HHsearch alignment for GI: 254780371 and conserved domain: TIGR01048

>TIGR01048 lysA diaminopimelate decarboxylase; InterPro: IPR002986 Pyridoxal-dependent decarboxylases that act on ornithine-, lysine-, arginine- and related substrates can be classified into different families on the basis of sequence similarity , . One of these families includes ornithine decarboxylase (ODC), which catalyses the transformation of ornithine into putrescine; prokaryotic diaminopimelic acid decarboxylase (DAPDC), which catalyses the conversion of diaminopimelic acid into lysine, the final step of lysine biosynthesis; Pseudomonas syringae pv. tabaci protein, tabA, which is probably involved in tabtoxin biosynthesis and is similar to DAPDC; and bacterial and plant biosynthetic arginine decarboxylase (ADC), which catalyses the transformation of arginine into agmatine, the first step in putrescine synthesis from arginine. Although these proteins, which are known collectively as group IV decarboxylases , probably share a common evolutionary origin, their levels of sequence similarity are low, being confined to a few short conserved regions. These conserved motifs suggest a common structural arrangement for positioning of substrate and the cofactor pyridoxal 5'-phosphate among bacterial DAP decarboxylases, eukaryotic ornithine decarboxylases and arginine decarboxylases . The structure of bacterial diaminopimelate decarboxylase has been determined . ; GO: 0008836 diaminopimelate decarboxylase activity, 0009089 lysine biosynthetic process via diaminopimelate.
Probab=100.00  E-value=0  Score=948.44  Aligned_cols=410  Identities=45%  Similarity=0.755  Sum_probs=396.8

Q ss_pred             EEECCEEEECCCCHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHCCC--CC-CEEEEEEECCCCHHHHHHHHHCCCCEEEE
Q ss_conf             6668858987842999999749978997799999999999986144--79-78999641079999999999739928986
Q gi|254780371|r    5 KYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDG--MD-TMVCYALKANSNQAVIKTLAHLGSGLDIV   81 (431)
Q Consensus         5 ~~~~~~l~i~~~~l~~La~~~gTP~yV~d~~~i~~n~~~l~~a~~~--~~-~~i~yAvKaN~~~~il~~l~~~G~g~dv~   81 (431)
T Consensus         3 ~~~~G~l~i~~~~~~~La~~fGTPLYVyd~~~l~~~~~~~~~AF~~~~~~~~~v~YA~KAn~Nl~~~~~la~~G~G~D~V   82 (431)
T TIGR01048         3 ENKDGELFIEGVDLKELAEEFGTPLYVYDEATLRERFEAYKEAFGAAERESALVCYAVKANSNLALLRLLAELGSGFDVV   82 (431)
T ss_pred             EECCCEEEEECCCHHHHHHHCCCCEEEECHHHHHHHHHHHHHHHHCCCCCCCCEEEEHHHHCCHHHHHHHHHCCCCEEEE
T ss_conf             40254489844677999985189879816789999999999873015877531587431407688999999638846887


Q ss_pred             CHHHHHHHHHCCCC----CCCEEECCCCCCCHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEEEEEECCCCCC
Q ss_conf             89998652212578----43124447754201244442068723333220246768774113344215899872377867
Q gi|254780371|r   82 SEGELRRALAAPVP----AERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINAN  157 (431)
Q Consensus        82 S~~El~~al~~G~~----~~~Ii~~g~~k~~~~l~~ai~~gv~~i~vDs~~el~~l~~~a~~~~~~~~I~lRinp~~~~~  157 (431)
T Consensus        83 S~GEL~~A~~AG~~~~~~~~~i~F~Gn~Ks~~El~~Al~~~i~~~nVdS~~El~~l~~~A~e~G~~~~i~~RvNP~Vdak  162 (431)
T TIGR01048        83 SGGELYRALAAGFPLQEIPEKIVFSGNGKSRAELERALELGIRCINVDSFSELELLNEIAPELGKKARISLRVNPDVDAK  162 (431)
T ss_pred             EHHHHHHHHHHCCCCCCCCCCEEEECCCCCHHHHHHHHHCCCCEEEECCHHHHHHHHHHCCCCCCEEEEEEEECCCCCCC
T ss_conf             01699999980888556664368965877889999999637989997688999999973521385589999726887598


Q ss_pred             CCCCCCCCCCCCCCCCCCC--CCHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCC-CCCCCEE
Q ss_conf             4433322334445688711--113457776415632200233556415644204899999999887653102-6665268
Q gi|254780371|r  158 THKKISTGKKEDKFGIPIH--QIHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSN-GHNIQHI  234 (431)
Q Consensus       158 ~~~~~~tg~~~sKFGi~~~--~~~~~~~~~~~~~~l~l~GlH~H~GS~~~~~~~~~~~~~~~~~~~~~l~~~-g~~~~~l  234 (431)
T Consensus       163 THpyI~TG~~~sKFG~~~~sG~a~~~~~~a~~~~~l~~vG~H~HIGSQi~d~~Pf~~A~~~v~~~~~~l~~~yG~~l~~l  242 (431)
T TIGR01048       163 THPYISTGLKDSKFGIDVESGEALEAYLYALQLENLEIVGIHCHIGSQILDLSPFVEAAEKVVKLVEELKAEYGIDLEFL  242 (431)
T ss_pred             CCCHHHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCEEEEE
T ss_conf             78312210003654777457531789999983789938998643373010234079999999999998888716007999


Q ss_pred             EECCCCCCCCCCCCCCCCHHHHHHHHHHHHCC-----C-CCEEEEEECCEECCCCCEEEEEEEEECCCCC-CCCEEECCC
Q ss_conf             80687300026654553114565556542102-----4-5303441011120366325888764034689-742200553
Q gi|254780371|r  235 DVGGGLGIAYHSDHRPPSSSDYASLIHQYFGN-----L-QCKIILEPGRFLVADVGILVTKVISIKKSAD-KTFVILDVA  307 (431)
Q Consensus       235 diGGGf~i~y~~~~~~~~~~~~~~~i~~~~~~-----~-~~~l~~EPGR~lva~ag~ll~~V~~vK~~~~-~~~~~vD~g  307 (431)
T Consensus       243 d~GGGLGi~Y~~e~~~p~~~~yA~~~~~~l~~~~~~g~~~~~li~EPGRslVa~aG~Llt~V~~~K~~~~~r~Fv~VDaG  322 (431)
T TIGR01048       243 DLGGGLGIPYTPEEEPPDLSEYAQAILAALEGYARLGLPDPKLILEPGRSLVANAGVLLTRVGFVKEVGSVRNFVIVDAG  322 (431)
T ss_pred             ECCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCEECCCCEEEEEEEEEEECCCEEEEEEEECC
T ss_conf             83872224006888866989999999999886775279963799922600020451789987668746857899998077


Q ss_pred             CCCCCCCHHHCCCCCCCCCCCC--CCCCCEEEEEEEEEECCCCCEEEEEEECCCCCCCCEEEEECCCCHHHHHHCCCCCC
Q ss_conf             0001100111024653222234--67776158999810005666656210056688888999967970233340277889
Q gi|254780371|r  308 MNDFMRPTLYDAYHEINYIVNP--AGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSR