BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780371|ref|YP_003064784.1| diaminopimelate decarboxylase
protein [Candidatus Liberibacter asiaticus str. psy62]
         (431 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780371|ref|YP_003064784.1| diaminopimelate decarboxylase protein [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040048|gb|ACT56844.1| diaminopimelate decarboxylase protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 431

 Score =  892 bits (2305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/431 (100%), Positives = 431/431 (100%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK
Sbjct: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY
Sbjct: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS
Sbjct: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL
Sbjct: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT
Sbjct: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP
Sbjct: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
           RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL
Sbjct: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420

Query: 421 QKTPKQSSENY 431
           QKTPKQSSENY
Sbjct: 421 QKTPKQSSENY 431


>gi|315121839|ref|YP_004062328.1| diaminopimelate decarboxylase protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495241|gb|ADR51840.1| diaminopimelate decarboxylase protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 422

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/422 (80%), Positives = 381/422 (90%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+AFKY+ GSLHAE+VSLEK++  VQTPFYCY+T AIE+NYLTFS A DGM+TM+CYA+K
Sbjct: 1   MNAFKYYRGSLHAEDVSLEKISQTVQTPFYCYATAAIEQNYLTFSRALDGMNTMICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAVI+TLA LGSGLDIVSEGEL RAL+A VPAE+IVFSGVGKTI E+DLALQ+GIY
Sbjct: 61  ANSNQAVIQTLARLGSGLDIVSEGELHRALSAQVPAEKIVFSGVGKTISEMDLALQTGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ESESEL TLNQRA+SLGK API+FRVNPD+NANTHKKISTGKKEDKFGIPIHQIHS
Sbjct: 121 CFNIESESELITLNQRAISLGKIAPISFRVNPDVNANTHKKISTGKKEDKFGIPIHQIHS 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LY YA  LPG+KISG+DMHIGSQI+QIESF +AFKLLR+ T +LRS+GHNIQHIDVGGGL
Sbjct: 181 LYDYAKDLPGIKISGIDMHIGSQINQIESFCQAFKLLRETTLKLRSDGHNIQHIDVGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y HS+  PPS SDYASLIH+YFG+LQCKIILEPGRFLVAD GILV+KVIS+KKS DK
Sbjct: 241 GITYCHSNPPPPSPSDYASLIHKYFGDLQCKIILEPGRFLVADAGILVSKVISVKKSTDK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILDVAMNDFMRPTLYDAYHEI YI +P   RLH+ ADIVGPICETGDFIALNR I L
Sbjct: 301 IFIILDVAMNDFMRPTLYDAYHEIKYISSPEEGRLHVQADIVGPICETGDFIALNRTIPL 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P+ GD+LYIEK GAYGAVQSGTYNSR LIPE+MV  SQFHIIRPRM+FQ+LIE+DS P W
Sbjct: 361 PQAGDILYIEKAGAYGAVQSGTYNSRRLIPEVMVKDSQFHIIRPRMSFQKLIEMDSTPEW 420

Query: 420 LQ 421
           L+
Sbjct: 421 LK 422


>gi|190893634|ref|YP_001980176.1| diaminopimelate decarboxylase [Rhizobium etli CIAT 652]
 gi|190698913|gb|ACE92998.1| diaminopimelate decarboxylase protein [Rhizobium etli CIAT 652]
          Length = 422

 Score =  566 bits (1460), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 255/422 (60%), Positives = 333/422 (78%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y +G LHAENV + ++A  V TPFY YST  +E++Y  FS AF  MD+MVCYA+K
Sbjct: 1   MNHFEYRDGILHAENVPVPEIAKAVGTPFYVYSTATLERHYRVFSEAFADMDSMVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTL  LG+G+D+VSEGELRRALAA +PA RI+FSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLKTLGRLGAGIDVVSEGELRRALAADIPASRIMFSGVGKTPSEMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ LNQRAVS GKKAP++FR+NPD++A TH KISTGKKE+KFGI   +  +
Sbjct: 121 CFNVESEPELEILNQRAVSAGKKAPVSFRINPDVDAKTHSKISTGKKENKFGISWERARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A+ LPG++++G+DMHIGSQI +++ F  AFKLLRDL   LR++GH I H+D+GGGL
Sbjct: 181 IYAHAAKLPGIEVTGIDMHIGSQITELQPFDDAFKLLRDLVATLRADGHTIDHVDIGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y  D+ PP   D YA+++     +L CK+I EPGR +V + GILVT+V+ +K   +K
Sbjct: 241 GVPYKDDNNPPPLPDAYAAIVKNQLRDLNCKVITEPGRLIVGNAGILVTEVLYVKDGGEK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+AYHEI  +   A +   I AD+VGP+CETGD++AL+R++A+
Sbjct: 301 TFVIVDGAMNDLIRPTLYEAYHEIRPVTISAANAPRIRADVVGPVCETGDYLALDREMAM 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P+PGDLL +   GAYGAVQ+GTYNSRLL+PE++V G  FH IRPR T+ ELI LDS+PAW
Sbjct: 361 PKPGDLLAVSTAGAYGAVQAGTYNSRLLVPEVLVKGGDFHAIRPRRTYAELISLDSVPAW 420

