HHsearch alignment for GI: 254780371 and conserved domain: cd06812

>cd06812 PLPDE_III_DSD_D-TA_like_1 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase, Unknown Group 1. This subfamily is composed of uncharacterized bacterial proteins with similarity to eukaryotic D-serine dehydratases (DSD) and D-threonine aldolases (D-TA). DSD catalyzes the dehydration of D-serine to aminoacrylate, which is rapidly hydrolyzed to pyruvate and ammonia. D-TA reversibly catalyzes the aldol cleavage of D-threonine into glycine and acetaldehyde, and the synthesis of D-threonine from glycine and acetaldehyde. DSD and D-TA are fold type III PLP-dependent enzymes, similar to bacterial alanine racemase (AR), which contains an N-terminal PLP-binding TIM barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on their similarity to AR, it is possible mem
Probab=99.87  E-value=3e-19  Score=150.91  Aligned_cols=334  Identities=16%  Similarity=0.169  Sum_probs=209.5

Q ss_pred             HHCCCCEEEEEHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHHHHCCC-CEEEECHHHHHHHHHCCCCCCCEEE
Q ss_conf             974997899779999999999998614479789996410799999999997399-2898689998652212578431244
Q gi|254780371|r   23 HVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGS-GLDIVSEGELRRALAAPVPAERIVF  101 (431)
Q Consensus        23 ~~~gTP~yV~d~~~i~~n~~~l~~a~~~~~~~i~yAvKaN~~~~il~~l~~~G~-g~dv~S~~El~~al~~G~~~~~Ii~  101 (431)
T Consensus         2 ~~l~TPalvvd~~~l~~Ni~~M~~~~~~~g~~lRPH~KTHKs~eia~~Q~~~Ga~gi~~atv~EAe~~a~~G~~--dIl~   79 (374)
T cd06812           2 AALDTPFLLLDEARMDRNIARLRQRLSRLGVRLRPHLKTAKSLEVARRLLAAGASPATVSTLKEAEAFAEAGYR--DILY   79 (374)
T ss_pred             CCCCCCEEEEEHHHHHHHHHHHHHHHHHCCCCEEEEECHHCCHHHHHHHHHCCCCCEEECCHHHHHHHHHCCCC--EEEE
T ss_conf             87899769972999999999999999876996602610014799999999679984897889999999977987--3999


Q ss_pred             CCCCCCCHHHH---HHHHCCCC-CCCCCCCHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             47754201244---44206872-333322024676877411334421589987237786744333223344456887111
Q gi|254780371|r  102 SGVGKTIDEID---LALQSGIY-CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQ  177 (431)
Q Consensus       102 ~g~~k~~~~l~---~ai~~gv~-~i~vDs~~el~~l~~~a~~~~~~~~I~lRinp~~~~~~~~~~~tg~~~sKFGi~~~~  177 (431)
T Consensus        80 a~~i~-~~kl~rl~~l~~~~~~~~v~VD~~~~~~~l~~~~~~~g~~~~V~Ievd~G------------~--~RtGv~~~~  144 (374)
T cd06812          80 AVGIA-PAKLPRVLALRRQGVNLTILLDSVEQAQAVAAFSRQHGVRFPVLIEIDCD------------G--HRGGIAPDS  144 (374)
T ss_pred             ECCCC-HHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCC------------C--CCCCCCCCH
T ss_conf             35778-78999999997369948999557999999999999759944699997689------------9--867889706


