RPSBLAST alignment of GI: 254780368 and MMDB domain: 1efv_B_1-226

>1efv_B (B:1-226) Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens}Length = 226
 Score =  191 bits (487), Expect = 6e-50
 Identities = 104/222 (46%), Positives = 150/222 (67%), Gaps = 4/222 (1%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIATEVIV 60
           +++LV +K VI+Y  K+R+K D +G+ T+  K SMNPF EIA+EE+++L+EK +  EVI 
Sbjct: 4   LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIA 63

Query: 61  VSIGSCKVEEVLKNSLAMGADRGILIES----NETLEPLSIAKILREIVKKENPIIVIAG 116
           VS G  + +E ++ +LAMGADRGI +E      E L PL +A++L ++ +KE   +V+ G
Sbjct: 64  VSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLG 123

Query: 117 KQTTDNESNQTGQMLAALMRWPQATFVSNIKIIDNHAIVTREVGHGTMTMETPLPAVITV 176
           KQ  D++ NQTGQM A  + WPQ TF S + +  +   V RE+  G  T+   LPAV+T 
Sbjct: 124 KQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTA 183

Query: 177 DLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLTPRLKVL 218
           DL LNEPRY +LPNI+KA+KK+IE  K  D  +DLT +L V+
Sbjct: 184 DLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVI 225