Query: 420 LQ 421
           L 
Sbjct: 421 LD 422


>gi|241206546|ref|YP_002977642.1| diaminopimelate decarboxylase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240860436|gb|ACS58103.1| diaminopimelate decarboxylase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 422

 Score =  566 bits (1458), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 256/422 (60%), Positives = 332/422 (78%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y +G LHAENV + ++A  V TPFY YST  +E++Y  FS AF  MD+MVCYA+K
Sbjct: 1   MNHFEYRDGVLHAENVPVPEIAKAVGTPFYVYSTATLERHYRVFSEAFADMDSMVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTL  LG+G+D+VSEGELRRALAA +PA RI+FSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLKTLGRLGAGIDVVSEGELRRALAADIPASRIMFSGVGKTPSEMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ LNQRAVS GKKAP++FR+NPD++A TH KISTGKKE+KFGI   +  +
Sbjct: 121 CFNVESEPELEILNQRAVSAGKKAPVSFRINPDVDAKTHSKISTGKKENKFGISWERARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A+ LPG++++G+DMHIGSQI +++ F  AFKLL DL   LR++GH I H+D+GGGL
Sbjct: 181 IYAHAAKLPGIEVTGIDMHIGSQITELQPFDDAFKLLHDLVATLRADGHTIHHVDIGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+ PP   D YA+++      L CKII EPGR +V + GILVT+V+ +K   +K
Sbjct: 241 GIPYKDDNNPPPLPDAYAAIVKNQLRGLNCKIITEPGRLIVGNAGILVTEVLYVKDGGEK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+AYHEI  +   A +   I AD+VGP+CETGD++AL+R++A+
Sbjct: 301 TFVIVDGAMNDLIRPTLYEAYHEIRPVTISAANAPRIRADVVGPVCETGDYLALDREMAM 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P+PGDL+ +   GAYGAVQ+GTYNSRLL+PE++V GS FH IRPR T+ ELI LDS+PAW
Sbjct: 361 PKPGDLMAVSTAGAYGAVQAGTYNSRLLVPEVLVRGSDFHTIRPRRTYAELISLDSVPAW 420

Query: 420 LQ 421
           L 
Sbjct: 421 LD 422


>gi|116254060|ref|YP_769898.1| diaminopimelate decarboxylase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258708|emb|CAK09813.1| putative diaminopimelate decarboxylase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 422

 Score =  565 bits (1456), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 256/422 (60%), Positives = 332/422 (78%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y +G LHAENV + ++A  V TPFY YST  +E++Y  FS AF  MD+MVCYA+K
Sbjct: 1   MNHFEYRDGVLHAENVPVPEIAKAVGTPFYVYSTATLERHYRVFSEAFADMDSMVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTL  LG+G+D+VSEGELRRALAA +PA RI+FSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLKTLGRLGAGIDVVSEGELRRALAADIPANRIMFSGVGKTPSEMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ LNQRAVS GKKAP++FR+NPD++A TH KISTGKKE+KFGI   +  +
Sbjct: 121 CFNVESEPELEILNQRAVSAGKKAPVSFRINPDVDAKTHSKISTGKKENKFGISWERARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A+ LPG++++G+DMHIGSQI +++ F  AFKLL DL   LR++GH I H+D+GGGL
Sbjct: 181 IYAHAARLPGIEVTGIDMHIGSQITELQPFDDAFKLLHDLVATLRADGHTIHHVDIGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+ PP   D YA+++      L CKII EPGR +V + GILVT+V+ +K   +K
Sbjct: 241 GIPYKDDNNPPPLPDAYAAIVKNQLRGLDCKIITEPGRLIVGNAGILVTEVLYVKDGGEK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+AYHEI  +   A +   I AD+VGP+CETGD++AL+R++A+
Sbjct: 301 TFVIVDGAMNDLIRPTLYEAYHEIRPVTISAANAPRIRADVVGPVCETGDYLALDREMAM 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P+PGDL+ +   GAYGAVQ+GTYNSRLL+PE++V GS FH IRPR T+ ELI LDS+PAW
Sbjct: 361 PKPGDLMAVSTAGAYGAVQAGTYNSRLLVPEVLVRGSDFHTIRPRRTYAELISLDSVPAW 420

