327357280|gb|EGE86137.1| electron transfer flavoprotein subunit beta [Ajellomyces
           dermatitidis ATCC 18188]
          Length = 263

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 111/253 (43%), Positives = 164/253 (64%), Gaps = 10/253 (3%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLRE-KGIAT--E 57
           ++ILVP+K VI++  K RI    +G+ET   K S+NPFDE+++EE+++LRE KG  T  +
Sbjct: 6   LRILVPVKRVIDFAIKPRINKTQTGVETAGVKHSLNPFDELSIEEAVRLRERKGPMTVSD 65

Query: 58  VIVVSIGSCKVEEVLKNSLAMGADRGILIESNE-----TLEPLSIAKILREIVKKENPII 112
           ++ +S G  K  + L+ ++AMGADR I+++  E      LEPL++AK+L+ +V+KEN  +
Sbjct: 66  ILAISAGGPKCADTLRTAMAMGADRSIIVDVPEKADQAGLEPLTVAKMLKSVVQKENINL 125

Query: 113 VIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIV--TREVGHGTMTMETPL 170
           V+ GKQ  D +  QTGQMLA L+ W QAT  S + I D+   V  TREV  G  T++  L
Sbjct: 126 VLLGKQAIDGDQGQTGQMLAGLLGWSQATQASKVDIKDDAGTVEVTREVDGGVETLKAKL 185

Query: 171 PAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGL 230
           P VIT DL LNEPRY SLPN++KA++K +EK+   +  ++ T RLK L+  E  A + G 
Sbjct: 186 PMVITTDLRLNEPRYASLPNLMKAKRKPLEKRTLAELGVEDTKRLKTLKVTEPPARQGGG 245

Query: 231 RLYSTTKLIEILK 243
           ++     +I  LK
Sbjct: 246 KVEDVDGMIAKLK 258


>gi|118365591|ref|XP_001016016.1| electron transfer flavoprotein, beta subunit containing protein
           [Tetrahymena thermophila]
 gi|89297783|gb|EAR95771.1| electron transfer flavoprotein, beta subunit containing protein
           [Tetrahymena thermophila SB210]
          Length = 253

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 112/254 (44%), Positives = 169/254 (66%), Gaps = 6/254 (2%)

Query: 1   MKILVPIKGVINYNT-KVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVI 59
           M+ LV +K V++Y T K+R+K D SGI+    +I +NPF EIA+EE+++L+EK I  EV+
Sbjct: 1   MRALVGVKRVLDYTTTKIRVKPDGSGIDLSGKQI-INPFCEIAIEEAIKLKEKNIIKEVV 59

Query: 60  VVSIGSCKVEEVLKNSLAMGADRGILIESN----ETLEPLSIAKILREIVKKENPIIVIA 115
            +SIG    +E L++SLAMGAD+ I I ++    + L+PL +AKIL++I++++N  +V+ 
Sbjct: 60  ALSIGPKTFQETLRHSLAMGADKAIHISTDLSPDQKLQPLIVAKILQKIIERDNFELVLL 119

Query: 116 GKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVIT 175
           GKQ+ D++ NQTGQ+LA L+ WPQATF S I I D    VTRE+  G  T+   LP VIT
Sbjct: 120 GKQSVDDDFNQTGQLLAGLLDWPQATFASQITIKDKDVEVTREIDAGLQTIGFKLPGVIT 179

Query: 176 VDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYST 235
            DL LN PRY  +P+I+KA+KK +E+ +     IDL   L+V++ E  +  + G  L S 
Sbjct: 180 CDLRLNTPRYAKIPDIMKAKKKPLEELQLNSLGIDLNTGLEVIKTEAPQQRKGGQVLSSV 239

Query: 236 TKLIEILKSKHDLL 249
            +L+  L+++  L 
Sbjct: 240 DELVNKLRNEAKLF 253


>gi|116195834|ref|XP_001223729.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
 gi|88180428|gb|EAQ87896.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
          Length = 258

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 117/250 (46%), Positives = 167/250 (66%), Gaps = 7/250 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREK----GIAT 56
           ++ILVPIK VI+Y  K R+    +G+ET   K SMNPFDE+++EES+++REK    G   
Sbjct: 4   LRILVPIKRVIDYAVKPRVNKAQTGVETAGVKHSMNPFDELSVEESVRIREKSRAPGGVE 63

Query: 57  EVIVVSIGSCKVEEVLKNSLAMGADRGILIESNET--LEPLSIAKILREIVKKENPIIVI 114
           ++ V+S G  K +++L+ ++AMGADR I ++  E   LEPL++AK+L+  V+++   +VI
Sbjct: 64  DICVLSAGPPKAQDILRTAMAMGADRAIHVDVKEGDDLEPLAVAKLLKGAVEQQKSNLVI 123

Query: 115 AGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAI-VTREVGHGTMTMETPLPAV 173
            GKQ+ D+++NQTGQMLA L+ WPQAT  S ++  +  A+ VTREV  G  T+   LP +
Sbjct: 124 LGKQSIDDDANQTGQMLAGLLGWPQATQASKVEFGEGDAVNVTREVDGGVETVRAKLPMI 183

Query: 174 ITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLY 233
           IT DL LNEPRY SLPNI+KA+KK +EKK   DF +    RLKVL+  E  A + G ++ 
Sbjct: 184 ITTDLRLNEPRYASLPNIMKAKKKPLEKKTLADFGVSAEKRLKVLKVTEPPARQGGGKVE 243

Query: 234 STTKLIEILK 243
               LI  LK
Sbjct: 244 DVDGLISKLK 253


>gi|39952203|ref|XP_363818.1| conserved hypothetical protein [Magnaporthe oryzae 70-15]
 gi|145020406|gb|EDK04535.1| conserved hypothetical protein [Magnaporthe oryzae 70-15]
          Length = 257

 Score =  206 bits (524), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 167/249 (67%), Gaps = 6/249 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREK----GIAT 56
           ++ILVP+K VI+Y  K R+    +G+ET   K SMNPFDE+++EE++++REK    G   
Sbjct: 4   LRILVPVKRVIDYAVKPRVNKAQTGVETAGVKHSMNPFDELSVEEAVRIREKKSAPGGVE 63

Query: 57  EVIVVSIGSCKVEEVLKNSLAMGADRGILIESNE-TLEPLSIAKILREIVKKENPIIVIA 115
           ++ V+S G  K ++VL+ +LAMGADRG+ +E+ E  LEPL +AK+LR+  ++    +VI 
Sbjct: 64  DICVISAGPSKAQDVLRTALAMGADRGVHVETGEEQLEPLGVAKLLRKAAEEHKSNLVIL 123

Query: 116 GKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAI-VTREVGHGTMTMETPLPAVI 174
           GKQ+ D++S QTGQMLAAL+ WPQAT  S ++  +  ++ VT EV  G  T++  LP +I
Sbjct: 124 GKQSIDDDSAQTGQMLAALLGWPQATQASKVEFGEGDSVSVTCEVDGGVETVKAKLPMII 183

Query: 175 TVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYS 234
           T DL LNEPRY SLPNI+KA+KK  EKKK +D+ +    RLKVL+  E    + G ++  
Sbjct: 184 TTDLRLNEPRYASLPNIMKAKKKPFEKKKLSDYGVSAESRLKVLKVTEPPPRKGGGKVED 243

Query: 235 TTKLIEILK 243
              LI  LK
Sbjct: 244 VDGLIGKLK 252


>gi|145334707|ref|NP_001078699.1| ETFBETA; electron carrier [Arabidopsis thaliana]
 gi|222424201|dbj|BAH20059.1| AT5G43430 [Arabidopsis thaliana]
 gi|332007579|gb|AED94962.1| Electron transfer flavoprotein subunit beta [Arabidopsis thaliana]
          Length = 219

 Score =  206 bits (524), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 145/216 (67%), Gaps = 4/216 (1%)

Query: 33  ISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETL 92
           +SMNPF EIALEE+L+++E G A EVI VSIG  +  + L+  LAMGADRGI +E+N   
Sbjct: 1   MSMNPFCEIALEEALRIKEAGFAKEVIAVSIGPSQCVDTLRTGLAMGADRGIHVETNSIF 60

Query: 93  EPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIID-- 150
            PL+IAKIL+ +   ENP ++  GKQ  D++ NQTGQM+AAL+ WPQATF S + ++D  
Sbjct: 61  LPLTIAKILKSLADVENPGLIFLGKQAIDDDCNQTGQMVAALLGWPQATFASKV-VLDKD 119

Query: 151 -NHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAI 209
            N A V REV  G  T+   LPAVIT DL LN+PRY SLPNI+KA+ K I+K    D  +
Sbjct: 120 KNVATVDREVDGGLETLNVDLPAVITTDLRLNQPRYASLPNIMKAKSKPIKKMTVQDLKV 179

Query: 210 DLTPRLKVLRFEENRAERKGLRLYSTTKLIEILKSK 245
           D+   +++L   E    + G+ + S  +LI+ LK++
Sbjct: 180 DIKSDIEILEVTEPPKRKSGVMVSSVDELIDKLKNE 215


>gi|281337541|gb|EFB13125.1| hypothetical protein PANDA_017839 [Ailuropoda melanoleuca]
          Length = 257

 Score =  206 bits (524), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 102/232 (43%), Positives = 154/232 (66%), Gaps = 4/232 (1%)

Query: 16  KVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNS 75
           ++R+K D +G+ T+  K SMNPF EIA+EE+++L+EK +  EVI VS G  + +E ++ +
Sbjct: 21  QIRVKPDKTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPTQCQETIRTA 80

Query: 76  LAMGADRGILIESN----ETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQML 131
           LAMGADRGI +E +    + L PL +A++L ++ +KE   +++ GKQ  D++ NQTGQM 
Sbjct: 81  LAMGADRGIHVEVSAAEADRLGPLQVARVLAKLAEKEKVDLLLLGKQAIDDDCNQTGQMT 140

Query: 132 AALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNI 191
           A L+ WPQ TF S + +  +   V RE+  G  T+   LPAV+T DL LNEPRY +LPNI
Sbjct: 141 AGLLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNI 200

Query: 192 IKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIEILK 243
           +KA+KK+IE  K TD  +DLT +L V+  E+      G+++ +T  L+  L+
Sbjct: 201 MKAKKKKIEVIKPTDLGVDLTSKLSVVSVEDPPQRMAGVKVETTEDLVAKLR 252


