RPSBLAST alignment of GI: 254780369 and MMDB domain: 3fet_A_

>3fet_A (A:) Electron transfer flavoprotein subunit alpha related protein; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: MSE; 2.05A {Thermoplasma acidophilum}Length = 166
 Score = 75.2 bits (185), Expect = 1e-14
 Identities = 24/157 (15%), Positives = 53/157 (33%), Gaps = 22/157 (14%)

Query: 8   VLLLADYNQENLSEQTARIVTAAQKISHDIHVLVLGDNIENIAQQAARIQGVTQVIVAQS 67
            L ++D           ++ T       D   +++G+         A+  G   +  A+ 
Sbjct: 6   FLTVSDDX-----NFLRQVNTLVAGKG-DXDSVIIGEG-------DAKGLGSKVLYRAKK 52

Query: 68  TIFRHKLAGPVSDFVVSIARDYKTIMASANAMGKDILPRVAAMLDVMQVSEVIEIISPK- 126
                     VS+ ++ IA +Y  I   +  +G++I   ++        +E+  +     
Sbjct: 53  ----GTPFDAVSEGILKIAGNYDYIAIGSTEVGREIAGYLSFKTGFYTATEIFSLEFNGQ 108

Query: 127 --IFKRPSYTGNIIQTIETTDTYQIITIRAIAFPPAP 161
               KR  Y G  +   E+    +I+T+         
Sbjct: 109 KAHTKRFFYGGKTVIEEESDA--RILTVAPGVIEAKD 143