RPSBLAST alignment of GI: 254780368 and MMDB domain: 1efp_A_1-179

>1efp_A (A:1-179) ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans}Length = 179
 Score =  136 bits (343), Expect = 3e-33
 Identities = 20/179 (11%), Positives = 47/179 (26%), Gaps = 8/179 (4%)

Query: 28  TENTKISMNPFDEIALEESLQLREKGIATEVIVVSIGSCKVEEVLKNSLAMGADRGILIE 87
            E T  ++N         +++        +V V+  G+       + +   G  + ++ E
Sbjct: 6   GEVTNGALNRDATAKAVAAVKA-----LGDVTVLCAGASAKAAAEEAAKIAGVAKVLVAE 60

Query: 88  SNETLEPLSIAKILREIVKKENPIIVIAGKQTTDNESNQTGQMLAALMRWPQATFVSNIK 147
                  L+       +    +   + A   T           +AAL+     + VS I 
Sbjct: 61  DALYGHRLAEPTAALIVGLAGDYSHIAAPATTDAK---NVMPRVAALLDVMVLSDVSAIL 117

Query: 148 IIDNHAIVTREVGHGTMTMETPLPAVITVDLNLNEPRYISLPNIIKARKKRIEKKKATD 206
             D             +        V T+     +         +       +   ++ 
Sbjct: 118 DADTFERPIYAGNAIQVVKSKDAKKVFTIRTASFDAAGEGGTAPVTETAAAADPGLSSW 176