>gi|62420877|ref|NP_001014763.1| electron transfer flavoprotein subunit beta isoform 2 [Homo
           sapiens]
 gi|193786211|dbj|BAG51494.1| unnamed protein product [Homo sapiens]
          Length = 346

 Score =  206 bits (523), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 151/232 (65%), Gaps = 4/232 (1%)

Query: 16  KVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNS 75
           ++R+K D +G+ T+  K SMNPF EIA+EE+++L+EK +  EVI VS G  + +E ++ +
Sbjct: 110 QIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTA 169

Query: 76  LAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQML 131
           LAMGADRGI +E      E L PL +A++L ++ +KE   +V+ GKQ  D++ NQTGQM 
Sbjct: 170 LAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMT 229

Query: 132 AALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNI 191
           A  + WPQ TF S + +  +   V RE+  G  T+   LPAV+T DL LNEPRY +LPNI
Sbjct: 230 AGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNI 289

Query: 192 IKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIEILK 243
           +KA+KK+IE  K  D  +DLT +L V+  E+      G+++ +T  L+  LK
Sbjct: 290 MKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTEDLVAKLK 341


>gi|90411298|ref|ZP_01219310.1| putative electron transfer flavoprotein,beta subunit
           [Photobacterium profundum 3TCK]
 gi|90327827|gb|EAS44158.1| putative electron transfer flavoprotein,beta subunit
           [Photobacterium profundum 3TCK]
          Length = 264

 Score =  206 bits (523), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 110/257 (42%), Positives = 167/257 (64%), Gaps = 12/257 (4%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV IK VI+   KVR+K+D SG+ET N K++MNPF EIA+EE+++L+E G A E+IV
Sbjct: 1   MKVLVAIKRVIDPYVKVRVKSDGSGVETNNVKMTMNPFCEIAVEEAVRLKEAGHAEEIIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G    +E L+ +LA+GADR I I+   + EPL +AK+LR ++  E+P IV+ GKQ+ 
Sbjct: 61  VSVGDKSCQEQLRTALALGADRAIHIDIPSSPEPLVVAKLLRAVMVIEDPGIVLLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKII------------DNHAIVTREVGHGTMTMET 168
           D ++NQ  QMLAA+ + PQ TF S + ++             N  +VTRE+  G  T++ 
Sbjct: 121 DTDNNQVAQMLAAITQRPQGTFASEVTVVSEESPVSESNGQSNAVLVTREIDGGLETVKL 180

Query: 169 PLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERK 228
            LPA+I+ DL LNEPRY SLPNI+KA++K ++     +  + +T   ++L          
Sbjct: 181 NLPAIISTDLRLNEPRYASLPNIMKAKRKPLDVITPDELGVAVTLHQEILDVMSPPERAT 240

Query: 229 GLRLYSTTKLIEILKSK 245
           G+ + S ++L+E LK++
Sbjct: 241 GVMVNSVSELVEKLKNE 257


>gi|242072448|ref|XP_002446160.1| hypothetical protein SORBIDRAFT_06g002880 [Sorghum bicolor]
 gi|241937343|gb|EES10488.1| hypothetical protein SORBIDRAFT_06g002880 [Sorghum bicolor]
          Length = 255

 Score =  206 bits (523), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 117/256 (45%), Positives = 168/256 (65%), Gaps = 8/256 (3%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++Y  KVR++ D +G+ET N K+SMNPF EIA+EE+L+LRE G A EV+ 
Sbjct: 1   MKILVAVKRVVDYAVKVRVRPDRTGVETANVKMSMNPFCEIAVEEALRLREAGAAAEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
            ++G  +  + L+ +LAMGADR + +    +    L PL++AKILR +  +E P +VI G
Sbjct: 61  ATVGPAQSADTLRTALAMGADRAVHVLHDPDPARPLLPLAVAKILRAVALQEKPGLVILG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNH---AIVTREVGHGTMTMETPLPAV 173
           KQ  D++ NQTGQMLA L++WPQ TF S + I+D     A V REV  G  T+   LPAV
Sbjct: 121 KQAIDDDCNQTGQMLAGLLQWPQGTFASKV-ILDTEKQKATVEREVDGGIETICLDLPAV 179

Query: 174 ITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLY 233
           IT DL LN+PRY +LPNI+KA+ K I+K    D  +D+   ++V+   E    + G+ L 
Sbjct: 180 ITTDLRLNQPRYATLPNIMKAKSKVIKKVAPGDLGVDIRSDMEVIEVNEPPKRKAGVILS 239

Query: 234 STTKLIEILKSKHDLL 249
           S  +L++ LK++  +L
Sbjct: 240 SVDELLDKLKNEAGVL 255


>gi|33341692|gb|AAQ15217.1|AF370381_1 FP585 [Homo sapiens]
          Length = 346

 Score =  206 bits (523), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 151/232 (65%), Gaps = 4/232 (1%)

Query: 16  KVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNS 75
           ++R+K D +G+ T+  K SMNPF EIA+EE+++L+EK +  EVI VS G  + +E ++ +
Sbjct: 110 QIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTA 169

Query: 76  LAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQML 131
           LAMGADRGI +E      E L PL +A++L ++ +KE   +V+ GKQ  D++ NQTGQM 
Sbjct: 170 LAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMT 229

Query: 132 AALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNI 191
           A  + WPQ TF S + +  +   V RE+  G  T+   LPAV+T DL LNEPRY +LPNI
Sbjct: 230 AGFLDWPQGTFASQVMLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNI 289

Query: 192 IKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIEILK 243
           +KA+KK+IE  K  D  +DLT +L V+  E+      G+++ +T  L+  LK
Sbjct: 290 MKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTEDLVAKLK 341


>gi|54302777|ref|YP_132770.1| putative electron transfer flavoprotein,beta subunit
           [Photobacterium profundum SS9]
 gi|46916201|emb|CAG22970.1| putative electron transfer flavoprotein,beta subunit
           [Photobacterium profundum SS9]
          Length = 267

 Score =  206 bits (523), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 110/263 (41%), Positives = 166/263 (63%), Gaps = 18/263 (6%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV IK VI+   KVR+K+D SG+ET N K++MNPF EIA+EE+++L+E G A E+IV
Sbjct: 1   MKVLVAIKRVIDPYVKVRVKSDGSGVETNNVKMTMNPFCEIAVEEAVRLKEAGHAEEIIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G    +E L+ +LA+GADR I I+   + EPL +AK+LR ++  E+P IV+ GKQ+ 
Sbjct: 61  VSVGDISCQEQLRTALALGADRAIHIDMPSSPEPLVVAKLLRAVMAIEDPGIVLLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKII------------------DNHAIVTREVGHG 162
           D ++NQ  QMLAA+ + PQ TF S + ++                   N  +VTRE+  G
Sbjct: 121 DTDNNQVAQMLAAITQRPQGTFASEVTVVSEESPVSEEPIVSESNGQSNAVLVTREIDGG 180

Query: 163 TMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEE 222
             T++  LPA+I+ DL LNEPRY SLPNI+KA++K ++     +  + +T   ++L    
Sbjct: 181 LETVKLNLPAIISTDLRLNEPRYASLPNIMKAKRKPLDVITPDELGVAVTQHQEILDVMS 240

Query: 223 NRAERKGLRLYSTTKLIEILKSK 245
                 G+ + S  +L+E LK++
Sbjct: 241 PPERAAGVMVNSVLELVEKLKNE 263


>gi|294932227|ref|XP_002780167.1| Electron transfer flavoprotein subunit beta, putative [Perkinsus
           marinus ATCC 50983]
 gi|239890089|gb|EER11962.1| Electron transfer flavoprotein subunit beta, putative [Perkinsus
           marinus ATCC 50983]
          Length = 252

 Score =  205 bits (522), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 106/250 (42%), Positives = 160/250 (64%), Gaps = 2/250 (0%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           K LV IK V++Y  KVR+    +G++  N K S+NPF EIA+EE+L+++E G  +EV+ V
Sbjct: 3   KALVCIKRVVDYAVKVRVMATKAGVDLANVKHSVNPFCEIAVEEALRMKEAGHLSEVVAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTD 121
             G+ K  E L+ +LAMG DR   + +++ L PL +AK++ +IV+KE+P++V+ GKQ  D
Sbjct: 63  CAGTDKATEQLRQALAMGCDRATHLRTDQELPPLLVAKLIEKIVEKEDPLLVLMGKQAID 122

Query: 122 NESNQTGQMLAALMRWPQATFVSNIKIIDNHA--IVTREVGHGTMTMETPLPAVITVDLN 179
            +  QT Q+LA ++ WPQAT  S + + D++    V REV  G   +  PLPAV++ DL 
Sbjct: 123 GDMGQTCQLLAGMLGWPQATCASKVVVSDDNTELTVDREVDTGIQKVHIPLPAVMSADLR 182

Query: 180 LNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLI 239
           LN PRY +LPN++KA+KK IE   A    +DL   L+V   EE  A + G+ L    +LI
Sbjct: 183 LNTPRYATLPNLMKAKKKPIEVIPAESLGVDLKSTLQVTSVEEPPARKAGVILSDVDELI 242

Query: 240 EILKSKHDLL 249
           + LK++  +L
Sbjct: 243 DKLKNEAKVL 252


>gi|225709120|gb|ACO10406.1| Electron transfer flavoprotein subunit beta [Caligus rogercresseyi]
          Length = 251

 Score =  205 bits (522), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 114/249 (45%), Positives = 163/249 (65%), Gaps = 4/249 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           M+ILV +K VI+Y  K R++ D  G+ T+  K SMNPFDEI +EE+++L+EK IA E++V
Sbjct: 1   MRILVGVKRVIDYAVKNRVRPDGKGVVTDGVKHSMNPFDEIGIEEAVRLKEKKIAKEIVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESN----ETLEPLSIAKILREIVKKENPIIVIAG 116
            + G  + +E L+ +LAMGADRGI IE +    ET+ P+ I+K+  EI KKE   +V+ G
Sbjct: 61  ATCGPTQSQETLRTALAMGADRGIHIEVSPLEVETILPIQISKMFSEIAKKEEIDMVLLG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQT QM+A+ + WPQ  F S +   D    V RE+  G  T+   LPAVI+V
Sbjct: 121 KQAIDDDCNQTAQMMASFLNWPQGVFASKVDPKDKKVEVIREIDGGLETVSLDLPAVISV 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+I K K  D  +D+TPR++V++ E+      G+ +    
Sbjct: 181 DLRLNEPRYATLPNIMKAKKKKIAKMKPADLNVDITPRIEVIKVEDPPVREPGIIVEDVE 240

