HHsearch alignment for GI: 254780371 and conserved domain: cd06843

>cd06843 PLPDE_III_PvsE_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme PvsE. This subfamily is composed of PvsE from Vibrio parahaemolyticus and similar proteins. PvsE is a vibrioferrin biosynthesis protein which is homologous to eukaryotic ornithine decarboxylase (ODC) and diaminopimelate decarboxylase (DapDC). ODC and DapDC are fold type III PLP-dependent enzymes that contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. It has been suggested that PvsE may be involved in the biosynthesis of the polycarboxylate siderophore vibrioferrin. It may catalyze the decarboxylation of serine to yield ethanolamine. PvsE may require homodimer formation and the presence of the PLP cofactor for activity.
Probab=100.00  E-value=0  Score=670.26  Aligned_cols=366  Identities=25%  Similarity=0.405  Sum_probs=340.8

Q ss_pred             CCCEEEEEHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHHHHCCCCEEEECHHHHHHHHHCCCCCCCEEECCCC
Q ss_conf             99789977999999999999861447978999641079999999999739928986899986522125784312444775
Q gi|254780371|r   26 QTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVG  105 (431)
Q Consensus        26 gTP~yV~d~~~i~~n~~~l~~a~~~~~~~i~yAvKaN~~~~il~~l~~~G~g~dv~S~~El~~al~~G~~~~~Ii~~g~~  105 (431)
T Consensus         1 ~~~~YVyd~~~l~~~~~~l~~a~p~-~~~~~YAvKaN~~~~il~~l~~~G~g~DvaS~~El~~~~~~~-~~~~Iif~gp~   78 (377)
T cd06843           1 PLCAYVYDLAALRAHARALRASLPP-GCELFYAIKANSDPPILRALAPHVDGFEVASGGEIAHVRAAV-PDAPLIFGGPG   78 (377)
T ss_pred             CCCEEEECHHHHHHHHHHHHHHCCC-CCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHHHHHHCC-CCCCEEECCCC
T ss_conf             9867996099999999999985799-984999960388999999999769968982999999998539-99647988999


Q ss_pred             CCCHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             42012444420687233332202467687741133442158998723778674433322334445688711113457776
Q gi|254780371|r  106 KTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYA  185 (431)
Q Consensus       106 k~~~~l~~ai~~gv~~i~vDs~~el~~l~~~a~~~~~~~~I~lRinp~~~~~~~~~~~tg~~~sKFGi~~~~~~~~~~~~  185 (431)
T Consensus        79 K~~~~l~~a~~~gv~~i~~DS~~El~~i~~~~~~~~~~~~v~lRinp~~~~~~~~~~~~~~~~sKFGi~~~~~~~~l~~~  158 (377)
T cd06843          79 KTDSELAQALAQGVERIHVESELELRRLNAVARRAGRTAPVLLRVNLALPDLPSSTLTMGGQPTPFGIDEADLPDALELL  158 (377)
T ss_pred             CCHHHHHHHHHCCCCEEEECCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             99999999998799889988999999999878861996289999967877777554205888877898989999999999


Q ss_pred             HHCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHH-CCCCCCCEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             4156322002335564156442048999999998876531-026665268806873000266545531145655565421
Q gi|254780371|r  186 STLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLR-SNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASLIHQYF  264 (431)
Q Consensus       186 ~~~~~l~l~GlH~H~GS~~~~~~~~~~~~~~~~~~~~~l~-~~g~~~~~ldiGGGf~i~y~~~~~~~~~~~~~~~i~~~~  264 (431)
T Consensus       159 ~~~~~l~~~Glh~HvGS~~~d~~~~~~~~~~~~~~~~~~~~~~g~~~~~iDiGGGf~v~y~~~~~~~d~~~~~~~i~~~~  238 (377)
T cd06843         159 RDLPNIRLRGFHFHLMSHNLDAAAHLALVKAYLETARQWAAEHGLDLDVVNVGGGIGVNYADPEEQFDWAGFCEGLDQLL  238 (377)
T ss_pred             HHCCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             82899856777773367888979999999999999999999719973146505862446788888889899999999999


Q ss_pred             CCC--CCEEEEEECCEECCCCCEEEEEEEEECCCCCCCCEEECCCCCCCCCCHHHCCCCCCCCCCCCC-------CCCCE
Q ss_conf             024--530344101112036632588876403468974220055300011001110246532222346-------77761
Q gi|254780371|r  265 GNL--QCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPA-------GDRLH  335 (431)
Q Consensus       265 ~~~--~~~l~~EPGR~lva~ag~ll~~V~~vK~~~~~~~~~vD~g~~~~~~p~~~~~~~~i~~~~~~~-------~~~~~  335 (431)
T Consensus       239 ~~~~~~~~l~~EPGR~lva~ag~ll~~V~~vK~~~~~~~~~~d~g~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~  318 (377)
T cd06843         239 AEYEPGLTLRFECGRYISAYCGYYVTEVLDLKRSHGEWFAVLRGGTHHFRLPAAWGHNHPFSVLPVEEWPYPWPRPSVRD  318 (377)
T ss_pred             HHCCCCCEEEECCCCEEEECCEEEEEEEEEEEECCCCEEEEECCCCCCCCCHHHHCCCCCEEEEECCCCCCCCCCCCCCC
T ss_conf             85299877997575278714349999999997519937999815534442413413668448875344555557766677


Q ss_pred             EEEEEEEEECCCCCEEEEEEECCCCCCCCEEEEECCCCHHHHHH-CCCCCCCCCEEEEE
Q ss_conf             58999810005666656210056688888999967970233340-27788986659999
Q gi|254780371|r  336 IHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQS-GTYNSRLLIPEIMV  393 (431)
Q Consensus       336 ~~~~i~G~~C~~~D~l~~~~~lp~l~~GD~l~i~~~GAY~~s~~-s~fn~~p~p~~v~v  393 (431)
T Consensus       319 ~~~~v~Gp~C~s~D~l~~~~~lp~l~~GD~L~i~~~GAY~~s~s~~~fn~~p~P~~v~i  377 (377)
T cd06843         319 TPVTLVGQLCTPKDVLARDVPVDRLRAGDLVVFPLAGAYGWNISHHDFLMHPHPERIYL  377 (377)
T ss_pred             CEEEEECCCCCCCCEECCCCCCCCCCCCCEEEECCCCHHHHHHHHHHHCCCCCCCEEEC
T ss_conf             56999916989988887366878899999999958873017560354349999988869