HHsearch alignment for GI: 254780371 and conserved domain: cd06842

>cd06842 PLPDE_III_Y4yA_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Y4yA. This subfamily is composed of the hypothetical Rhizobium sp. protein Y4yA and similar uncharacterized bacterial proteins. These proteins are homologous to eukaryotic ornithine decarboxylase (ODC) and diaminopimelate decarboxylase (DapDC). ODC and DapDC are fold type III PLP-dependent enzymes that contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. ODC participates in the formation of putrescine by catalyzing the decarboxylation of ornithine, the first step in polyamine biosynthesis. DapDC participates in the last step of lysine biosynthesis, the conversion of meso-2,6-diaminoheptanedioate to L-lysine. Proteins in this subfamily may function as PLP-dependent decarboxylases.
Probab=100.00  E-value=0  Score=633.67  Aligned_cols=362  Identities=26%  Similarity=0.374  Sum_probs=299.8

Q ss_pred             HHHHHHHCCCCEEEEEHHHHHHHHHHHHHHCCC--CCCEEEEEEECCCCHHHHHHHHHCCCCEEEECHHHHHHHHHCCCC
Q ss_conf             999999749978997799999999999986144--797899964107999999999973992898689998652212578
Q gi|254780371|r   18 LEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDG--MDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVP   95 (431)
Q Consensus        18 l~~La~~~gTP~yV~d~~~i~~n~~~l~~a~~~--~~~~i~yAvKaN~~~~il~~l~~~G~g~dv~S~~El~~al~~G~~   95 (431)
T Consensus         1 l~~La~~yGTP~yVyd~~~ir~n~~~l~~a~~~~~~~~~i~YAvKAN~~~~il~~l~~~G~g~Dv~S~gEl~~al~aG~~   80 (423)
T cd06842           1 LVALVEAYGSPLNVLFPQTFRENIAALRAVLDRHGVDGRVYFARKANKSLALVRAAAAAGIGVDVASLAELRQALAAGVR   80 (423)
T ss_pred             CHHHHHHHCCCEEEEEHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHHHHHHCCCC
T ss_conf             96898866999799769999999999999987559982699986106899999999984992898699999999985998


Q ss_pred             CCCEEECCCCCCCHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCC-CCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             431244477542012444420687233332202467687741133-4421589987237786744333223344456887
Q gi|254780371|r   96 AERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSL-GKKAPIAFRVNPDINANTHKKISTGKKEDKFGIP  174 (431)
Q Consensus        96 ~~~Ii~~g~~k~~~~l~~ai~~gv~~i~vDs~~el~~l~~~a~~~-~~~~~I~lRinp~~~~~~~~~~~tg~~~sKFGi~  174 (431)
T Consensus        81 ~~~Iv~~g~~Ks~~ei~~Ai~~gv-~i~vDs~~El~~l~~~a~~~~~~~~~V~lRvnp~----------~~~~~sKFGi~  149 (423)
T cd06842          81 GDRIVATGPAKTDEFLWLAVRHGA-TIAVDSLDELDRLLALARGYTTGPARVLLRLSPF----------PASLPSRFGMP  149 (423)
T ss_pred             HHHEEECCCCCCHHHHHHHHHCCC-EEEECCHHHHHHHHHHHHHHCCCCCEEEEEECCC----------CCCCCCCCCCC
T ss_conf             799897389899899999998599-8997899999999999876079962799986789----------99999999899


Q ss_pred             CCCCHHHHHHHHHC-CCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCCCCCC-
Q ss_conf             11113457776415-6322002335564156442048999999998876531026665268806873000266545531-
Q gi|254780371|r  175 IHQIHSLYAYASTL-PGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPS-  252 (431)
Q Consensus       175 ~~~~~~~~~~~~~~-~~l~l~GlH~H~GS~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~ldiGGGf~i~y~~~~~~~~-  252 (431)
T Consensus       150 ~~~~~~~l~~~~~~~~~l~~~GlH~HiGs~--~~~~~~~a~~~~~~~~~~~~~~g~~l~~idiGGGfgv~Y~~~~~~~~~  227 (423)
T cd06842         150 AAEVRTALERLAQLRERVRLVGFHFHLDGY--SAAQRVAALQECLPLIDRARALGLAPRFIDIGGGFPVSYLADAAEWEA  227 (423)
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEEECCCC--CHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCHHHHH
T ss_conf             999999999999639998368988864887--727899999999999999995299977897189977677663102344


Q ss_pred             ---------------------------------------HHHHHHH-----------HHHHHCCCCCEEEEEECCEECCC
Q ss_conf             ---------------------------------------1456555-----------65421024530344101112036
Q gi|254780371|r  253 ---------------------------------------SSDYASL-----------IHQYFGNLQCKIILEPGRFLVAD  282 (431)
Q Consensus       253 ---------------------------------------~~~~~~~-----------i~~~~~~~~~~l~~EPGR~lva~  282 (431)
T Consensus       228 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~iEPGR~lva~  307 (423)
T cd06842         228 FLAALTEALYGYGRPLTWRNEGGTLRGPDDFYPYGQPLVAADWLRAILSAPLPQGRTIAERLRDNGITLALEPGRALLDQ  307 (423)
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCHHHHCC
T ss_conf             33331011102354321112233456653334345675277899998741222224577764256855997665565225


Q ss_pred             CCEEEEEEEEECCCCCCCCE-EECCCCCCCCCCHHHCC-CCCCCC-CCCCCCCCCEEEEEEEEEECCCCCEEEEE-EECC
Q ss_conf             63258887640346897422-00553000110011102-465322-22346777615899981000566665621-0056
Q gi|254780371|r  283 VGILVTKVISIKKSADKTFV-ILDVAMNDFMRPTLYDA-YHEINY-IVNPAGDRLHIHADIVGPICETGDFIALN-RKIA  358 (431)
Q Consensus       283 ag~ll~~V~~vK~~~~~~~~-~vD~g~~~~~~p~~~~~-~~~i~~-~~~~~~~~~~~~~~i~G~~C~~~D~l~~~-~~lp  358 (431)
T Consensus       308 aG~llt~V~~vK~~~~~~~~v~~~g~~~~-~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~v~Gp~C~s~D~l~~~~~~lP  386 (423)
T cd06842         308 CGLTVARVAFVKQLGDGNHLIGLEGNSFS-ACEFSSEFLVDPLLIPAPEPTTDGAPIEAYLAGASCLESDLITRRKIPFP  386 (423)
T ss_pred             CCEEEEEEEEEEECCCCCEEEEECCCCCC-CCHHHCHHCCCCEEECCCCCCCCCCCEEEEEEECCCCCCCEEEECCCCCC
T ss_conf             52499999999765998589996688754-10121100047457436777778885389999816679815860556675


Q ss_pred             C-CCCCCEEEEECCCCHHH-HHHCCCCCCCCCEEEEE
Q ss_conf             6-88888999967970233-34027788986659999
Q gi|254780371|r  359 L-PRPGDLLYIEKTGAYGA-VQSGTYNSRLLIPEIMV  393 (431)
Q Consensus       359 ~-l~~GD~l~i~~~GAY~~-s~~s~fn~~p~p~~v~v  393 (431)
T Consensus       387 ~~~~~GD~l~i~~~GAY~~~~~as~fN~~P~P~~V~V  423 (423)
T cd06842         387 RLPKPGDLLVFPNTAGYQMDFLESRFHRHPLPRRVVV  423 (423)
T ss_pred             CCCCCCCEEEECCCCCCCCCCCHHHCCCCCCCCEEEC
T ss_conf             6799999999938630268422123049999988769