HHsearch alignment for GI: 254780371 and conserved domain: cd06814

>cd06814 PLPDE_III_DSD_D-TA_like_3 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase, Unknown Group 3. This subfamily is composed of uncharacterized bacterial proteins with similarity to eukaryotic D-serine dehydratases (DSD) and D-threonine aldolases (D-TA). DSD catalyzes the dehydration of D-serine to aminoacrylate, which is rapidly hydrolyzed to pyruvate and ammonia. D-TA reversibly catalyzes the aldol cleavage of D-threonine into glycine and acetaldehyde, and the synthesis of D-threonine from glycine and acetaldehyde. DSD and D-TA are fold type III PLP-dependent enzymes, similar to bacterial alanine racemase (AR), which contains an N-terminal PLP-binding TIM barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on their similarity to AR, it is possible mem
Probab=99.66  E-value=3.5e-13  Score=109.65  Aligned_cols=338  Identities=12%  Similarity=0.126  Sum_probs=185.2

Q ss_pred             HHCCCCEEEEEHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHHHH-CCC-CEEEECHHHHHHHHHCCCCCCCEE
Q ss_conf             974997899779999999999998614479789996410799999999997-399-289868999865221257843124
Q gi|254780371|r   23 HVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAH-LGS-GLDIVSEGELRRALAAPVPAERIV  100 (431)
Q Consensus        23 ~~~gTP~yV~d~~~i~~n~~~l~~a~~~~~~~i~yAvKaN~~~~il~~l~~-~G~-g~dv~S~~El~~al~~G~~~~~Ii  100 (431)
T Consensus         5 a~i~tP~lvvDldal~~Ni~~m~~~~~~-~~~lRph~Ks~ks~~ll~~~~~~~g~~g~~~~~~~e~~~~~~~~~-~~DiL   82 (379)
T cd06814           5 AGIGEPTLLLDKDRLDHNIDLLREHLAG-SLAYRIVAKSLPSPPLLRHIMKRAGTRRLMVFHQPFLNAVAKAFP-DADIL   82 (379)
T ss_pred             CCCCCCEEEEEHHHHHHHHHHHHHHHCC-CCCCCCEECCCCCHHHHHHHHHHCCCCEEEEECHHHHHHHHHHCC-CCCEE
T ss_conf             0789976996189999999999997568-997353504057999999998745987578821999999997476-66489


Q ss_pred             ECCCCCCCHHHH---HH----HHCCC-CCCCCCCCHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             447754201244---44----20687-23333220246768774113344215899872377867443332233444568
Q gi|254780371|r  101 FSGVGKTIDEID---LA----LQSGI-YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFG  172 (431)
Q Consensus       101 ~~g~~k~~~~l~---~a----i~~gv-~~i~vDs~~el~~l~~~a~~~~~~~~I~lRinp~~~~~~~~~~~tg~~~sKFG  172 (431)
T Consensus        83 l~~p~~~~~~~~~~~~~~~~~~~~~~~i~~~VD~~~~l~~l~~~a~~~g~~l~V~ieiDv----G~~----------R~G  148 (379)
T cd06814          83 LGKPMPVAAAARFYRQLTGSAFRPARQLQWLIDTPERLAQYRALARSLGLTLRINLELDV----GLH----------RGG  148 (379)
T ss_pred             ECCCCCCHHHHHHHHHHHHCCCCCCCCEEEEEECHHHHHHHHHHHHHCCCCEEEEEEECC----CCC----------CCC
T ss_conf             648774078999998733100266561799983899999999999875981689999678----887----------388