Query: 237 KLIEILKSK 245
            L+  LK K
Sbjct: 241 TLVSKLKDK 249


>gi|146282944|ref|YP_001173097.1| electron transfer flavoprotein beta-subunit [Pseudomonas stutzeri
           A1501]
 gi|145571149|gb|ABP80255.1| electron transfer flavoprotein beta-subunit [Pseudomonas stutzeri
           A1501]
          Length = 215

 Score =  205 bits (522), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 99/215 (46%), Positives = 148/215 (68%)

Query: 35  MNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEP 94
           MNPF EIA+EE+++L+EKG+A+E++VVSIG    +E L+ +LA+GADR +L+ESN+ L  
Sbjct: 1   MNPFCEIAVEEAVRLKEKGVASEIVVVSIGPTAAQEQLRTALALGADRAVLVESNDELNS 60

Query: 95  LSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAI 154
           L++AK+L+ +V KE P +VI GKQ  D+++NQTGQML AL  + Q TF S +++  +   
Sbjct: 61  LAVAKLLKAVVDKEQPQLVILGKQAIDSDNNQTGQMLGALTGYAQGTFASKVEVAGDKVN 120

Query: 155 VTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPR 214
           VTRE+  G  T+   LPA++T DL LNEPRY SLPNI+KA+KK +E        +  T  
Sbjct: 121 VTREIDGGLQTVALNLPAIVTTDLRLNEPRYASLPNIMKAKKKPLEVLTPDALGVATTST 180

Query: 215 LKVLRFEENRAERKGLRLYSTTKLIEILKSKHDLL 249
           +K L+ E   A   G+++ S  +L+E LK++  ++
Sbjct: 181 VKTLKVEAPAARSAGIKVKSVAELVEKLKNEAKVI 215


>gi|156845791|ref|XP_001645785.1| hypothetical protein Kpol_1010p43 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156116453|gb|EDO17927.1| hypothetical protein Kpol_1010p43 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 258

 Score =  205 bits (522), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 116/250 (46%), Positives = 167/250 (66%), Gaps = 8/250 (3%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKG--IATEV 58
           ++ILVP+K VI+Y  + R+ N+   I+++  K S+NPFD+IA+EE++++REK   +   +
Sbjct: 6   LRILVPVKRVIDYQIRPRVLNN--AIDSKTIKFSINPFDDIAVEEAVRIREKNKDLVELI 63

Query: 59  IVVSIGSCKVEEVLKNSLAMGADRGILIESNET-LEPLSIAKILREIVKKENPIIVIAGK 117
             VSIG  K ++VL+  LA G D   L++S E  LEPLS+AKIL+EIV K N  +VI GK
Sbjct: 64  HSVSIGPTKAQDVLRTCLAKGVDTSTLVDSGEQQLEPLSVAKILKEIVMKNNSNLVILGK 123

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIV--TREVGHGTMTMETPLPAVIT 175
           Q  D++SN TGQMLA L+ WPQAT  + I+ ++++  V   RE+  G  T+ + LP VIT
Sbjct: 124 QAIDDDSNNTGQMLAGLLSWPQATNAAKIEFLEDNTKVKIVREIDGGEETLISSLPLVIT 183

Query: 176 VDLNLNEPRYISLPNIIKARKKRIEKKKATDF-AIDLTPRLKVLRFEENRAERKGLRLYS 234
            DL LN PRY+SL N++KA+KK IEK K +DF  ID T RLK +  EE +    G+ + S
Sbjct: 184 TDLRLNTPRYVSLQNMMKAKKKPIEKLKLSDFNNIDTTQRLKTISIEEPKPRENGIMVNS 243

Query: 235 TTKLIEILKS 244
             +L+  LK+
Sbjct: 244 VDELVTSLKN 253


>gi|219110335|ref|XP_002176919.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217411454|gb|EEC51382.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 253

 Score =  205 bits (521), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 108/255 (42%), Positives = 166/255 (65%), Gaps = 8/255 (3%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV IK V++Y  KVR+      ++  N K SMNPF EIA+EE+++L+E   A+EV+ 
Sbjct: 1   MKILVGIKRVVDYAVKVRVSK--GTVDLANVKQSMNPFCEIAVEEAVRLKESKNASEVVA 58

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESN-----ETLEPLSIAKILREIVKKENPIIVIA 115
           +SIG  +  E ++ +LAMG DRGI I+++       L+P +IA++ ++IV+KE   +V+ 
Sbjct: 59  LSIGPKQCTETIRTALAMGCDRGIHIQTDLRTDYMDLQPFAIAQLFQKIVEKEKSDLVLL 118

Query: 116 GKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMET-PLPAVI 174
           GKQ  D++  QTG MLA +M WPQ TF + +++ D   +V RE   GT T++   LPAV+
Sbjct: 119 GKQGIDSDCGQTGPMLAGMMGWPQVTFAAKVEVKDGGLLVERETDSGTETIQVKSLPAVV 178

Query: 175 TVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYS 234
           T DL LNEPRY +LPNI+KA+KK +E  KA +  +DL P  +VL   E    ++G+ + +
Sbjct: 179 TCDLRLNEPRYATLPNIMKAKKKPVETLKAEEMGVDLVPHNQVLEILEPPPRKEGIMVEN 238

Query: 235 TTKLIEILKSKHDLL 249
              LI+ L+++  ++
Sbjct: 239 VDSLIDKLRNEAQVI 253


>gi|195445160|ref|XP_002070200.1| GK11162 [Drosophila willistoni]
 gi|194166285|gb|EDW81186.1| GK11162 [Drosophila willistoni]
          Length = 253

 Score =  204 bits (520), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 158/225 (70%), Gaps = 4/225 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  KVR+K D +G+ T+  K SMNPFDEIA+EE+++L+EK +A EVI V
Sbjct: 3   RVLVGVKRVIDYAVKVRVKPDKTGVVTQGVKHSMNPFDEIAVEEAVKLKEKKLAGEVIAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAGK 117
           S+G  + +EV++ +LAMGADRG+ +E      E L+P+ ++KIL ++  +E   +VI GK
Sbjct: 63  SVGPAQSQEVIRTALAMGADRGVHVEIPAAEYELLQPIHVSKILAKLALEEKADLVILGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D+++NQT QM AA + WPQ TF + I+  D    +TRE+  G  T++T  PAV++ D
Sbjct: 123 QAIDDDANQTAQMTAAALDWPQGTFCNKIEKTDAGLTITREIDGGLETIKTKTPAVLSAD 182

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEE 222
           L LN PRY +LPNI+KA+KK ++K  A D  +D +PR++++  E+
Sbjct: 183 LRLNTPRYATLPNIMKAKKKPLKKVTAKDLGVDTSPRIEIVSVED 227


>gi|148690713|gb|EDL22660.1| electron transferring flavoprotein, beta polypeptide, isoform CRA_b
           [Mus musculus]
          Length = 264

 Score =  204 bits (520), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 109/256 (42%), Positives = 161/256 (62%), Gaps = 13/256 (5%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           ++ LV +K VI++  K+R+K D SG+ T+  K SMNPF EIA+EE+++L+EK +  E+I 
Sbjct: 4   LRALVAVKRVIDFAVKIRVKPDKSGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEIIA 63

Query: 61  VSIG--SCKV----EEVLKNSLAMG---ADRGILIE----SNETLEPLSIAKILREIVKK 107
           VS G   C+V    E  ++ +   G   ADRGI +E      E+L PL +A++L ++ +K
Sbjct: 64  VSCGPSQCQVLRDPERPIRQTCFWGPWSADRGIHVEIPGAQAESLGPLQVARVLAKLAEK 123

Query: 108 ENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTME 167
           E   ++  GKQ  D++ NQTGQM A L+ WPQ TF S + +  +   V RE+  G  T+ 
Sbjct: 124 EKVDLLFLGKQAIDDDCNQTGQMTAGLLDWPQGTFASQVTLEGDKVKVEREIDGGLETLR 183

Query: 168 TPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAER 227
             LPAV+T DL LNEPRY +LPNI+KA+KK+IE  KA D  +DLT ++ V+  EE     
Sbjct: 184 LKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVVKAGDLGVDLTSKVSVISVEEPPQRS 243

Query: 228 KGLRLYSTTKLIEILK 243
            G+++ +T  L+  LK
Sbjct: 244 AGVKVETTEDLVAKLK 259


>gi|261251361|ref|ZP_05943935.1| electron transfer flavoprotein beta subunit [Vibrio orientalis CIP
           102891]
 gi|260938234|gb|EEX94222.1| electron transfer flavoprotein beta subunit [Vibrio orientalis CIP
           102891]
          Length = 250

 Score =  204 bits (520), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 148/200 (74%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK++V IK V++   KVRIK+D SG+ET+N K+++NPF EIA+EE+++++E G+A EVIV
Sbjct: 1   MKVIVAIKRVVDPYVKVRIKSDGSGVETDNVKMAINPFCEIAVEEAIRMKEAGVADEVIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
            S+G  + +E L+++LA+GADR I +  ++  +PLS+AK+L+ +++KE   IV+ GKQ+ 
Sbjct: 61  ASLGGDECQEQLRSALALGADRAIHVCVDQICQPLSVAKVLKALMEKEQAGIVLLGKQSI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D ++NQ  QMLAAL   PQATF S + +  ++  V REV  G   ++  LPA+I+ DL L
Sbjct: 121 DTDNNQVAQMLAALTSLPQATFASKLTVDGDNVEVEREVDGGLERLKLALPAIISTDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIE 200
           NEPRY SLPNI+KA++K +E
Sbjct: 181 NEPRYASLPNIMKAKRKPME 200


>gi|171690830|ref|XP_001910340.1| hypothetical protein [Podospora anserina S mat+]
 gi|170945363|emb|CAP71475.1| unnamed protein product [Podospora anserina S mat+]
          Length = 258

 Score =  204 bits (519), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 164/250 (65%), Gaps = 7/250 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREK----GIAT 56
           ++ILVP+K VI+Y  K R+    +G+ET   K SMNPFDE+++EES+++REK    G   
Sbjct: 4   LRILVPVKRVIDYAVKPRVNKAQTGVETAGVKHSMNPFDELSVEESVRIREKKRAPGGVE 63