Q ss_pred             C-HHHHHHHHHCCCCCHHHHHHHHHH-CC-CCCHHH----HHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCCCC
Q ss_conf             1-345777641563220023355641-56-442048----9999999988765310266652688068730002665455
Q gi|254780371|r  178 I-HSLYAYASTLPGVKISGVDMHIGS-QI-DQIESF----HKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRP  250 (431)
Q Consensus       178 ~-~~~~~~~~~~~~l~l~GlH~H~GS-~~-~~~~~~----~~~~~~~~~~~~~l~~~g~~~~~ldiGGGf~i~y~~~~~~  250 (431)
T Consensus       145 ~al~~~~~~~~~~~l~~~G~~~y~Gh~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~vs~Gg-Tpt~~~~~-~~  222 (374)
T cd06812         145 DALLEIARILHDGGAELRGVLTHAGESYACRTPEALAAAAEQERAAAVRAAERLRAAGLPCPVVSVGS-TPTAHFAE-DL  222 (374)
T ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECC-CCCCEEEC-CC
T ss_conf             99999999974799745467623874347899999999999999999999999986599988785268-87400110-36


Q ss_pred             CCHHHHHHHHHHHHCCCCCEEEEEECCEECCC--------------CCEEEEEEEEECCCCCCCCEEECCCCCCCCCCHH
Q ss_conf             31145655565421024530344101112036--------------6325888764034689742200553000110011
Q gi|254780371|r  251 PSSSDYASLIHQYFGNLQCKIILEPGRFLVAD--------------VGILVTKVISIKKSADKTFVILDVAMNDFMRPTL  316 (431)
Q Consensus       251 ~~~~~~~~~i~~~~~~~~~~l~~EPGR~lva~--------------ag~ll~~V~~vK~~~~~~~~~vD~g~~~~~~p~~  316 (431)
T Consensus       223 ~g-------v----------tE~~pG~Yvf~D~~~~~~g~~~~~~~Al~Vl~tViS~~p~--~~~~~iDaG~kals~D~g  283 (374)
T cd06812         223 TG-------V----------TEVRAGVYVFFDLVMAGIGVCGLDDIALSVVTTVIGHQPE--KGWILIDAGWMALSRDRG  283 (374)
T ss_pred             CC-------C----------CCCCCCEEEECCHHHHCCCCCCHHHHHHEEEEEEEECCCC--CCCEEECCCCCEEECCCC
T ss_conf             77-------5----------2015721585047775158897565102244576513789--993797577401211457


Q ss_pred             HCCCCCC----CCCCCCCCCCCEEEEEEEEEECCCCCEEEE----EEECCCCCCCCEEEEECCCCHHHHHHCCCCCCCCC
Q ss_conf             1024653----222234677761589998100056666562----10056688888999967970233340277889866
Q gi|254780371|r  317 YDAYHEI----NYIVNPAGDRLHIHADIVGPICETGDFIAL----NRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLI  388 (431)
Q Consensus       317 ~~~~~~i----~~~~~~~~~~~~~~~~i~G~~C~~~D~l~~----~~~lp~l~~GD~l~i~~~GAY~~s~~s~fn~~p~p  388 (431)
T Consensus       284 ~~-~~~~~~g~g~v~~~~g~~~-~~~~v~~-~seEHg~l~~~~~~~~~~~~l~vGd~v~liP~H~-C~----T~~l~~~-  354 (374)
T cd06812         284 TA-RQAVDQGYGLVCDVAGSPL-PGLIVTS-TNQEHGIIALRGGSDLSLPDLPIGTRLRILPNHA-CA----TAAQHDH-  354 (374)
T ss_pred             CC-CCCCCCCCCEEECCCCCCC-CCEEEEC-CCCCCEEEECCCCCCCCCCCCCCCCEEEEECCCC-CC----CHHCCCE-
T ss_conf             76-6765566655615778858-9848913-5565059977888755456798488899964985-90----2115787-


Q ss_pred             EEEEEE-CCEEEEEEEC
Q ss_conf             599998-8968999824
Q gi|254780371|r  389 PEIMVN-GSQFHIIRPR  404 (431)
Q Consensus       389 ~~v~v~-~g~~~~ir~r  404 (431)
T Consensus       355 -~~vv~~~g~V~~~W~~  370 (374)
T cd06812         355 -YHVLDGEGVVQATWSR  370 (374)
T ss_pred             -EEEEECCCEEEEECCC
T ss_conf             -9999798989998689