HHsearch alignment for GI: 254780369 and conserved domain: PRK06546

>PRK06546 pyruvate dehydrogenase; Provisional.
Probab=96.37  E-value=0.024  Score=35.07  Aligned_cols=112  Identities=18%  Similarity=0.234  Sum_probs=73.7

Q ss_pred             HHHCC-EEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEHHHHHCCCCCHHH--HHHCCCCE---------ECCCEEEEE
Q ss_conf             00074-5641367777833568899999876398597425788678888889--54015975---------457389999
Q gi|254780369|r  199 LSSAK-IVISGGKSFGSMENFHKLLLPLAKKLGAAIGATRDAVDAGFAPNDW--QIGQTGVT---------VSPELYIAA  266 (318)
Q Consensus       199 L~~A~-iVVsgGRGi~~~enf~~l~~~LA~~LgaavG~SRp~vD~gw~p~~~--qIG~tG~~---------v~P~lYia~  266 (318)
T Consensus       198 L~~AkrPvii~G~G~~~a~--~e-l~~lae~l~~PV~tt~~--gkg~i~~dhpl~~G~~G~~g~~~a~~~l~~aDlvl~i  272 (578)
T PRK06546        198 INDAKKVTLFCGAGVAGAH--AE-VLELAEKIKAPIGHALR--GKDWIQYDNPFDVGMSGLLGYGAAAEAMNDADLLILL  272 (578)
T ss_pred             HHHCCCCEEEECCCCCCHH--HH-HHHHHHHHCCCEEEECC--CCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCEEEEE
T ss_conf             8507798899377741279--99-99999987988898623--3466778883005657676868999865157879998


Q ss_pred             EECCHHHHHHHHCCCCEEEEEECCCCCCH-HHCCCEEEECCHHHHHHHHHHCC
Q ss_conf             61672645555168988999766599883-10276457523899999988609
Q gi|254780369|r  267 GISGAIQHISGMKDSKVIVSINTDENAPI-FKISDYFIVGDIFKILPEIEKNL  318 (318)
Q Consensus       267 GISGa~qH~~G~~~s~~IvAIN~D~~ApI-f~~ad~giv~D~~~vlp~l~~~l  318 (318)
T Consensus       273 Gt~~~~~~--~~p~-~~ii~Id~d~~~lg~~~~~~~~i~gD~~~~L~~L~~~l  322 (578)
T PRK06546        273 GTDFPYNQ--FLPD-VRTAQVDIAPEHLGRRTDVDIAVHGDVAATIRALLPLV  322 (578)
T ss_pred             CCCCCCCC--CCCC-CEEEEEECCHHHHCCCCCCCEEEECCHHHHHHHHHHHH
T ss_conf             16888222--3877-70799718878846656787557667999999999975