Query: 57  EVIVVSIGSCKVEEVLKNSLAMGADRGILIE--SNETLEPLSIAKILREIVKKENPIIVI 114
           ++ V+S G  K +++L+ ++AMGADRGI +E    E LEPLS+AK+L+  V+++   +V 
Sbjct: 64  DICVISAGPTKAQDILRTAMAMGADRGIHVEVKEGEDLEPLSVAKLLKAAVEQQKSNLVF 123

Query: 115 AGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAI-VTREVGHGTMTMETPLPAV 173
            GKQ+ D+++NQTGQMLA L+ WPQAT  S +   +   + VT+EV  G  T++  LP +
Sbjct: 124 LGKQSIDDDANQTGQMLAGLLGWPQATQASEVTFGEGDTVTVTKEVDGGVETVKAKLPMI 183

Query: 174 ITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLY 233
           IT DL LNEPRY SLPNI+KA+KK +EKK   DF I    RLK L+  E    + G ++ 
Sbjct: 184 ITTDLRLNEPRYASLPNIMKAKKKPLEKKTLADFGITGEKRLKTLKVTEPPPRKGGGKVE 243

Query: 234 STTKLIEILK 243
               LI  LK
Sbjct: 244 DVDGLISKLK 253


>gi|195113511|ref|XP_002001311.1| GI10719 [Drosophila mojavensis]
 gi|193917905|gb|EDW16772.1| GI10719 [Drosophila mojavensis]
          Length = 253

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 104/247 (42%), Positives = 166/247 (67%), Gaps = 4/247 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  KVR+K + +G+ T+  K SMNPFDEIA+EE+++++EK +A+EVI V
Sbjct: 3   RVLVGVKRVIDYAVKVRVKPEKNGVVTQGVKHSMNPFDEIAVEEAVKMKEKKLASEVIAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAGK 117
           S+G  + +EV++ +LAMGADRG+ +E      + L+P+ ++KIL ++   E   +VI GK
Sbjct: 63  SVGPTQSQEVIRTALAMGADRGVHVEVPAAEYDLLQPIHVSKILAKLALDEKADLVILGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D+++NQT QM AA++ WPQ TF + ++  D    + RE+  G  T++T LPAV++ D
Sbjct: 123 QAIDDDANQTAQMTAAVLDWPQGTFCNKVEKTDAGLTIAREIDGGLETIKTKLPAVLSAD 182

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LN PRY +LPNI+KA+KK ++K    D  +D TPR++++  E+    + G  +     
Sbjct: 183 LRLNTPRYATLPNIMKAKKKPLKKVTPKDLGVDTTPRIEIISVEDPPVRQAGAVVADVDA 242

Query: 238 LIEILKS 244
           L+  LK+
Sbjct: 243 LVAKLKA 249


>gi|195053476|ref|XP_001993652.1| GH20899 [Drosophila grimshawi]
 gi|193895522|gb|EDV94388.1| GH20899 [Drosophila grimshawi]
          Length = 253

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 105/225 (46%), Positives = 158/225 (70%), Gaps = 4/225 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  KVR+K + +G+ T+  K SMNPFDEIA+EE+++L+EK +ATEVI V
Sbjct: 3   RVLVGVKRVIDYAVKVRVKPEKNGVVTQGVKHSMNPFDEIAVEEAVKLKEKKLATEVIAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIESN----ETLEPLSIAKILREIVKKENPIIVIAGK 117
           S+G  + +EV++ +LAMGADRG+ +E +    E L+PL ++KIL ++   E   +VI GK
Sbjct: 63  SVGPTQSQEVIRTALAMGADRGVHVEVSAAEYELLQPLHVSKILAKLALDEKADLVILGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D+++NQT QM AA++ WPQ TF + I+  D    + REV  G  T++T  PAV++ D
Sbjct: 123 QAIDDDANQTAQMTAAVLDWPQGTFCNKIEKTDAGLTIVREVDGGLETIKTKTPAVLSAD 182

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEE 222
           L LN PRY +LPNI+KA+KK ++K    D  +D TPR++++  E+
Sbjct: 183 LRLNTPRYATLPNIMKAKKKPLKKVTPKDLGVDTTPRIEIVSVED 227


>gi|225711948|gb|ACO11820.1| Electron transfer flavoprotein subunit beta [Lepeophtheirus
           salmonis]
 gi|290462363|gb|ADD24229.1| Electron transfer flavoprotein subunit beta [Lepeophtheirus
           salmonis]
 gi|290462399|gb|ADD24247.1| Electron transfer flavoprotein subunit beta [Lepeophtheirus
           salmonis]
 gi|290562762|gb|ADD38776.1| Electron transfer flavoprotein subunit beta [Lepeophtheirus
           salmonis]
          Length = 251

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 112/249 (44%), Positives = 165/249 (66%), Gaps = 4/249 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           M+ILV +K VI+Y  K+RI+ D  G+ T+  K SMNPFDEIA+EE+++L+EK IA E+IV
Sbjct: 1   MRILVGVKRVIDYAVKIRIRPDGKGVVTDGVKHSMNPFDEIAVEEAVRLKEKKIAKEIIV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAG 116
           ++ G  + ++ L+ +LAMGADRGI +E      ET+ P+ I+K+  E+ KKE   +VI G
Sbjct: 61  MTCGPTQSQDTLRTALAMGADRGIHVEVPPSEAETILPIQISKMFSEVAKKEEVDLVILG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQT QM A+++ WPQ  + S +++ D    V RE+  G  T+   LPAV++ 
Sbjct: 121 KQAIDDDCNQTAQMTASILDWPQGVYASKLEVKDKKLEVIREIDGGLETILLDLPAVVSA 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK+I K K +D  +D  PR++V++ E+      G+ +    
Sbjct: 181 DLRLNEPRYATLPNIMKAKKKKIAKMKPSDLGVDSAPRIEVIKVEDPPVREPGIIVEDVD 240

Query: 237 KLIEILKSK 245
            LI  LK K
Sbjct: 241 TLITKLKDK 249


>gi|293336913|ref|NP_001168485.1| hypothetical protein LOC100382262 [Zea mays]
 gi|223948593|gb|ACN28380.1| unknown [Zea mays]
          Length = 255

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 167/256 (65%), Gaps = 8/256 (3%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++Y  KVR++ D +G+ET N K+SMNPF EIA+EE+L+LRE G A EV+ 
Sbjct: 1   MKILVAVKRVVDYAVKVRVRPDRTGVETANVKMSMNPFCEIAVEEALRLREAGAAAEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
            ++G  +  E L+ +LA GADR I +    +    L PL++AKILR +  +E P +VI G
Sbjct: 61  ATVGPAQSAETLRTALANGADRAIHVLHDPDPARPLLPLTVAKILRAVALQEKPGLVILG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNH---AIVTREVGHGTMTMETPLPAV 173
           KQ  D++ NQTGQMLA L++WPQ TF S + I+D     A V REV  G  T+   LPAV
Sbjct: 121 KQAIDDDCNQTGQMLAGLLQWPQGTFASKV-ILDTEKQKATVEREVDGGIETICLDLPAV 179

Query: 174 ITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLY 233
           IT DL LN+PRY +LPNI+KA+ K I+K    D  +D+   ++V+   E    + G+ L 
Sbjct: 180 ITTDLRLNQPRYATLPNIMKAKSKVIKKVVPKDLGVDIRSDMEVIEVNEPPKRKAGVILS 239

Query: 234 STTKLIEILKSKHDLL 249
           S  +LI+ LK++  +L
Sbjct: 240 SVDELIDRLKNEARVL 255


>gi|226499156|ref|NP_001150438.1| electron transfer flavoprotein beta-subunit [Zea mays]
 gi|195639262|gb|ACG39099.1| electron transfer flavoprotein beta-subunit [Zea mays]
 gi|238010590|gb|ACR36330.1| unknown [Zea mays]
          Length = 255

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 115/255 (45%), Positives = 166/255 (65%), Gaps = 6/255 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++Y  KVR++ D  G+ET N K+SMNPF EIA+EE+L+LRE G+A EV+ 
Sbjct: 1   MKILVAVKRVVDYAVKVRVRPDGRGVETANVKMSMNPFCEIAVEEALRLREAGVAAEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
            ++G  +  + L+ +LAMGADR + +    +    L PL++AKILR +  +E P +VI G
Sbjct: 61  ATVGPAQSADTLRTALAMGADRAVHVLHDPDPARPLLPLAVAKILRAVALQEKPGLVILG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKII--DNHAIVTREVGHGTMTMETPLPAVI 174
           KQ  D++ NQTGQMLA L++WPQ TF S + +      A V REV  G  T+   LPAVI
Sbjct: 121 KQAIDDDCNQTGQMLAGLLKWPQGTFASKVTLDTEKQKATVEREVDGGIETICLDLPAVI 180

Query: 175 TVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYS 234
           T DL LN+PRY +LPNI+KA+ K I+K  A D  +D+   ++V+   E    + G+ L  
Sbjct: 181 TTDLRLNQPRYATLPNIMKAKSKVIKKVAAEDLGVDIRSDMEVIEVNEPPKRKAGVILSC 240

Query: 235 TTKLIEILKSKHDLL 249
             +L++ LK++  +L
Sbjct: 241 VDELLDKLKNEARVL 255


>gi|169621225|ref|XP_001804023.1| hypothetical protein SNOG_13820 [Phaeosphaeria nodorum SN15]
 gi|111057724|gb|EAT78844.1| hypothetical protein SNOG_13820 [Phaeosphaeria nodorum SN15]
          Length = 260

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 166/252 (65%), Gaps = 9/252 (3%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLRE-KGIAT--- 56
           ++ILVP+K VI+Y  K R+    + +ET N K SMNPFDE+++EE++++RE KG  T   
Sbjct: 4   LRILVPVKRVIDYAVKPRVNRAQTAVETANVKHSMNPFDELSIEEAVRVREQKGHHTSAP 63

Query: 57  ---EVIVVSIGSCKVEEVLKNSLAMGADRG--ILIESNETLEPLSIAKILREIVKKENPI 111
              E++  S G  K +++L+ ++AMGADRG  +++E  + LEPL +AK+L+++V +    
Sbjct: 64  KVEEIVAFSAGPPKSQDILRTAMAMGADRGLHVVVEEKDALEPLGVAKLLKKVVDENKSS 123

Query: 112 IVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLP 171
           +VI GKQ+ D+++ QTGQMLA L+ WPQAT  S I   D    V REV  G  T++  LP
Sbjct: 124 LVILGKQSIDDDAGQTGQMLAGLLNWPQATQASKITFKDETVEVIREVDGGVETLKAKLP 183

