RPSBLAST alignment of GI: 254780368 and protein with PDBid: 1o97

>1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C* Length = 264
 Score =  202 bits (515), Expect = 5e-53
 Identities = 78/259 (30%), Positives = 133/259 (51%), Gaps = 16/259 (6%)

Query: 1   MKILVPIKGVINYNTKVRIKNDYSGIETENTKISMNPFDEIALEESLQLREKGIA-TEVI 59
           MKILV +K          I+ D   ++ +     +N +D+ +LEE+++++E      EV+
Sbjct: 1   MKILVAVKQTAALEEDFEIREDGMDVDEDFMMYDLNEWDDFSLEEAMKIKESSDTDVEVV 60

Query: 60  VVSIGSCKVEEVLKNSLAMGADRGILIESNET--LEPLSIAKILREIVKKENPIIVIAGK 117
           VVS+G  +V+E L+  LA GADR + +  +     + + + +IL E++KKE P +V AG 
Sbjct: 61  VVSVGPDRVDESLRKCLAKGADRAVRVWDDAAEGSDAIVVGRILTEVIKKEAPDMVFAGV 120

Query: 118 QTTDNESNQTGQMLAALMRWPQATFVSNIKII--DNHAIVTREV-GHGTMTMETPLPAVI 174
           Q++D     TG  +A+ + WP A  V++++    DN A++ RE+ G     +E   PAV+
Sbjct: 121 QSSDQAYASTGISVASYLNWPHAAVVADLQYKPGDNKAVIRRELEGGMLQEVEINCPAVL 180

Query: 175 TVDLNLNEPRYISLPNIIKARKKRIEKKKATDFAIDLT------PRLKVLRFEENRAERK 228
           T+ L +N+PRY SL  I +A  K IE+    D  +            +V R       R 
Sbjct: 181 TIQLGINKPRYASLRGIKQAATKPIEEVSLADIGLSANDVGAAQSMSRVRRMYIPEKGRA 240

Query: 229 GLRLYST----TKLIEILK 243
            +   +      K+I+I+ 
Sbjct: 241 TMIEGTISEQAAKIIQIIN 259