HHsearch alignment of GI: 254780369 and MMDB domain: 1ma3_A_1-117_168-253

>1ma3_A (A:1-117,A:168-253) SIR2-AF2, transcriptional regulatory protein, SIR2 family; enzyme-substrate complex, protein binding, transcription; HET: ALY MES; 2.00A {Archaeoglobus fulgidus}
Probab=93.42  E-value=0.091  Score=31.00  Aligned_cols=58  Identities=19%  Similarity=0.294  Sum_probs=39.7

Q ss_pred             CCEEEEEEECCHHHHHHHH----CCCCEE-EEEECCCCCCHHHCCCEEEECCHHHHHHHHHHCC
Q ss_conf             7389999616726455551----689889-9976659988310276457523899999988609
Q gi|254780369|r  260 PELYIAAGISGAIQHISGM----KDSKVI-VSINTDENAPIFKISDYFIVGDIFKILPEIEKNL  318 (318)
Q Consensus       260 P~lYia~GISGa~qH~~G~----~~s~~I-vAIN~D~~ApIf~~ad~giv~D~~~vlp~l~~~l  318 (318)
                      -+|-|++|-|-.+....+.    ++.+.| |-||.++-. --..+|.+|+||+.++|++|+++|
T Consensus       134 aDlvl~iGt~l~~~~~~~~~~~~~~~~~~~vdin~~~~~-~~~~~d~~i~gD~~~~l~~L~~~l  196 (203)
T 1ma3_A          134 CDAFMVVGSSLVVYPAAELPYIAKKAGAKMIIVNAEPTM-ADPIFDVKIIGKAGEVLPKIVEEV  196 (203)
T ss_dssp             CSEEEEESCCSCEETGGGHHHHHHHHTCEEEEEESSCCT-TGGGCSEEEESCHHHHHHHHHHHH
T ss_pred             CCEEEEECCCCEEEECCHHHHHHHHCCCEEEEECCCCCC-CCCCCCEEEECCHHHHHHHHHHHH
T ss_conf             999999866977837206899999759939999999988-888612899798999999999999