Query: 172 AVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLR 231
            VIT DL LNEPRY SLPNI+KA+KK+++KK   D+ +D   RLK ++  E  A + G++
Sbjct: 184 MVITTDLRLNEPRYASLPNIMKAKKKKLDKKTLGDYGLDTELRLKTVKVAEPEARKAGVK 243

Query: 232 LYSTTKLIEILK 243
           +     +I  LK
Sbjct: 244 VEDVDGMISKLK 255


>gi|157108610|ref|XP_001650309.1| electron transfer flavoprotein beta-subunit [Aedes aegypti]
 gi|108879274|gb|EAT43499.1| electron transfer flavoprotein beta-subunit [Aedes aegypti]
          Length = 210

 Score =  202 bits (515), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 99/195 (50%), Positives = 140/195 (71%), Gaps = 4/195 (2%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  K+R+K D SG+ TE  K SMNPFDEIA+EE+++++EK IA+EV+ V
Sbjct: 3   RVLVGVKRVIDYAVKIRVKPDKSGVVTEGVKHSMNPFDEIAVEEAVKMKEKKIASEVVAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIESN----ETLEPLSIAKILREIVKKENPIIVIAGK 117
           S+G  + +EVL+ +LAMGADRGI IE +    E L+P+ ++KIL ++ + E   +VI GK
Sbjct: 63  SVGPAQSQEVLRTALAMGADRGIHIEVSGKDYELLQPIHVSKILAKLAQDEKADLVILGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D++ NQT QM AAL+ WPQATF S ++   +   V REV  G  T++T +PAVI+ D
Sbjct: 123 QAIDDDCNQTAQMTAALLDWPQATFASKVEKTGDGLTVVREVDGGLETIKTKVPAVISAD 182

Query: 178 LNLNEPRYISLPNII 192
           L LN PRY +LPNI+
Sbjct: 183 LRLNTPRYATLPNIM 197


>gi|260770217|ref|ZP_05879150.1| electron transfer flavoprotein beta subunit [Vibrio furnissii CIP
           102972]
 gi|260615555|gb|EEX40741.1| electron transfer flavoprotein beta subunit [Vibrio furnissii CIP
           102972]
          Length = 232

 Score =  202 bits (514), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 99/227 (43%), Positives = 153/227 (67%)

Query: 19  IKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAM 78
           +K+D SG+ET N K+++NPF EIA+EE+++LRE GIA EVIVVS G    +E L+ +LA+
Sbjct: 1   MKSDGSGVETHNVKMAINPFCEIAVEEAIRLREAGIAEEVIVVSAGDATCQEQLRAALAL 60

Query: 79  GADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWP 138
           GADR I IE++   EPL++AK+L+ ++  E P +V+ GKQ+ D ++NQ  QMLAAL   P
Sbjct: 61  GADRAIHIETDGAPEPLNVAKLLKAVMASEAPGLVLLGKQSIDTDNNQVAQMLAALTERP 120

Query: 139 QATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKR 198
           Q TF S + +  +  +VTRE+  G  T++  LPA+I+ DL LNEPRY SLPNI+KA++K 
Sbjct: 121 QGTFASKVDVQGDAVLVTREIDGGLETLKLALPAIISTDLRLNEPRYASLPNIMKAKRKP 180

Query: 199 IEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIEILKSK 245
           ++        + LT   +++        + G+ + S ++L++ LK++
Sbjct: 181 LDVTTPDALGVTLTTHQQIMDVMPPPERKAGVMVASVSELVDKLKNE 227


>gi|330810514|ref|YP_004354976.1| Electron transfer flavoprotein, beta subunit [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327378622|gb|AEA69972.1| Electron transfer flavoprotein, beta subunit [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 249

 Score =  202 bits (514), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 104/244 (42%), Positives = 163/244 (66%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K  I+ N KVR+K D S +E    K+++NPF EIA+EE+++L+EKG+ +EV+V
Sbjct: 1   MKVLVAVKRAIDPNVKVRVKADGSDVELNGVKMALNPFCEIAVEEAIRLKEKGLVSEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+G+   +E L+ +LA+GADR +L+E++E LEPL++AK L +++ +E P +++ GKQ  
Sbjct: 61  VSVGTSAAQEQLRTALALGADRALLVETSELLEPLNVAKYLSKVIDQEKPQLILCGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D E+NQ GQM+A L+   QAT+ S I  +D   +V REV  G+  +   +PAV+T DL L
Sbjct: 121 DQENNQVGQMVAQLIGSGQATYASAINHVDGQWVVEREVDGGSQVLALAMPAVVTCDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           N+PRY SLPNI+KA+KK +E   A      +    ++L        + G+ + S  +L++
Sbjct: 181 NQPRYASLPNIMKAKKKPLEIIAADTLGASVKEHARLLGVVPPAVRKAGINVGSVAELVD 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKN 244


>gi|38047567|gb|AAR09686.1| similar to Drosophila melanogaster CG7834 [Drosophila yakuba]
          Length = 203

 Score =  202 bits (513), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 142/200 (71%), Gaps = 4/200 (2%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  KVR+K D SG+ T+  K SMNPFDEIA+EE+++L+EK +A EVI V
Sbjct: 3   RVLVGVKRVIDYAVKVRVKPDKSGVVTQGVKHSMNPFDEIAVEEAVKLKEKKLAEEVIAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAGK 117
           S+G  + +EV++ +LAMGADRG+ +E      E L+P+ ++KIL ++   E   +VI GK
Sbjct: 63  SVGPAQSQEVIRTALAMGADRGVHVEIPAAEYELLQPIHVSKILAKLALDEKADLVILGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D+++NQT QM AA++ WPQ TF + I+  D    +TRE+  G  T++T  PAV++ D
Sbjct: 123 QAIDDDANQTAQMTAAVLDWPQGTFCNKIEKTDAGLTITREIDGGLETIKTKTPAVLSAD 182

Query: 178 LNLNEPRYISLPNIIKARKK 197
           L LN PRY +LPNI+KA+KK
Sbjct: 183 LRLNTPRYATLPNIMKAKKK 202


>gi|294892019|ref|XP_002773854.1| Electron transfer flavoprotein subunit beta, putative [Perkinsus
           marinus ATCC 50983]
 gi|239879058|gb|EER05670.1| Electron transfer flavoprotein subunit beta, putative [Perkinsus
           marinus ATCC 50983]
          Length = 256

 Score =  201 bits (512), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 106/250 (42%), Positives = 161/250 (64%), Gaps = 6/250 (2%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           K LV IK V++Y  KVR+    +G++  N K S+NPF EIA+EE+L+++E G  +EV+ V
Sbjct: 3   KALVCIKRVVDYAVKVRVMASKAGVDIANVKHSVNPFCEIAVEEALRMKEAGRLSEVVAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAGK 117
             G  KV E L+  LAMG DR I ++    +++ L PL +AK++++IV++E+P++V+ GK
Sbjct: 63  CAGPDKVTEQLRQVLAMGCDRAIHLQTHLRTDQELPPLMVAKLIKKIVEREDPLLVLMGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHA--IVTREVGHGTMTMETPLPAVIT 175
           Q  D +  QT Q+LA ++ WPQAT  S I + D++    V REV  G  T+  PLPAV++
Sbjct: 123 QAIDGDMGQTSQLLAGMLGWPQATCASKIVVSDDNTELTVDREVDTGIQTVHLPLPAVMS 182

Query: 176 VDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYST 235
            DL LN PRY +LPN++KA+KK IE        +DL   L+V   EE  A + G+ L + 
Sbjct: 183 ADLRLNTPRYATLPNLMKAKKKPIEVIPVETLGVDLLSTLQVTSVEEPPARKAGVILNNV 242

Query: 236 TKLIEILKSK 245
            +L++ LK++
Sbjct: 243 DELVDKLKNE 252


>gi|126642663|ref|YP_001085647.1| electron transfer flavoprotein beta-subunit [Acinetobacter
           baumannii ATCC 17978]
          Length = 217

 Score =  201 bits (512), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 95/217 (43%), Positives = 150/217 (69%)

Query: 33  ISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETL 92
           +S+NPF EIA+EE+++L+EKG  +E++VVSIG  + +E +++++A+GADRGIL+E+ + +
Sbjct: 1   MSINPFCEIAVEEAVRLKEKGTVSEIVVVSIGPKEAQEQIRSAMALGADRGILVETTDEI 60

Query: 93  EPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNH 152
             L +AKIL+ +V  E P +++ GKQ  D++SNQ GQML AL+   Q TF S +K+    
Sbjct: 61  GALEVAKILKGVVDAEKPELILLGKQAIDDDSNQVGQMLGALLGAGQGTFASEVKVDGGK 120

Query: 153 AIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLT 212
             VTRE+  G  T+E  LPA+IT DL LNEPRY +LPNI+KARKK ++ K   D+ +   
Sbjct: 121 VQVTREIDGGLQTVELALPAIITTDLRLNEPRYAALPNIMKARKKPLDTKSPADYGVTAG 180

Query: 213 PRLKVLRFEENRAERKGLRLYSTTKLIEILKSKHDLL 249
            +LK ++ E     + G+++ S  +L+E LK++  ++
Sbjct: 181 TKLKTIKVEAPAERKAGVQVKSVDELVEKLKNEAKVI 217


>gi|310792179|gb|EFQ27706.1| electron transfer flavoprotein domain-containing protein
           [Glomerella graminicola M1.001]
          Length = 258

 Score =  201 bits (512), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 117/250 (46%), Positives = 166/250 (66%), Gaps = 7/250 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREK----GIAT 56
           ++ILVP+K VI+Y  K R+    +G+ET   K SMNPFDE+++EES+++REK    G   
Sbjct: 4   LRILVPVKRVIDYAVKPRVNKAQTGVETAGVKHSMNPFDELSVEESVRIREKKRAPGGVE 63

Query: 57  EVIVVSIGSCKVEEVLKNSLAMGADRGILIESNET--LEPLSIAKILREIVKKENPIIVI 114
           ++ V+S G  K  +VL+ ++AMGADR I +E+ E   LEPLS+AK+LR+  ++    ++I
Sbjct: 64  DITVISAGPPKAVDVLRTAMAMGADRAIHVETKEGDDLEPLSVAKLLRKAAEEHKSNLII 123

