HHsearch alignment for GI: 254780371 and conserved domain: cd00622

>cd00622 PLPDE_III_ODC Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase. This subfamily is composed mainly of eukaryotic ornithine decarboxylases (ODC, EC 4.1.1.17) and ODC-like enzymes from prokaryotes represented by Vibrio vulnificus LysineOrnithine decarboxylase. These are fold type III PLP-dependent enzymes that differ from most bacterial ODCs which are fold type I PLP-dependent enzymes. ODC participates in the formation of putrescine by catalyzing the decarboxylation of ornithine, the first step in polyamine biosynthesis. Members of this subfamily contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Homodimer formation and the presence of the PLP cofactor are required for catalytic activity. Also members of this su
Probab=100.00  E-value=0  Score=635.89  Aligned_cols=353  Identities=28%  Similarity=0.439  Sum_probs=314.0

Q ss_pred             CCCEEEEEHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHHHHCCCCEEEECHHHHHHHHHCCCCCCCEEECCCC
Q ss_conf             99789977999999999999861447978999641079999999999739928986899986522125784312444775
Q gi|254780371|r   26 QTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVG  105 (431)
Q Consensus        26 gTP~yV~d~~~i~~n~~~l~~a~~~~~~~i~yAvKaN~~~~il~~l~~~G~g~dv~S~~El~~al~~G~~~~~Ii~~g~~  105 (431)
T Consensus         1 ~TP~yvyd~~~i~~~~~~l~~afp--~~~i~YA~KaN~~~~vl~~l~~~G~g~dv~S~~El~~al~~G~~~~~Iif~gp~   78 (362)
T cd00622           1 ETPFLVVDLGDVVRKYRRWKKALP--RVRPFYAVKCNPDPAVLRTLAALGAGFDCASKGEIELVLGLGVSPERIIFANPC   78 (362)
T ss_pred             CCCEEEEEHHHHHHHHHHHHHHCC--CCEEEEEECCCCCHHHHHHHHHCCCEEEEECHHHHHHHHHCCCCHHHEEECCCC
T ss_conf             998899459999999999998689--987999966589899999999739919982999999999849987895845887


Q ss_pred             CCCHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             42012444420687233332202467687741133442158998723778674433322334445688711113457776
Q gi|254780371|r  106 KTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYA  185 (431)
Q Consensus       106 k~~~~l~~ai~~gv~~i~vDs~~el~~l~~~a~~~~~~~~I~lRinp~~~~~~~~~~~tg~~~sKFGi~~~~~~~~~~~~  185 (431)
T Consensus        79 K~~~el~~a~~~gv~~i~vDS~~EL~~i~~~~~~----~~i~lRv~~~~~~~~~------~~~~KFGi~~~~~~~~l~~~  148 (362)
T cd00622          79 KSISDIRYAAELGVRLFTFDSEDELEKIAKHAPG----AKLLLRIATDDSGALC------PLSRKFGADPEEARELLRRA  148 (362)
T ss_pred             CCHHHHHHHHHCCCCEEEECCHHHHHHHHHHCCC----CCEEEEECCCCCCCCC------CCCCCCCCCHHHHHHHHHHH
T ss_conf             8879999999749966772789999999986777----8269998669998733------57775799999999999999


Q ss_pred             HHCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHC
Q ss_conf             41563220023355641564420489999999988765310266652688068730002665455311456555654210
Q gi|254780371|r  186 STLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASLIHQYFG  265 (431)
Q Consensus       186 ~~~~~l~l~GlH~H~GS~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~ldiGGGf~i~y~~~~~~~~~~~~~~~i~~~~~  265 (431)
T Consensus       149 ~~~-~l~~~GlH~H~GS~~~~~~~~~~~i~~~~~~~~~~~~~g~~~~~idiGGG~~~~y~~~--~~~~~~~~~~i~~~~~  225 (362)
T cd00622         149 KEL-GLNVVGVSFHVGSQCTDPSAYVDAIADAREVFDEAAELGFKLKLLDIGGGFPGSYDGV--VPSFEEIAAVINRALD  225 (362)
T ss_pred             HHC-CCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCC--CCCHHHHHHHHHHHHH
T ss_conf             862-9956889987687768979999999999999999997599976798379836788889--9998999999999999


Q ss_pred             C----CCCEEEEEECCEECCCCCEEEEEEEEECCCCCC---CCEEECCCCCCCCCCHHHC-CCCCCCCCCCCCCCCCEEE
Q ss_conf             2----453034410111203663258887640346897---4220055300011001110-2465322223467776158
Q gi|254780371|r  266 N----LQCKIILEPGRFLVADVGILVTKVISIKKSADK---TFVILDVAMNDFMRPTLYD-AYHEINYIVNPAGDRLHIH  337 (431)
Q Consensus       266 ~----~~~~l~~EPGR~lva~ag~ll~~V~~vK~~~~~---~~~~vD~g~~~~~~p~~~~-~~~~i~~~~~~~~~~~~~~  337 (431)
T Consensus       226 ~~~~~~~~~l~~EPGR~lva~ag~llt~V~~~K~~~~~~~~~~~~vd~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  305 (362)
T cd00622         226 EYFPDEGVRIIAEPGRYLVASAFTLAVNVIAKRKRGDDDRERWYYLNDGVYGSFNEILFDHIRYPPRVLKDGGRDGELYP  305 (362)
T ss_pred             HHCCCCCCEEEECCHHHHCCCEEEEEEEEEEEEECCCCCCEEEEEECCCCCCHHHHHHHCCCCCCEEEECCCCCCCCCEE
T ss_conf             86486797799856045201407999999999860788726999984787511546764377671681058887898018


Q ss_pred             EEEEEEECCCCCEEEEEEECC-CCCCCCEEEEECCCCHHHHHHCCCCCCCCCEEEEE
Q ss_conf             999810005666656210056-68888899996797023334027788986659999
Q gi|254780371|r  338 ADIVGPICETGDFIALNRKIA-LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMV  393 (431)
Q Consensus       338 ~~i~G~~C~~~D~l~~~~~lp-~l~~GD~l~i~~~GAY~~s~~s~fn~~p~p~~v~v  393 (431)
T Consensus       306 ~~v~G~~C~~~D~l~~~~~lP~~l~~GD~l~i~~~GAY~~smss~fN~~p~p~~V~v  362 (362)
T cd00622         306 SSLWGPTCDSLDVIYEDVLLPEDLAVGDWLLFENMGAYTTAYASTFNGFPPPKIVYV  362 (362)
T ss_pred             EEEECCCCCCCCEEEECCCCCCCCCCCCEEEECCCCCCHHHHHCCCCCCCCCCEEEC
T ss_conf             999844888886983566578889999999995987051756287789899948969