HHsearch alignment for GI: 254780371 and conserved domain: cd06810

>cd06810 PLPDE_III_ODC_DapDC_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Ornithine and Diaminopimelate Decarboxylases, and Related Enzymes. This family includes eukaryotic ornithine decarboxylase (ODC, EC 4.1.1.17), diaminopimelate decarboxylase (DapDC, EC 4.1.1.20), plant and prokaryotic biosynthetic arginine decarboxylase (ADC, EC 4.1.1.19), carboxynorspermidine decarboxylase (CANSDC), and ODC-like enzymes from diverse bacterial species. These proteins are fold type III PLP-dependent enzymes that catalyze essential steps in the biosynthesis of polyamine and lysine. ODC and ADC participate in alternative pathways of the biosynthesis of putrescine, which is the precursor of aliphatic polyamines in many organisms. ODC catalyzes the direct synthesis of putrescine from L-ornithine, while ADC converts L-arginine to agmatine, which is hydrolysed to putrescine by agmatinase in a pathway that exists only in plants and bacteria. DapDC converts meso-2,6-diaminoheptanedioate to
Probab=100.00  E-value=0  Score=667.70  Aligned_cols=362  Identities=41%  Similarity=0.705  Sum_probs=338.8

Q ss_pred             CCEEEEEHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHHHHCCCCEEEECHHHHHHHHHCCCCCCCEEECCCCC
Q ss_conf             97899779999999999998614479789996410799999999997399289868999865221257843124447754
Q gi|254780371|r   27 TPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGK  106 (431)
Q Consensus        27 TP~yV~d~~~i~~n~~~l~~a~~~~~~~i~yAvKaN~~~~il~~l~~~G~g~dv~S~~El~~al~~G~~~~~Ii~~g~~k  106 (431)
T Consensus         1 TP~yv~d~~~l~~~~~~~~~~~~~-~~~i~YAvKaN~~~~vl~~l~~~g~g~dvaS~~El~~al~~G~~~~~Ii~~gp~K   79 (368)
T cd06810           1 TPFYVYDLDIIRAHYAALKEALPS-GVKLFYAVKANPNPHVLRTLAEAGTGFDVASKGELALALAAGVPPERIIFTGPAK   79 (368)
T ss_pred             CCEEEEEHHHHHHHHHHHHHHCCC-CCEEEEEECCCCCHHHHHHHHHHCCEEEEECHHHHHHHHHCCCCHHHEEEECCCC
T ss_conf             989998699999999999975799-9789999653899999999998599189779999999998599944199945545


Q ss_pred             CCHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             20124444206872333322024676877411334421589987237786744333223344456887111134577764
Q gi|254780371|r  107 TIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYAS  186 (431)
Q Consensus       107 ~~~~l~~ai~~gv~~i~vDs~~el~~l~~~a~~~~~~~~I~lRinp~~~~~~~~~~~tg~~~sKFGi~~~~~~~~~~~~~  186 (431)
T Consensus        80 ~~~~l~~a~~~gv~~i~~Ds~~El~~i~~~~~~~~~~~~i~lRinp~~~~~~~-~~~~~~~~sKFGi~~~~~~~~~~~~~  158 (368)
T cd06810          80 SVSEIEAALASGVDHIVVDSLDELERLNELAKKLGPKARILLRVNPDVSAGTH-KISTGGLKSKFGLSLSEARAALERAK  158 (368)
T ss_pred             CCHHHHHHHHCCCCCEEECCHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCE-EECCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             30569999975978455579999999999998569997599999448787752-10368887767999999999999998


Q ss_pred             HCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHCC
Q ss_conf             15632200233556415644204899999999887653102666526880687300026654553114565556542102
Q gi|254780371|r  187 TLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASLIHQYFGN  266 (431)
Q Consensus       187 ~~~~l~l~GlH~H~GS~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~ldiGGGf~i~y~~~~~~~~~~~~~~~i~~~~~~  266 (431)
T Consensus       159 ~~-~l~l~GlhfH~GS~~~~~~~~~~~i~~~~~~~~~~~~~g~~~~~idiGGGf~~~y~~--~~~~~~~~~~~i~~~~~~  235 (368)
T cd06810         159 EL-DLRLVGLHFHVGSQILDLETIVQALSDARELIEELVEMGFPLEMLDLGGGLGIPYDE--QPLDFEEYAALINPLLKK  235 (368)
T ss_pred             HC-CCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEECCCCCCCCCCC--CCCCHHHHHHHHHHHHHH
T ss_conf             65-996789999768776886999999999999999998629985346437885777888--998999999999999998


Q ss_pred             C-----CCEEEEEECCEECCCCCEEEEEEEEECCCCCCCCEEECCCCCCCCCCHH-HCCCCCCCCCCCCCCCCCEEEEEE
Q ss_conf             4-----5303441011120366325888764034689742200553000110011-102465322223467776158999
Q gi|254780371|r  267 L-----QCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPTL-YDAYHEINYIVNPAGDRLHIHADI  340 (431)
Q Consensus       267 ~-----~~~l~~EPGR~lva~ag~ll~~V~~vK~~~~~~~~~vD~g~~~~~~p~~-~~~~~~i~~~~~~~~~~~~~~~~i  340 (431)
T Consensus       236 ~~~~~~~~~l~~EPGR~lva~ag~lv~~V~~~K~~~~~~~~~vd~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i  315 (368)
T cd06810         236 YFPNDPGVTLILEPGRYIVAQAGVLVTRVVAVKVNGGRFFAVVDGGMNHSFRPALAYDAYHPITPLKAPGPDEPLVPATL  315 (368)
T ss_pred             HHCCCCCCEEEECCCHHHHHCCCCEEEEEEEEEECCCCEEEEECCCCCCCCCCHHHCCCCCCEEECCCCCCCCCEEEEEE
T ss_conf             72347896899866445652436199999999975997189976643455662321688464286178888898669999


Q ss_pred             EEEECCCCCEEEEEEECCCCCCCCEEEEECCCCHHHHHHCCCCCCCCCEEEEE
Q ss_conf             81000566665621005668888899996797023334027788986659999
Q gi|254780371|r  341 VGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMV  393 (431)
Q Consensus       341 ~G~~C~~~D~l~~~~~lp~l~~GD~l~i~~~GAY~~s~~s~fn~~p~p~~v~v  393 (431)
T Consensus       316 ~G~~C~~~D~l~~~~~lp~l~~GD~l~~~~~GAY~~s~s~~Fn~~~~pa~vli  368 (368)
T cd06810         316 AGPLCDSGDVIGRDRLLPELEVGDLLVFEDMGAYGFSESSNFNSHPRPAEYLV  368 (368)
T ss_pred             ECCCCCCCCEEEECCCCCCCCCCCEEEECCCCHHHHHHHCCCCCCCCCCEEEC
T ss_conf             75588868799568857889999999776947324766177889999978979