Query: 115 AGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAI-VTREVGHGTMTMETPLPAV 173
            GKQ+ D+++NQTGQMLA L+ W QAT  S +K  +   + VTREV  G  T++  LP V
Sbjct: 124 LGKQSIDDDANQTGQMLAGLLGWSQATSASVVKFGEGDTVSVTREVDGGVETVKGKLPMV 183

Query: 174 ITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLY 233
           IT DL LNEPRY SLPNI+KA+KK +EKKK  D+ I +  RLKVL+  E    + G ++ 
Sbjct: 184 ITTDLRLNEPRYASLPNIMKAKKKPLEKKKLADYGIGVEKRLKVLKVTEPPVRQGGGKVE 243

Query: 234 STTKLIEILK 243
               L+  LK
Sbjct: 244 DVNGLVAKLK 253


>gi|126274787|ref|XP_001387639.1| predicted protein [Scheffersomyces stipitis CBS 6054]
 gi|126213509|gb|EAZ63616.1| predicted protein [Pichia stipitis CBS 6054]
          Length = 255

 Score =  201 bits (511), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 166/247 (67%), Gaps = 3/247 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLRE--KGIATEV 58
           ++ILVP+K VI++  K RI    +G+ET+  K S+NPF +IALEES++++E  K     +
Sbjct: 5   LRILVPVKRVIDFAIKPRINKAQTGVETKGVKFSINPFCDIALEESVRIKEADKDKVENI 64

Query: 59  IVVSIGSCKVEEVLKNSLAMGADRGILIE-SNETLEPLSIAKILREIVKKENPIIVIAGK 117
            VVS+G  K ++VL+ +LA GAD   LI+  +E +EPL++AK+L+++V+K+   +VI GK
Sbjct: 65  HVVSVGPAKAQDVLRTALAKGADNSTLIDVGDEEVEPLTVAKLLQKVVEKDKSNLVILGK 124

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D+++NQTGQMLA L+ WPQAT  S I+I      VTRE+  G  T+   LP VIT D
Sbjct: 125 QAIDDDANQTGQMLAGLLNWPQATNASKIEIDGETVTVTREIDGGADTLRAKLPLVITTD 184

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LNEPRY SLPNI+KA+KK ++K K +D  IDL  RL+ L+  E      G+++ +  +
Sbjct: 185 LRLNEPRYASLPNIMKAKKKPLDKLKPSDLNIDLVKRLETLKVVEPPVREAGIKVETVDE 244

Query: 238 LIEILKS 244
           L+  LK 
Sbjct: 245 LVAKLKD 251


>gi|25141345|ref|NP_490973.2| hypothetical protein F23C8.5 [Caenorhabditis elegans]
 gi|16604166|gb|AAD03129.2| Hypothetical protein F23C8.5 [Caenorhabditis elegans]
          Length = 255

 Score =  201 bits (511), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 106/250 (42%), Positives = 159/250 (63%), Gaps = 5/250 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++Y  K+R+K D SG+ TE  + SMNPFDEIALEE+++L+EK +ATEV+ 
Sbjct: 1   MKILVGVKRVVDYAVKIRVKPDRSGVVTEGVQHSMNPFDEIALEEAVKLKEKKLATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNET----LEPLSIAKILREIVKKENPIIVIAG 116
            S+G  K  EVL+ +LA GAD+ + ++  +     LE   +AK L++IV++E    V  G
Sbjct: 61  FSLGGPKSAEVLRTALAKGADKAVHVQVTDAEAGKLESFHVAKALQKIVEQEKFDAVFLG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIID-NHAIVTREVGHGTMTMETPLPAVIT 175
           KQ  D++S+QT  +LA L+ WPQA + S ++     H  VTRE+  G  T++  +P V++
Sbjct: 121 KQAIDDDSSQTAPILAGLLEWPQALYASKVEDAGAGHMKVTREIDGGLDTIKVKVPFVLS 180

Query: 176 VDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYST 235
            DL LNEPRY +LPNI+KA+KK ++     D  +D+TP+ + L   E    + G  +   
Sbjct: 181 ADLRLNEPRYATLPNIMKAKKKPLKNIPIKDLNVDITPQTETLEVTEPPVRQAGGFVDDV 240

Query: 236 TKLIEILKSK 245
           + L+  LK K
Sbjct: 241 SALVAKLKEK 250


>gi|225706664|gb|ACO09178.1| Electron transfer flavoprotein subunit beta [Osmerus mordax]
          Length = 254

 Score =  201 bits (511), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 167/246 (67%), Gaps = 4/246 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  K+R+K D+SG+ T+  K SMNPF EIA+EE+++L+EK +  EV+ V
Sbjct: 4   RVLVGVKRVIDYAVKIRVKPDHSGVVTDGVKHSMNPFCEIAVEEAVKLKEKKLIKEVVAV 63

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIE----SNETLEPLSIAKILREIVKKENPIIVIAGK 117
           S G  +V+E ++ +LAMGADRGI +E      ETL PL ++KI   + KKEN  +VI GK
Sbjct: 64  SCGPQQVQETIRTALAMGADRGIHVEVTGNDYETLGPLQVSKIFAALAKKENAQLVILGK 123

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D++ NQTGQM AAL+ WPQ TF S + +  +   V RE+  G  T++  +PAV+T D
Sbjct: 124 QAIDDDCNQTGQMTAALLDWPQGTFASEVALDGDKVKVVREIDGGLETIKINMPAVVTAD 183

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LN PRY +LPNI+KA+KK+I   K +D  +DLT R++V+R +E    + G+++ +   
Sbjct: 184 LRLNTPRYATLPNIMKAKKKKIANVKPSDLGVDLTSRVEVVRVDEPPQRQAGVKVDTVDD 243

Query: 238 LIEILK 243
           L+  LK
Sbjct: 244 LVGKLK 249


>gi|154338590|ref|XP_001565517.1| electron transfer flavoprotein [Leishmania braziliensis
           MHOM/BR/75/M2904]
 gi|134062569|emb|CAM39011.1| putative electron transfer flavoprotein [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 258

 Score =  201 bits (511), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 100/246 (40%), Positives = 160/246 (65%), Gaps = 6/246 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           +K+ V +K V++Y  KVR+K++   ++T N+K+S+NPFDEIA+EE++QL+EK +A EV+ 
Sbjct: 9   LKVAVCVKRVVDYTVKVRVKDN--KVQTANSKMSVNPFDEIAMEEAIQLKEKKMADEVVA 66

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILI----ESNETLEPLSIAKILREIVKKENPIIVIAG 116
           ++IGS K EEVL+ ++A+G D+ + +     + E+LE L++A+IL+++ ++  P I + G
Sbjct: 67  ITIGSKKAEEVLRTAMALGCDKAMHVVVPEAAEESLESLAVARILQKLHEEIKPDIWVLG 126

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D +   T Q+LA L+  PQ TF S +++ +    VTREV  G   +E  +P V+  
Sbjct: 127 KQAVDGDFGCTAQLLAGLLDVPQGTFASKVEVTNQKITVTREVDAGRQVVELSMPCVLAA 186

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LN PR+  LPNI+KARKK I+ K    F +D+TPRL      E  A + G++L +  
Sbjct: 187 DLRLNTPRFPKLPNIMKARKKPIDTKDVAAFGVDITPRLTTETVTEPAARKAGIKLKTVD 246

Query: 237 KLIEIL 242
           +  + L
Sbjct: 247 EFYDKL 252


>gi|319941850|ref|ZP_08016171.1| electron transfer flavoprotein beta-subunit [Sutterella
           wadsworthensis 3_1_45B]
 gi|319804503|gb|EFW01373.1| electron transfer flavoprotein beta-subunit [Sutterella
           wadsworthensis 3_1_45B]
          Length = 249

 Score =  201 bits (511), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 165/249 (66%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++   KVR   D SG +T+  ++++NPFDEIA+EE+++L+E G   EV+ 
Sbjct: 1   MKILVAVKRVVDAKVKVRPLPDRSGPDTKLARMAINPFDEIAVEEAVELKEAGKVQEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           V+IG  K  +VL+ ++A+GADR I + ++E +EPL+ AKIL +I ++E P +++ GKQ  
Sbjct: 61  VTIGGAKSVDVLRTAMAIGADRSIHVSTDEMMEPLAAAKILAKIAEREKPDLILMGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D+++ QTG ML+ L+  P A F S I++ D   IVTRE   GT T+   LPAV+T DL L
Sbjct: 121 DDDAAQTGPMLSELLNLPLAAFASEIELADGRLIVTRETDGGTQTISVTLPAVVTADLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
            EPRY++LP++ KARKK +E  +     I+  PR K+L  E   A + G+ + +  +LI+
Sbjct: 181 AEPRYVTLPSMAKARKKPVETVELASLGINTAPRQKLLGVEPPPARKAGVMVANVDELIQ 240

Query: 241 ILKSKHDLL 249
            L+ +  LL
Sbjct: 241 KLRDEVHLL 249


>gi|307177606|gb|EFN66681.1| Electron transfer flavoprotein subunit beta [Camponotus floridanus]
          Length = 253

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 109/250 (43%), Positives = 166/250 (66%), Gaps = 5/250 (2%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  K+R+K D SG+ T+  K SMNPFDEIA+EE+++++EK IA EVI V
Sbjct: 3   RVLVGVKRVIDYAVKIRVKPDKSGVVTDGIKHSMNPFDEIAIEEAVRMKEKKIAQEVIAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIESN----ETLEPLSIAKILREIVKKENPIIVIAGK 117
           S G  + ++ ++ +LAMGADRGI +E +    +TL+P+ ++K+L ++ ++E   +VI GK
Sbjct: 63  SCGPAQSQDTIRTALAMGADRGIHVEISGPEYQTLQPIHVSKMLAKLAQEEKVDLVILGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D+++NQT QM A ++ WP  TF S ++  +    VTRE+  G   ++   PAV++ D
Sbjct: 123 QAIDDDNNQTAQMTAGVLDWPAGTFCSKVENNNGELTVTREIDGGLEVIKMKTPAVLSAD 182

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LNEPRY +LPNI+KA+KK I+K    D  +D+TPR+++L  E+    + G  L     
Sbjct: 183 LRLNEPRYATLPNIMKAKKKPIKKVTPKDLGVDITPRIEILSVEDPPVRQAGAILPDVDT 242

