HHsearch alignment for GI: 254780371 and conserved domain: pfam02784

>pfam02784 Orn_Arg_deC_N Pyridoxal-dependent decarboxylase, pyridoxal binding domain. These pyridoxal-dependent decarboxylases acting on ornithine, lysine, arginine and related substrates This domain has a TIM barrel fold.
Probab=100.00  E-value=0  Score=407.79  Aligned_cols=240  Identities=37%  Similarity=0.591  Sum_probs=218.6

Q ss_pred             EHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHHHHCCCCEEEECHHHHHHHHHCCCCCCCEEECCCCCCCHHHH
Q ss_conf             79999999999998614479789996410799999999997399289868999865221257843124447754201244
Q gi|254780371|r   33 STTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEID  112 (431)
Q Consensus        33 d~~~i~~n~~~l~~a~~~~~~~i~yAvKaN~~~~il~~l~~~G~g~dv~S~~El~~al~~G~~~~~Ii~~g~~k~~~~l~  112 (431)
T Consensus         1 D~~~i~~~~~~~~~~~~-p~~~~~YAvKaN~~~~il~~l~~~G~g~dv~S~~El~~al~~g~~~~~I~~~g~~k~~~~i~   79 (245)
T pfam02784         1 DLGRIIERAHALWQAFL-PRIQPFYAVKANSDPAVLRLLAELGLGFDCASKGELERVLAAGVPPERIIFANPCKSRSELR   79 (245)
T ss_pred             CHHHHHHHHHHHHHHHC-CCCEEEEEEEECCCHHHHHHHHHCCCCEEEECHHHHHHHHHCCCCHHHEEEECCCCCHHHHH
T ss_conf             96899999999999848-99779988501888999999998299299989999999998698957889814435468999


Q ss_pred             HHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCC
Q ss_conf             44206872333322024676877411334421589987237786744333223344456887111134577764156322
Q gi|254780371|r  113 LALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVK  192 (431)
Q Consensus       113 ~ai~~gv~~i~vDs~~el~~l~~~a~~~~~~~~I~lRinp~~~~~~~~~~~tg~~~sKFGi~~~~~~~~~~~~~~~~~l~  192 (431)
T Consensus        80 ~a~~~gv~~i~vDs~~el~~i~~~~~~----~~i~lRvnp~~~~~~~~~~~~g~-~sKFGi~~~~~~~~~~~~~~~-~~~  153 (245)
T pfam02784        80 YALEHGVVCVTVDNVEELEKLARLAPE----ARLLLRVKPDVDAHAHCYLSTGQ-DSKFGADLEEAEALLKAAKEL-GLN  153 (245)
T ss_pred             HHHHHCCCCEEECCHHHHHHHHHHCCC----CCEEEEEEECCCCCCCCCCCCCC-CCCCCCCHHHHHHHHHHHHHC-CCC
T ss_conf             999827761442799999999985753----77899994067766554444688-777689999999999999867-997


Q ss_pred             HHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHCC-----C
Q ss_conf             00233556415644204899999999887653102666526880687300026654553114565556542102-----4
Q gi|254780371|r  193 ISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASLIHQYFGN-----L  267 (431)
Q Consensus       193 l~GlH~H~GS~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~ldiGGGf~i~y~~~~~~~~~~~~~~~i~~~~~~-----~  267 (431)
T Consensus       154 ~~GlH~H~GSq~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~idiGGGf~v~Y~~~~---~~~~~~~~i~~~~~~~~~~~~  230 (245)
T pfam02784       154 VVGVHFHVGSGCTDAEAFVKAARDARNVFDQGAELGFELKILDLGGGFGVDYTGAE---DFEEYAEVINAALEEVFPHDP  230 (245)
T ss_pred             EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCC---CHHHHHHHHHHHHHHHHCCCC
T ss_conf             54755653657899899999999999999999980998319985899588889999---989999999999999845599


Q ss_pred             CCEEEEEECCEECCC
Q ss_conf             530344101112036
Q gi|254780371|r  268 QCKIILEPGRFLVAD  282 (431)
Q Consensus       268 ~~~l~~EPGR~lva~  282 (431)
T Consensus       231 ~~~l~~EPGR~lvap  245 (245)
T pfam02784       231 HPTIIAEPGRYIVAP  245 (245)
T ss_pred             CEEEEEECCCCCCCC
T ss_conf             808999578000286