HHsearch alignment for GI: 254780371 and conserved domain: cd06841

>cd06841 PLPDE_III_MccE_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme MccE. This subfamily is composed of uncharacterized proteins with similarity to Escherichia coli MccE, a hypothetical protein that is homologous to eukaryotic ornithine decarboxylase (ODC) and diaminopimelate decarboxylase (DapDC). ODC and DapDC are fold type III PLP-dependent enzymes that contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. ODC participates in the formation of putrescine by catalyzing the decarboxylation of ornithine, the first step in polyamine biosynthesis. DapDC participates in the last step of lysine biosynthesis, the conversion of meso-2,6-diaminoheptanedioate to L-lysine. Most members of this subfamily share the same domain architecture as ODC and DapDC. A few members, including Escherichia coli MccE, contain an additional acetyltransferase domain at the C-terminus.
Probab=100.00  E-value=0  Score=649.84  Aligned_cols=361  Identities=28%  Similarity=0.446  Sum_probs=323.4

Q ss_pred             HHHHCCCCEEEEEHHHHHHHHHHHHHHCCC--CCCEEEEEEECCCCHHHHHHHHHCCCCEEEECHHHHHHHHHCCCCCCC
Q ss_conf             999749978997799999999999986144--797899964107999999999973992898689998652212578431
Q gi|254780371|r   21 LAHVVQTPFYCYSTTAIEKNYLTFSNAFDG--MDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAER   98 (431)
Q Consensus        21 La~~~gTP~yV~d~~~i~~n~~~l~~a~~~--~~~~i~yAvKaN~~~~il~~l~~~G~g~dv~S~~El~~al~~G~~~~~   98 (431)
T Consensus         1 La~~~gTP~yv~d~~~l~~n~~~l~~~~~~~~p~~~i~YAvKaN~~~~vl~~l~~~G~g~DvaS~~El~~al~~g~~~~~   80 (379)
T cd06841           1 LLESYGSPFFVFDEDALRENYRELLGAFKKRYPNVVIAYSYKTNYLPAICKILHEEGGYAEVVSAMEYELALKLGVPGKR   80 (379)
T ss_pred             CCHHHCCCEEEEEHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCE
T ss_conf             91420998899869999999999999987608982999996217589999999983998599899999999985999322


Q ss_pred             EEECCCCCCCHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             24447754201244442068723333220246768774113344215899872377867443332233444568871111
Q gi|254780371|r   99 IVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQI  178 (431)
Q Consensus        99 Ii~~g~~k~~~~l~~ai~~gv~~i~vDs~~el~~l~~~a~~~~~~~~I~lRinp~~~~~~~~~~~tg~~~sKFGi~~~~~  178 (431)
T Consensus        81 Ii~~gp~K~~~~i~~a~~~g~-~i~vDs~~El~~l~~~a~~~~~~~~i~lRvn~~~~---------~~~~skFG~~~~~~  150 (379)
T cd06841          81 IIFNGPYKSKEELEKALEEGA-LINIDSFDELERILEIAKELGRVAKVGIRLNMNYG---------NNVWSRFGFDIEEN  150 (379)
T ss_pred             EEECCCCCCHHHHHHHHHCCC-CCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCC---------CCCCCCCCCCHHHH
T ss_conf             998899898799999998599-30448889999999999864997479999658888---------88643469998999


Q ss_pred             HHHHHHHH---HCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCC------CCCCCC
Q ss_conf             34577764---156322002335564156442048999999998876531026665268806873000------266545
Q gi|254780371|r  179 HSLYAYAS---TLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIA------YHSDHR  249 (431)
Q Consensus       179 ~~~~~~~~---~~~~l~l~GlH~H~GS~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~ldiGGGf~i~------y~~~~~  249 (431)
T Consensus       151 ~~~l~~~~~~~~~~~l~~~GlhfHvGS~~~d~~~~~~~~~~~~~~~~~~--~~~~~~~idiGGGf~~~~~~~~~~~~~~~  228 (379)
T cd06841         151 GEALAALKKIQESKNLSLVGLHCHVGSNILNPEAYSAAAKKLIELLDRL--FGLELEYLDLGGGFPAKTPLSLAYPQEDT  228 (379)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHH--CCCCCEEEEECCCCCCCCCCCCCCCCCCC
T ss_conf             9999999987545897299999888987589899999999999999996--19996099807875767776545678889


Q ss_pred             CCCHHHHHHHHHHHHCCC------CCEEEEEECCEECCCCCEEEEEEEEECCCCCCCCEEECCCCCCCCCCHHHCCCCCC
Q ss_conf             531145655565421024------53034410111203663258887640346897422005530001100111024653
Q gi|254780371|r  250 PPSSSDYASLIHQYFGNL------QCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEI  323 (431)
Q Consensus       250 ~~~~~~~~~~i~~~~~~~------~~~l~~EPGR~lva~ag~ll~~V~~vK~~~~~~~~~vD~g~~~~~~p~~~~~~~~i  323 (431)
T Consensus       229 ~~~~~~~~~~i~~~l~~~~~~~~~~~~li~EPGR~lv~~ag~lv~~V~~~K~~~~~~~~~~D~g~~~~~~~~~~--~~~~  306 (379)
T cd06841         229 VPDPEDYAEAIASTLKEYYANKENKPKLILEPGRALVDDAGYLLGRVVAVKNRYGRNIAVTDAGINNIPTIFWY--HHPI  306 (379)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHHHHCCEEEEEEEEEEEEECCCEEEEECCCCCCCCCHHHC--CCCE
T ss_conf             99999999999999998551027886699816711111415799999999960992799982664577174656--9877


Q ss_pred             CCCCCCCCCCCEEEEEEEEEECCCCCEEEEEEECCCCCCCCEEEEECCCCHHHHHHCCCCCCCCCEEEEEECC
Q ss_conf             2222346777615899981000566665621005668888899996797023334027788986659999889
Q gi|254780371|r  324 NYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGS  396 (431)
Q Consensus       324 ~~~~~~~~~~~~~~~~i~G~~C~~~D~l~~~~~lp~l~~GD~l~i~~~GAY~~s~~s~fn~~p~p~~v~v~~g  396 (431)
T Consensus       307 ~~~~~~~~~~~~~~~~v~G~~C~~~D~l~~~~~lp~l~~GD~l~~~~~GAY~~s~ss~f~-~prPa~vlv~~~  378 (379)
T cd06841         307 LVLRPGKEDPTSKNYDVYGFNCMESDVLFPNVPLPPLNVGDILAIRNVGAYNMTQSNQFI-RPRPAVYLIDNN  378 (379)
T ss_pred             EEECCCCCCCCCEEEEEECCCCCCCCEEEECCCCCCCCCCCEEEECCCCHHHHHHHCCCC-CCCCCEEEEECC
T ss_conf             955788888983089998878663569903513789999999978783754574618788-877829999398