Query: 238 LIEILK-SKH 246
           LI  LK S H
Sbjct: 243 LISKLKESGH 252


>gi|119182018|ref|XP_001242167.1| hypothetical protein CIMG_06063 [Coccidioides immitis RS]
 gi|303318885|ref|XP_003069442.1| electron transfer flavoprotein subunit beta, putative [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240109128|gb|EER27297.1| electron transfer flavoprotein subunit beta, putative [Coccidioides
           posadasii C735 delta SOWgp]
 gi|320041201|gb|EFW23134.1| electron transfer flavoprotein [Coccidioides posadasii str.
           Silveira]
          Length = 263

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 117/254 (46%), Positives = 165/254 (64%), Gaps = 11/254 (4%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLRE-KGI--ATE 57
           ++ILVPIK VI++  K RI    +G+ET   K S+NPFDE+++EE+++LRE KG     +
Sbjct: 5   LRILVPIKRVIDFAIKPRINKTQTGVETAGVKHSLNPFDELSVEEAVRLRERKGPMNVAD 64

Query: 58  VIVVSIGSCKVEEVLKNSLAMGADRGILIESNET------LEPLSIAKILREIVKKENPI 111
           ++ +S G  K ++ L+ ++AMGADRG+L++  E       LEPL++AK+L+ +V+KEN  
Sbjct: 65  ILALSAGGPKCQDTLRTAMAMGADRGLLVDVPEGKGDEGGLEPLTVAKLLKSVVEKENIN 124

Query: 112 IVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAI--VTREVGHGTMTMETP 169
           +V  GKQ  D +  QTGQMLA L+ WPQAT  S + + D      VTREV  G  T++  
Sbjct: 125 LVFLGKQAIDGDQGQTGQMLAGLLGWPQATQASKVTVKDAEGSIEVTREVDGGVETLKAK 184

Query: 170 LPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKG 229
           LP +IT DL LNEPRY SLPNI+KA+KK +EKK   DF ++ T RLK L+  E  A + G
Sbjct: 185 LPMIITTDLRLNEPRYASLPNIMKAKKKPLEKKTLADFGVENTKRLKTLKVTEPPARQGG 244

Query: 230 LRLYSTTKLIEILK 243
            ++     LI  LK
Sbjct: 245 GKVEDVDGLIGRLK 258


>gi|289740961|gb|ADD19228.1| electron transfer flavoprotein beta subunit [Glossina morsitans
           morsitans]
          Length = 253

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 105/246 (42%), Positives = 163/246 (66%), Gaps = 4/246 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  KVR+K D +G+ T+  K SMNPFDEIA+EE+++++EK +A+EVI V
Sbjct: 3   RVLVGVKRVIDYAVKVRVKPDKTGVVTDGVKHSMNPFDEIAIEEAVKMKEKKLASEVIAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIESN----ETLEPLSIAKILREIVKKENPIIVIAGK 117
           S+G  + +E+++ +LAMGADRGI +E +    + L+P+ +AKIL ++   E   +VI GK
Sbjct: 63  SVGPTQSQEIIRTALAMGADRGIHVEVSGKEYDLLQPIHVAKILSKLALDEKADLVILGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D++SNQT QM AA++ WPQ TF + ++  D    + RE+  G  T++T LPAV++ D
Sbjct: 123 QAIDDDSNQTAQMTAAMLDWPQGTFCNKVEKSDAGLTIVREIDGGLETIKTKLPAVLSAD 182

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LN PRY +LPNI+KA+KK ++K    D  +D   R++++   +    + G  +     
Sbjct: 183 LRLNTPRYATLPNIMKAKKKPLKKIAPKDVGVDTAARIEIVSVVDPPVRQAGAVVPDVDA 242

Query: 238 LIEILK 243
           LI  LK
Sbjct: 243 LIAKLK 248


>gi|218460636|ref|ZP_03500727.1| electron transport flavoprotein, beta subunit [Rhizobium etli Kim
           5]
          Length = 193

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 140/193 (72%)

Query: 57  EVIVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAG 116
           EV+VVSIG  K EE L+ +LAMGAD  ILIE+++ +EPL++AKIL+ +   E P ++I G
Sbjct: 1   EVVVVSIGPAKAEETLRTALAMGADPAILIETDDQVEPLAVAKILKAVADAEKPGLIITG 60

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++SNQTGQMLAAL+   QATF S I+I D  A VTREV  G  T+E  LPAV+T 
Sbjct: 61  KQAIDDDSNQTGQMLAALLGTAQATFASRIEIGDGKATVTREVDGGLQTIEIKLPAVVTT 120

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY SLPNI+KA+KK ++KK   DF +D TPRLKVL+ EE    + G+++ S  
Sbjct: 121 DLRLNEPRYASLPNIMKAKKKPLDKKSPADFGVDTTPRLKVLKTEEPSGRKAGVKVKSVA 180

Query: 237 KLIEILKSKHDLL 249
           +L++ LK++  +L
Sbjct: 181 ELVDKLKNEAGVL 193


>gi|312961047|ref|ZP_07775552.1| electron transfer flavoprotein beta-subunit [Pseudomonas
           fluorescens WH6]
 gi|311284705|gb|EFQ63281.1| electron transfer flavoprotein beta-subunit [Pseudomonas
           fluorescens WH6]
          Length = 249

 Score =  200 bits (508), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 109/244 (44%), Positives = 168/244 (68%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MK+LV +K  I+ N KVR+K D S +E    K+++NPF EIA+EE+++L+EKG+A+EV+V
Sbjct: 1   MKVLVAVKRAIDPNVKVRVKADGSDVELNGVKMALNPFCEIAVEEAIRLKEKGVASEVVV 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS+GS   +E L+ +LA+GADR +L+E++  LEPL++AK L +++  E P +++ GKQ  
Sbjct: 61  VSVGSSAAQEQLRTALALGADRALLVETSAVLEPLNVAKYLSKVIDNEKPQLILFGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDLNL 180
           D E+NQ GQM+A L+   QAT+ S I  ID+  +V REV  G+ T+   +PAV+T DL L
Sbjct: 121 DQENNQVGQMVAQLIGSGQATYASCISYIDDQWVVAREVDGGSQTLALSVPAVVTCDLRL 180

Query: 181 NEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKLIE 240
           NEPRY SLPNI+KA+KK +E   A      +   +++L     +  + G+++ S ++L+E
Sbjct: 181 NEPRYASLPNIMKAKKKPLEVIAADTLGASVKEHVRLLGVASPQVRKAGIKVGSVSELVE 240

Query: 241 ILKS 244
            LK+
Sbjct: 241 KLKN 244


>gi|324504492|gb|ADY41942.1| Electron transfer flavoprotein subunit beta [Ascaris suum]
          Length = 254

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/249 (44%), Positives = 165/249 (66%), Gaps = 4/249 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           M+ LV +K VI+Y  KVR++ D  G+  EN + SMNPFDEIALEE+++L+EK IA E++ 
Sbjct: 1   MRALVGVKRVIDYAIKVRVRPDKMGVVKENVQHSMNPFDEIALEEAVRLKEKKIANEIVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESN----ETLEPLSIAKILREIVKKENPIIVIAG 116
           VS+G  K +EVL+ +LA GAD+ IL+E +    E +EPL +AK+L +I ++E    +  G
Sbjct: 61  VSLGPSKAQEVLRTALAKGADKAILVEVDDATVEKIEPLHVAKVLAKIAEEEKVDFIFLG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++S QTGQ++A ++ WPQA F S ++   ++  VTREV  G   +   LPAV++ 
Sbjct: 121 KQAIDDDSCQTGQLVAGILGWPQAMFASKVEPDGDYFKVTREVDGGLDKIRVKLPAVLSA 180

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTT 236
           DL LNEPRY +LPNI+KA+KK ++KKK  D+ I++  + ++L+  E    + G  +    
Sbjct: 181 DLRLNEPRYATLPNIMKAKKKPLQKKKPADYGIEIKTQTQILQVTEPPVRKAGGFVEDVP 240

Query: 237 KLIEILKSK 245
            LI  LK K
Sbjct: 241 TLIAKLKEK 249


>gi|268565283|ref|XP_002639395.1| Hypothetical protein CBG03983 [Caenorhabditis briggsae]
 gi|187036176|emb|CAP24782.1| hypothetical protein CBG_03983 [Caenorhabditis briggsae AF16]
          Length = 255

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 106/250 (42%), Positives = 160/250 (64%), Gaps = 5/250 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           MKILV +K V++Y  K+R+K D SG+ TE  + SMNPFDEIALEE+++L+EK +ATEV+ 
Sbjct: 1   MKILVGVKRVVDYAVKIRVKPDRSGVFTEGVQHSMNPFDEIALEEAVKLKEKKLATEVVA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNET----LEPLSIAKILREIVKKENPIIVIAG 116
            S+G  K  EVL+ +LA GAD+ I ++ ++     LE   +AK L++IV++E    V  G
Sbjct: 61  FSLGGPKSAEVLRTALAKGADKAIHVQVSDDEAGKLESFHVAKTLQKIVEQEKFDAVFLG 120

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNI-KIIDNHAIVTREVGHGTMTMETPLPAVIT 175
           KQ  D++S+QT  +LA L+ WPQA + S + +    H  VTRE+  G  T++  +P V++
Sbjct: 121 KQAIDDDSSQTAPILAGLLDWPQALYASKVEEGGSGHMKVTREIDVGLDTIKVKVPFVLS 180

Query: 176 VDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYST 235
            DL LNEPRY +LPNI+KA+KK ++     D  +D+TP+ + +   E    + G  +   
Sbjct: 181 ADLRLNEPRYATLPNIMKAKKKPLKNIPIKDLGVDITPQTETVEVTEPPVRKAGGFVEDV 240

Query: 236 TKLIEILKSK 245
           + L+  LK K
Sbjct: 241 SALVAKLKEK 250


>gi|156543370|ref|XP_001608218.1| PREDICTED: similar to electron-transfer-flavoprotein beta
           polypeptide [Nasonia vitripennis]
          Length = 253

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 159/246 (64%), Gaps = 4/246 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  K+R+K D SG+ T+  K SMNPFDEIA+EE+++++EK +A EVI V
Sbjct: 3   RVLVGVKRVIDYAVKIRVKPDKSGVITDGVKHSMNPFDEIAIEEAVRMKEKKLAQEVIAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIESN----ETLEPLSIAKILREIVKKENPIIVIAGK 117
           S G  + +E L+ +LAMGAD+GI +E +    ETL+P+ ++KIL ++ + E   +VI GK
Sbjct: 63  SCGPAQAQETLRTALAMGADKGIHVEISGPEYETLQPIHVSKILAKLAQDEKADLVIVGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D++ NQT QM   ++ WP ATF S I+       VTRE+  G   ++   PAV++ D
Sbjct: 123 QAIDDDCNQTAQMTGGVLGWPTATFCSKIEHGKGEMTVTREIDGGLEVIKVKTPAVLSAD 182