Q ss_pred             CC-CCCCHHHHHHHHHCCCCCHHHHHHHHHH--CCCCCH----HHHHHHHHHHHHHHHHH---CCCCCCCEEEECCCCCC
Q ss_conf             87-1111345777641563220023355641--564420----48999999998876531---02666526880687300
Q gi|254780371|r  173 IP-IHQIHSLYAYASTLPGVKISGVDMHIGS--QIDQIE----SFHKAFKLLRDLTQQLR---SNGHNIQHIDVGGGLGI  242 (431)
Q Consensus       173 i~-~~~~~~~~~~~~~~~~l~l~GlH~H~GS--~~~~~~----~~~~~~~~~~~~~~~l~---~~g~~~~~ldiGGGf~i  242 (431)
T Consensus       149 v~~~~~a~~la~~I~~~~~l~l~Glm~Yeghi~~~~~~~~r~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~vn-gGGTgT  227 (379)
T cd06814         149 FADPQTLPKALTAIDAPPRLRFSGLMGYEPHVAKLPGLISPAKARAAAMARYQAFVALARAHLGAHTQKLTLN-TGGSPT  227 (379)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEEEEEEHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEE-ECCCCC
T ss_conf             7897999999999973899779898516465655987031899999999999999999987540367665694-268743


Q ss_pred             CCCCCCCCCCHHHHHH--H-HHHHHCCCCCEEEEEECCEECCCCCEEEEEEEEECCCCCCCCEEECCCCCCCCC---C--
Q ss_conf             0266545531145655--5-654210245303441011120366325888764034689742200553000110---0--
Q gi|254780371|r  243 AYHSDHRPPSSSDYAS--L-IHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMR---P--  314 (431)
Q Consensus       243 ~y~~~~~~~~~~~~~~--~-i~~~~~~~~~~l~~EPGR~lva~ag~ll~~V~~vK~~~~~~~~~vD~g~~~~~~---p--  314 (431)
T Consensus       228 -~~~~~~~~~~tEv~aGS~~f~p~--dfd-----~~~~~~~~pA~~ia~~Vv~--~~~~~~-~~~~~g~~~~~~~~~~~~  296 (379)
T cd06814         228 -YRLYEGDGPVNEVSAGSALVKPT--DFD-----LPALEDHQPALFIATPVLK--VLDALE-IPGLPGLGRLLPLWNPNR  296 (379)
T ss_pred             -CEEECCCCCCEEECCCCCEECCC--CCC-----CCCCCCCCCCHHHHCEEEE--CCCCCC-CCCCCCCCEECCCCCCCC
T ss_conf             -00114799732887773572401--014-----4344455620544100032--168772-123542221014568875


Q ss_pred             ----HHHCCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCEEEEEEECCCCCCCCEEEEECCCCHHHHHHCCCCCCCCCEE
Q ss_conf             ----1110246532222346777615899981000566665621005668888899996797023334027788986659
Q gi|254780371|r  315 ----TLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPE  390 (431)
Q Consensus       315 ----~~~~~~~~i~~~~~~~~~~~~~~~~i~G~~C~~~D~l~~~~~lp~l~~GD~l~i~~~GAY~~s~~s~fn~~p~p~~  390 (431)
T Consensus       297 ~~~~~i~Gg~w~a~-p~~P~Gl---~~~~~~g~se-~q~~l~~-~~~~~L~vGD~V~lrp~ha~-~~----~~~f~--~l  363 (379)
T cd06814         297 RRAYFIYGGNWKAD-PVSPAGL---RYNGLYGRSS-NQEMLNG-SASSQLKVDDYVFLRPTQSE-AV----LLQFG--DI  363 (379)
T ss_pred             CCCEEECCCCCCCC-CCCCCCC---CCCCCCCCCC-CCCEEEC-CCCCCCCCCCEEEEECCCCC-HH----HHHCC--EE
T ss_conf             65403117864566-5478887---7675031466-6411545-77667999999999557533-66----67248--79


Q ss_pred             EEEECCEEEEE
Q ss_conf             99988968999
Q gi|254780371|r  391 IMVNGSQFHII  401 (431)
Q Consensus       391 v~v~~g~~~~i  401 (431)
T Consensus       364 ~vvrgg~vv~~  374 (379)
T cd06814         364 LVVRGGQIIDR  374 (379)
T ss_pred             EEEECCEEEEE
T ss_conf             99999999999