HHsearch alignment for GI: 254780371 and conserved domain: COG0787

>COG0787 Alr Alanine racemase [Cell envelope biogenesis, outer membrane].
Probab=99.60  E-value=2.7e-12  Score=103.64  Aligned_cols=304  Identities=18%  Similarity=0.179  Sum_probs=187.0

Q ss_pred             EEEEHHHHHHHHHHHHHHCCCCCCEEEEEEECCC----CHHHHHHHHHCCC-CEEEECHHHHHHHHHCCCCCCCEEECCC
Q ss_conf             9977999999999999861447978999641079----9999999997399-2898689998652212578431244477
Q gi|254780371|r   30 YCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS----NQAVIKTLAHLGS-GLDIVSEGELRRALAAPVPAERIVFSGV  104 (431)
Q Consensus        30 yV~d~~~i~~n~~~l~~a~~~~~~~i~yAvKaN~----~~~il~~l~~~G~-g~dv~S~~El~~al~~G~~~~~Ii~~g~  104 (431)
T Consensus         7 ~~Idl~Al~~N~~~i~~~~~~--~~~~AVVKAnAYGhG~~~va~~l~~~g~~~f~VA~l~EAi~LR~~gi~~~~IlvL~g   84 (360)
T COG0787           7 AEIDLGALRHNLRALRELAGP--AKLMAVVKANAYGHGAVRVAKALLDAGADGFGVASLEEAIELREAGITGAPILVLEG   84 (360)
T ss_pred             EEEEHHHHHHHHHHHHHHCCC--CEEEEEEECCCCCCCHHHHHHHHHHCCCCEEEECCHHHHHHHHHCCCCCCCEEEECC
T ss_conf             998689999999999974788--579999965436778999999999859998998629999999971888997899737


Q ss_pred             CCCCHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             54201244442068723333220246768774113344215899872377867443332233444568871111345777
Q gi|254780371|r  105 GKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAY  184 (431)
Q Consensus       105 ~k~~~~l~~ai~~gv~~i~vDs~~el~~l~~~a~~~~~~~~I~lRinp~~~~~~~~~~~tg~~~sKFGi~~~~~~~~~~~  184 (431)
T Consensus        85 ~~~~~~~~~~~~~~l-~~~v~s~~ql~~l~~~~~~~-~~l~vhLki------------DTGM--~RlG~~~~~~~~~~~~  148 (360)
T COG0787          85 FFPAEELELAAAYNL-TPVVNSLEQLEALKNAALKN-KPLKVHLKI------------DTGM--NRLGLRPEEAVALAID  148 (360)
T ss_pred             CCCHHHHHHHHHCCC-EEEECCHHHHHHHHHHHHCC-CCEEEEEEE------------CCCC--CCCCCCHHHHHHHHHH
T ss_conf             588356789998697-38889999999999755106-962799997------------7898--7579884899999998


Q ss_pred             HHHCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCC----CCCCCCCCCCHHHHHHHH
Q ss_conf             6415632200233556415644204899999999887653102666526880687300----026654553114565556
Q gi|254780371|r  185 ASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI----AYHSDHRPPSSSDYASLI  260 (431)
Q Consensus       185 ~~~~~~l~l~GlH~H~GS~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~ldiGGGf~i----~y~~~~~~~~~~~~~~~i  260 (431)
T Consensus       149 ~~~~~~~~~~gi~SHfa~A-De~~~~-~~~~Q~~~F~--~~~~~~~~~~~h~aNSa~~~~~~~~~~d~vRpGi~lYG~~P  224 (360)
T COG0787         149 LIALKNLDLEGIFSHFACA-DEPEDP-YTLKQLERFN--LAKQGLPGELSHLANSAGLLLGPDYHFDMVRPGIALYGLSP  224 (360)
T ss_pred             HHHCCCCCEEEEECCCCCC-CCCCCH-HHHHHHHHHH--HHHCCCCCCEEEEECCHHHHCCCCCCCCEEECCEEEECCCC
T ss_conf             7632487559997156778-888982-7899999999--98646987537885558770686422514640013226885


Q ss_pred             HHHHCCCCCEEEEEECCEECCCCCEEEEEEEEECCCC-------CCCCEEECCCCCCCCCCHHHCCCCCCCCCCCCCC-C
Q ss_conf             5421024530344101112036632588876403468-------9742200553000110011102465322223467-7
Q gi|254780371|r  261 HQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSA-------DKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAG-D  332 (431)
Q Consensus       261 ~~~~~~~~~~l~~EPGR~lva~ag~ll~~V~~vK~~~-------~~~~~~vD~g~~~~~~p~~~~~~~~i~~~~~~~~-~  332 (431)
T Consensus       225 ~~~~~------------~~lkpvmtl~a~ii~vr~v~~Ge~VgYG~t~~a~~~t-~iavv~iGYaDG~pR-~~~~~~~Vl  290 (360)
T COG0787         225 SGGLD------------NGLKPVMTLKARIIQVRTVPAGETVGYGATFTAERDT-RIAVVAIGYADGYPR-ALSNGTPVL  290 (360)
T ss_pred             CCCCC------------CCCCCEEEEEEEEEEEEEECCCCCCCCCCEEECCCCC-EEEEEECCCCCCCHH-HCCCCCEEE
T ss_conf             65667------------7853107999988899985799952477079825882-689986334577420-168997799


Q ss_pred             CCEEEEEEEEEECCCCCEEEEEE-ECCCCCCCCEEEEECC
Q ss_conf             76158999810005666656210-0566888889999679
Q gi|254780371|r  333 RLHIHADIVGPICETGDFIALNR-KIALPRPGDLLYIEKT  371 (431)
Q Consensus       333 ~~~~~~~i~G~~C~~~D~l~~~~-~lp~l~~GD~l~i~~~  371 (431)
T Consensus       291 i~G~r~pivGrVsM--D~~~Vdl~~~~~~~~Gd~V~L~G~  328 (360)
T COG0787         291 INGKRVPIVGRVSM--DMIMVDLTDLPQVKVGDEVELFGE  328 (360)
T ss_pred             ECCEEEEEEEEEEC--EEEEEECCCCCCCCCCCEEEEECC
T ss_conf             99998157638842--069998899877899999999899