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LNEPRY +LPNI+KA+KK ++K    D  +D+  R++V+  E+    + G  L     
Sbjct: 183 LRLNEPRYATLPNIMKAKKKPVKKVSPKDLGVDIASRIEVISVEDPPVRQAGSILPDVDT 242

Query: 238 LIEILK 243
           L+  LK
Sbjct: 243 LVAKLK 248


>gi|47085679|ref|NP_998163.1| electron transfer flavoprotein subunit beta [Danio rerio]
 gi|28374430|gb|AAH45971.1| Electron-transfer-flavoprotein, beta polypeptide [Danio rerio]
 gi|182888880|gb|AAI64332.1| Electron-transfer-flavoprotein, beta polypeptide [Danio rerio]
          Length = 254

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 112/246 (45%), Positives = 166/246 (67%), Gaps = 4/246 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  K+R+K D++G+ T+  K SMNPF EIA+EE+++L+EK +  EV+ V
Sbjct: 4   RVLVGVKRVIDYAVKIRVKPDHTGVVTDGVKHSMNPFCEIAVEEAVKLKEKKLIKEVVAV 63

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIESN----ETLEPLSIAKILREIVKKENPIIVIAGK 117
           S G  +V+E ++ +LAMGADRGI +E +    ETL PL ++KIL  + KKE   ++I GK
Sbjct: 64  SCGPQQVQETIRTALAMGADRGIHVEVSGKDYETLGPLQVSKILAALAKKEEASLIILGK 123

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D++ NQTGQM AAL+ WPQ TF S +    +   V RE+  G  T++  LPAV+T D
Sbjct: 124 QAIDDDCNQTGQMTAALLDWPQGTFASELAFEADKLKVVREIDGGLETIKIKLPAVVTAD 183

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LN PRY +LPNI+KA+KK+I   K  D  +D++ RL+VL+ +E    + G+++ +   
Sbjct: 184 LRLNTPRYATLPNIMKAKKKKIAMVKPADLGVDVSSRLEVLKVDEPPTRQAGVKVETVED 243

Query: 238 LIEILK 243
           L+  LK
Sbjct: 244 LVGKLK 249


>gi|50291657|ref|XP_448261.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49527573|emb|CAG61222.1| unnamed protein product [Candida glabrata]
          Length = 259

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 163/251 (64%), Gaps = 7/251 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREK--GIATEV 58
           ++ILVP+K V+++  K R+    +GIE    K S+NPFD+IA+EE+++++EK   +    
Sbjct: 5   LRILVPVKRVVDFQIKPRVNKTLTGIEKSGIKFSINPFDDIAVEETVRIKEKHGDLVEHT 64

Query: 59  IVVSIGSCKVEEVLKNSLAMGADRGILIESNE-TLEPLSIAKILREIVKKENPIIVIAGK 117
             VSIG  K +++L+N LA G D   LI+  +  LEPL++AK+L+ IV+K+N  ++I GK
Sbjct: 65  QAVSIGPAKAQDILRNCLAKGIDNVSLIDCKDLELEPLAVAKVLKNIVEKQNINLIIMGK 124

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIV--TREVGHGTMTMETPLPAVIT 175
           Q  D++ N TGQMLA L+ WPQAT  + + I+ +   V  TRE+  G  T++  LP +IT
Sbjct: 125 QAIDDDFNHTGQMLAGLLNWPQATNAAKVDILADEGKVRITREIDGGEETLKASLPLIIT 184

Query: 176 VDLNLNEPRYISLPNIIKARKKRIEK-KKATDFA-IDLTPRLKVLRFEENRAERKGLRLY 233
            DL LN PRY+ LPN++KA+KK +EK     DFA ID  PRL++L   E  A+  G+ + 
Sbjct: 185 TDLRLNTPRYVGLPNLMKAKKKPMEKLTLEKDFADIDTKPRLEILSVNEPNAKEPGITVG 244

Query: 234 STTKLIEILKS 244
           S  +L++ LK 
Sbjct: 245 SVDELVQKLKD 255


>gi|209521639|ref|ZP_03270333.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           H160]
 gi|209497917|gb|EDZ98078.1| Electron transfer flavoprotein alpha/beta-subunit [Burkholderia sp.
           H160]
          Length = 160

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 125/159 (78%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           M++LV +K V+++N KVR+K+D +G++  N K+SMNPFDEIA+EE+++L+E G+ATEVI 
Sbjct: 1   MRVLVAVKRVVDFNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIA 60

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQTT 120
           VS G  + +E L+ +LA+GADR ILIESNE L+PL++AK+L+ +V KE P +VI GKQ  
Sbjct: 61  VSAGVTQCQETLRTALAIGADRAILIESNEDLQPLAVAKLLKALVDKEQPSLVILGKQAI 120

Query: 121 DNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREV 159
           D++SNQTGQMLAAL   PQATF S I + D  A V+REV
Sbjct: 121 DDDSNQTGQMLAALANLPQATFASKIVVADGKATVSREV 159


>gi|296414159|ref|XP_002836770.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295631609|emb|CAZ80961.1| unnamed protein product [Tuber melanosporum]
          Length = 253

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 110/245 (44%), Positives = 158/245 (64%), Gaps = 2/245 (0%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKG--IATEV 58
           ++ILVPIK VI+Y  K R+    + + T   K+SMNPFDE+++EES++LRE+      ++
Sbjct: 4   LRILVPIKQVIDYAIKPRVNATRTAVVTSGVKMSMNPFDELSIEESVRLRERNRDAVRDI 63

Query: 59  IVVSIGSCKVEEVLKNSLAMGADRGILIESNETLEPLSIAKILREIVKKENPIIVIAGKQ 118
           +  S G  K  + L+ ++AMGADR +L      LEPL +AK+LRE+V KE   +VI GKQ
Sbjct: 64  LAFSAGPAKAADTLRTAMAMGADRALLQGEGSDLEPLFVAKLLREVVHKEGCNMVICGKQ 123

Query: 119 TTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVDL 178
           + D++S QTGQMLA L+ W QAT  + + +  +  +VT+EV  G   +   LPAV+T DL
Sbjct: 124 SIDDDSGQTGQMLAGLLGWGQATQAAKVDVQGSEVVVTKEVDGGEEVVRVKLPAVVTTDL 183

Query: 179 NLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTKL 238
            LNEPRY +LPNI+KA+KK IEKK   DF+++   RL+ L+  E    + G ++ S   L
Sbjct: 184 RLNEPRYATLPNIMKAKKKPIEKKTLADFSVEFGKRLETLKVVEPPPRQGGGKVDSVDGL 243

Query: 239 IEILK 243
           I  LK
Sbjct: 244 ISRLK 248


>gi|198424300|ref|XP_002131618.1| PREDICTED: similar to electron-transfer-flavoprotein, beta
           polypeptide [Ciona intestinalis]
          Length = 253

 Score =  199 bits (505), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 108/246 (43%), Positives = 165/246 (67%), Gaps = 4/246 (1%)

Query: 2   KILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIVV 61
           ++LV +K VI+Y  K+R+K D SG+ TE  K SMNPFDEIA+EE+++L+EK  ATEVI V
Sbjct: 3   RVLVGVKRVIDYAVKIRVKPDKSGVVTEGVKHSMNPFDEIAVEEAIRLKEKKFATEVIAV 62

Query: 62  SIGSCKVEEVLKNSLAMGADRGILIE--SNETLE--PLSIAKILREIVKKENPIIVIAGK 117
           + G  + +E L+ +LAMGADRGI +E  +++ ++  PL I+KI  ++ ++E   ++I GK
Sbjct: 63  TCGPTQSQETLRTALAMGADRGIHVEIPADDYVKTGPLQISKIFAKLAEQEKANLIILGK 122

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITVD 177
           Q  D ++NQT QM AA++ W Q TF S +K+      V REV  G  T++  +PAV++ D
Sbjct: 123 QAIDGDNNQTAQMTAAVLDWAQGTFASELKLEGEKLTVVREVDGGLETIDLKMPAVVSAD 182

Query: 178 LNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYSTTK 237
           L LNEPRY +LPNI+KA+KK++ K  A D  +DL   +++L   +      G+++ +T +
Sbjct: 183 LRLNEPRYATLPNIMKAKKKKVAKLTAKDLGVDLASSIEILEVADPPQRLAGIKVENTEE 242

Query: 238 LIEILK 243
           L+  LK
Sbjct: 243 LVGKLK 248


>gi|316975062|gb|EFV58521.1| electron transfer flavoprotein, beta subunit [Trichinella spiralis]
          Length = 469

 Score =  198 bits (504), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 109/249 (43%), Positives = 167/249 (67%), Gaps = 5/249 (2%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           +++LV +K VI+Y  K+R+KND SG+ TE  K S+NPFDEIALEE+++++E+  A EVI 
Sbjct: 51  LRVLVSVKRVIDYAVKIRVKNDKSGVVTEGVKHSINPFDEIALEEAMRMKEQKHAAEVIA 110

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIESN----ETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G    +++L+++LA+G D+ I +E +    E +EPL +AKIL+ IVK+E+  +V+ G
Sbjct: 111 VSCGPPSSQDILRHALALGVDKAIHVEVDAKQYEHVEPLHVAKILQCIVKEEDINLVMLG 170

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKI-IDNHAIVTREVGHGTMTMETPLPAVIT 175
           KQ  D++ NQTGQML+AL+ W QA F S +++   ++  VTRE+  G  T+   LP+VIT
Sbjct: 171 KQAIDDDCNQTGQMLSALLNWSQAIFASKVEVNAPDYVTVTREIDGGLETVRCKLPSVIT 230

Query: 176 VDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVLRFEENRAERKGLRLYST 235
            DL LN PRY +LPNI+KA+KK + KK   D  I + P  +++   E    + G  + S 
Sbjct: 231 ADLRLNTPRYATLPNIMKAKKKPLVKKNVADLGITIKPHKQIIEVSEPPPRKVGQLVGSV 290

Query: 236 TKLIEILKS 244
            +L  ++K+
Sbjct: 291 QELPLVMKT 299


>gi|259487626|tpe|CBF86442.1| TPA: electron transfer flavoprotein, beta subunit, putative
           (AFU_orthologue; AFUA_5G07300) [Aspergillus nid