HHsearch alignment for GI: 254780371 and conserved domain: TIGR01047

>TIGR01047 nspC carboxynorspermidine decarboxylase; InterPro: IPR005730 Carboxynorspermidine synthase, mediates the nicotinamide-nucleotide-linked reduction of the Schiff base H2N(CH2)3N = CHCH2CH(NH2)COOH. This is formed from L-aspartic beta-semialdehyde (ASA) and 1,3-diaminopropane (DAP) and is reduced to carboxynorspermidine [H2N(CH2)3NH(CH2)2CH(NH2)COOH], an intermediate in the novel pathway for norspermidine biosynthesis shown in Vibrio alginolyticus.; GO: 0016830 carbon-carbon lyase activity, 0045312 nor-spermidine biosynthetic process.
Probab=100.00  E-value=0  Score=340.77  Aligned_cols=371  Identities=18%  Similarity=0.247  Sum_probs=305.4

Q ss_pred             CCCEEEEEHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHHHHCCC-CEEEECHHHHHHHHHCCCC-----CCCE
Q ss_conf             997899779999999999998614479789996410799999999997399-2898689998652212578-----4312
Q gi|254780371|r   26 QTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGS-GLDIVSEGELRRALAAPVP-----AERI   99 (431)
Q Consensus        26 gTP~yV~d~~~i~~n~~~l~~a~~~~~~~i~yAvKaN~~~~il~~l~~~G~-g~dv~S~~El~~al~~G~~-----~~~I   99 (431)
T Consensus         2 ~tP~fvLeE~~L~~Nl~i~~~v~q~SG~kv~LALKGFa~w~~F~ilr~yGL~G~taSgL~EAkLA~E~-fgGreshkE~H   80 (403)
T TIGR01047         2 PTPAFVLEEEKLRKNLEILESVQQQSGAKVLLALKGFAFWGVFPILREYGLKGATASGLWEAKLAKEE-FGGRESHKEVH   80 (403)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH-CCCCCCCCCEE
T ss_conf             99840215789999999999864308727853110032321001024204773242676788632231-38602676668


Q ss_pred             EECCCCCCCHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCC--C------CCCEEEEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             4447754201244442068723333220246768774113--3------4421589987237786744333223344456
Q gi|254780371|r  100 VFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVS--L------GKKAPIAFRVNPDINANTHKKISTGKKEDKF  171 (431)
Q Consensus       100 i~~g~~k~~~~l~~ai~~gv~~i~vDs~~el~~l~~~a~~--~------~~~~~I~lRinp~~~~~~~~~~~tg~~~sKF  171 (431)
T Consensus        81 vYs-Pay~e~d~~~I~~La~-~i~FNS~~Q~~~yr~~~~~K~~qlenlG~~~~k~GLRINPeyS~v~~dLYNPc~~~SRL  158 (403)
T TIGR01047        81 VYS-PAYKEEDLPEIIPLAD-HIIFNSLAQWARYREKVEDKNSQLENLGLREVKLGLRINPEYSEVETDLYNPCGKFSRL  158 (403)
T ss_pred             EEC-CCCCHHHHHHHHHHHH-HHHHCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCHHHCCCCCCCCCC
T ss_conf             715-8888645888987741-33410378999999999999998885597502241234674465661320878687546


Q ss_pred             CCCCCCCHH-HHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCCCC
Q ss_conf             887111134-5777641563220023355641564420489999999988765310266652688068730002665455
Q gi|254780371|r  172 GIPIHQIHS-LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRP  250 (431)
Q Consensus       172 Gi~~~~~~~-~~~~~~~~~~l~l~GlH~H~GS~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~ldiGGGf~i~y~~~~~~  250 (431)
T Consensus       159 Gv~a~~f~~Gvke~--~l~g--I~Gl~FH~~CEn~d~dAL~~~L~---~~E~~FG~yL~~m~WVNfGGGH----~~T~~G  227 (403)
T TIGR01047       159 GVQAKEFEEGVKES--LLDG--IEGLHFHTLCENKDADALERTLE---VIEKKFGEYLPQMEWVNFGGGH----LITKKG  227 (403)
T ss_pred             CCCHHHHCCCCCCC--CCCC--CCCHHHCCCCCCCCHHHHHHHHH---HHHHHHHHHCCCCCEEECCCCE----EECCCC
T ss_conf             64157761652214--6775--44110001344567478999999---9987642100032303138876----645788


Q ss_pred             CCHHHHHHHHHHHHCCCC-CEEEEEECCEECCCCCEEEEEEEEECCCCCCCCEEECCCCCCCCCCHHHCCCCCCCCCCCC
Q ss_conf             311456555654210245-3034410111203663258887640346897422005530001100111024653222234
Q gi|254780371|r  251 PSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNP  329 (431)
Q Consensus       251 ~~~~~~~~~i~~~~~~~~-~~l~~EPGR~lva~ag~ll~~V~~vK~~~~~~~~~vD~g~~~~~~p~~~~~~~~i~~~~~~  329 (431)
T Consensus       228 YDv~~LIa~~K~F~erh~~v~viLEPGeAigWqTG~Lv~sV~DiveNP~~~~AiLD~S~~AHmPD~LemPYrp~-vl~A~  306 (403)
T TIGR01047       228 YDVEKLIAVIKAFKERHGNVQVILEPGEAIGWQTGFLVASVVDIVENPEKKIAILDVSFEAHMPDTLEMPYRPS-VLGAS  306 (403)