BLAST/PSIBLAST alignment of GI: 254780371 and GI: 15966402 at iteration 1
>gi|15966402|ref|NP_386755.1| diaminopimelate DAP decarboxylase protein [Sinorhizobium meliloti 1021] Length = 422
>gi|307315801|ref|ZP_07595314.1| diaminopimelate decarboxylase [Sinorhizobium meliloti BL225C] Length = 422
>gi|307321017|ref|ZP_07600423.1| diaminopimelate decarboxylase [Sinorhizobium meliloti AK83] Length = 422
>gi|15075673|emb|CAC47228.1| Probable diaminopimelate DAP decarboxylase [Sinorhizobium meliloti 1021] Length = 422
>gi|306893292|gb|EFN24072.1| diaminopimelate decarboxylase [Sinorhizobium meliloti AK83] Length = 422
>gi|306898547|gb|EFN29221.1| diaminopimelate decarboxylase [Sinorhizobium meliloti BL225C] Length = 422
 Score =  556 bits (1433), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 252/422 (59%), Positives = 328/422 (77%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y +G L+AE+V L ++A  V TPFYCYST  +E++Y  FS AF  +D MVCYA+K
Sbjct: 1   MNHFQYRDGILYAEDVPLTEIARAVGTPFYCYSTATLERHYKVFSQAFADVDAMVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTL  LG+GLD+VSEGELRRALAA +PA RI+FSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLKTLGRLGAGLDVVSEGELRRALAAGIPAGRIMFSGVGKTAREMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ LNQRAV  G++AP++FR+NPD++A TH KISTGKKE+KFGI   +   
Sbjct: 121 CFNVESEPELEVLNQRAVRAGRRAPVSFRINPDVDARTHAKISTGKKENKFGISWERARG 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A+ LPG++++G+DMHIGSQI +++ F  AFKLLR+L   LRS+GH I+H+D+GGGL
Sbjct: 181 VYAHAAELPGIEVTGIDMHIGSQITELQPFDDAFKLLRELVDTLRSDGHVIEHVDIGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+ PP   D YA ++      L CKI+ EPGR +V + GILVT+V+ +K   DK
Sbjct: 241 GIPYREDNNPPPLPDAYADIVKNQLKGLDCKIVTEPGRLIVGNAGILVTEVVYVKDGGDK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+AYHEI  +   A     I AD+VGP+CETGD++AL+R++A+
Sbjct: 301 TFVIVDGAMNDLIRPTLYEAYHEIRPVKISAASAPRIKADVVGPVCETGDYLALDREMAM 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P+PGDL  I   GAYGAVQ+GTYNSRLL+PE++V G +FH+IRPR  + ELI LDS+P W
Sbjct: 361 PKPGDLFAIGSAGAYGAVQAGTYNSRLLVPEVLVKGDRFHVIRPRRDYDELIGLDSVPDW 420

Query: 420 LQ 421
           L 
Sbjct: 421 LD 422