HHsearch alignment for GI: 254780371 and conserved domain: KOG3157

>KOG3157 consensus.
Probab=97.72  E-value=0.00032  Score=48.79  Aligned_cols=188  Identities=21%  Similarity=0.260  Sum_probs=109.6

Q ss_pred             HHHHHHHHHHHHHCC-----CCCCEEEEEEECCCCHHHHHHHHHCCC-CEEEECHHHHHHHHHCCCCCCCE--EECCCCC
Q ss_conf             999999999998614-----479789996410799999999997399-28986899986522125784312--4447754
Q gi|254780371|r   35 TAIEKNYLTFSNAFD-----GMDTMVCYALKANSNQAVIKTLAHLGS-GLDIVSEGELRRALAAPVPAERI--VFSGVGK  106 (431)
Q Consensus        35 ~~i~~n~~~l~~a~~-----~~~~~i~yAvKaN~~~~il~~l~~~G~-g~dv~S~~El~~al~~G~~~~~I--i~~g~~k  106 (431)
T Consensus         9 ~~L~~v~~rv~qa~~~~~r~~~~~rlvaVSKtKPa~-~i~~~Y~~GqR~FGENYVQEl~--eKap~lp~DI~WHFIG~lQ   85 (244)
T KOG3157           9 SALRAVIERVQQAVNQRPRDENAVRLVAVSKTKPAS-LIIEAYDAGQRHFGENYVQELI--EKAPLLPDDIKWHFIGHLQ   85 (244)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCHH-HHHHHHHCCCCHHHHHHHHHHH--HHCCCCCCCCEEEEECHHH
T ss_conf             899999999999998444566644899962578689-9999987172704588999999--8462476213265644132


Q ss_pred             CCHHHHHHHHCCCCCC-CCCCCHHHHHHHHHHCCCCC--CEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             2012444420687233-33220246768774113344--21589987237786744333223344456887111134577
Q gi|254780371|r  107 TIDEIDLALQSGIYCF-NVESESELKTLNQRAVSLGK--KAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA  183 (431)
Q Consensus       107 ~~~~l~~ai~~gv~~i-~vDs~~el~~l~~~a~~~~~--~~~I~lRinp~~~~~~~~~~~tg~~~sKFGi~~~~~~~~~~  183 (431)
T Consensus        86 snK~kkl~svpnL~~vetVDseK~A~~ld~a~~k~g~~~PL~V~VQvN------------TSGEd~K~Giepse~~~l~~  153 (244)
T KOG3157          86 SNKCKKLLSVPNLYSVETVDSEKKARKLDSAWSKLGPDNPLKVLVQVN------------TSGEDSKSGIEPSEAPELAE  153 (244)
T ss_pred             HCCCCHHCCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEEEE------------CCCCCCCCCCCHHHHHHHHH
T ss_conf             311001106786478873126989888889999529999728999961------------67754457988366599999


Q ss_pred             HHHH-CCCCCHHHHHHHHHHCCCC---CHH--HHHHHHHHHHHHHHH-HCCCCCCCEEEECCCCCC
Q ss_conf             7641-5632200233556415644---204--899999999887653-102666526880687300
Q gi|254780371|r  184 YAST-LPGVKISGVDMHIGSQIDQ---IES--FHKAFKLLRDLTQQL-RSNGHNIQHIDVGGGLGI  242 (431)
Q Consensus       184 ~~~~-~~~l~l~GlH~H~GS~~~~---~~~--~~~~~~~~~~~~~~l-~~~g~~~~~ldiGGGf~i  242 (431)
T Consensus       154 ~i~~~c~nL~f~Gl-MTIGs~~~s~ss~eNpDF~----~L~~~r~~ic~~lg~~~dq~eLSMGMS~  214 (244)
T KOG3157         154 HIKSECKNLKFSGL-MTIGSFDNSHSSGENPDFQ----VLVKLRESICKKLGIPADQVELSMGMSA  214 (244)
T ss_pred             HHHHHCCCCEEEEE-EEECCCCCCCCCCCCCCHH----HHHHHHHHHHHHHCCCHHHHHHHCCCCH
T ss_conf             99986876345204-7753566655689996579----9999999999984898678100235636