Query: 420 LQ 421
           L 
Sbjct: 421 LD 422


>gi|209551143|ref|YP_002283060.1| diaminopimelate decarboxylase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209536899|gb|ACI56834.1| diaminopimelate decarboxylase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 422

 Score =  560 bits (1444), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 254/422 (60%), Positives = 330/422 (78%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y +G LHAENV + ++A  V TPFY YST  +E++Y  FS AF  MD+MVCYA+K
Sbjct: 1   MNHFEYRDGVLHAENVPVPEIAKAVGTPFYVYSTATLERHYRVFSEAFADMDSMVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTL  LG+G+D+VSEGELRRALAA +PA RI+FSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLKTLGRLGAGIDVVSEGELRRALAAGIPASRIMFSGVGKTPQEMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ LNQRAV  G KAP++FR+NPD++A TH KISTGKKE+KFGI   +  +
Sbjct: 121 CFNVESEPELEILNQRAVKAGTKAPVSFRINPDVDAKTHSKISTGKKENKFGISWERARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A+ LPG++++G+DMHIGSQI +++ F  AFKLL DL   LR++GH I H+D+GGGL
Sbjct: 181 IYAHAARLPGIEVTGIDMHIGSQITELQPFDDAFKLLHDLVATLRADGHTIDHVDIGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+ PP   D YA+++      L CKII EPGR +V + GILVT+V+ +K   +K
Sbjct: 241 GIPYKDDNNPPPLPDAYAAIVKNQLRGLNCKIITEPGRLIVGNAGILVTEVLYVKDGGEK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+AYHEI  +   A +   I AD+VGP+CETGD++AL+R++A+
Sbjct: 301 TFVIVDGAMNDLIRPTLYEAYHEIRPVTISAANAPRIRADVVGPVCETGDYLALDREMAM 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P+PGDL+ +   GAYGAVQ+GTYNSRLL+PE++V GS FH IRPR T+ ELI LDS+PAW
Sbjct: 361 PKPGDLIAVSTAGAYGAVQAGTYNSRLLVPEVLVKGSDFHTIRPRRTYAELIGLDSVPAW 420

Query: 420 LQ 421
           L 
Sbjct: 421 LD 422


>gi|86359380|ref|YP_471272.1| diaminopimelate decarboxylase protein [Rhizobium etli CFN 42]
 gi|86283482|gb|ABC92545.1| diaminopimelate decarboxylase protein [Rhizobium etli CFN 42]
          Length = 422

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 251/422 (59%), Positives = 332/422 (78%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y +G L+AENV + ++A  V TPFY YST  +E++Y  FS AF  +D+MVCYA+K
Sbjct: 1   MNHFDYRDGILYAENVPVPEIAKAVGTPFYVYSTATLERHYRVFSEAFADVDSMVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTL  LG+G+D+VSEGELRRALAA +PA RI+FSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLKTLGRLGAGIDVVSEGELRRALAAGIPANRIMFSGVGKTPQEMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ LNQRAV+ GK AP++FR+NPD++A TH KISTGKKE+KFGI   +  +
Sbjct: 121 CFNVESEPELEILNQRAVNAGKTAPVSFRINPDVDAKTHAKISTGKKENKFGISWDRARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A+ LPG++++G+DMHIGSQI +++ F  AFKLL DL   LR++GH+I H+D+GGGL
Sbjct: 181 IYAHAAKLPGIEVTGIDMHIGSQITELQPFDDAFKLLSDLVATLRADGHSIHHVDIGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y  D+ PP   D YA+++      L CKII EPGR +V + GILVT+V+ +K   +K
Sbjct: 241 GVPYKDDNNPPPLPDAYAAIVKNQLRGLNCKIITEPGRLIVGNAGILVTEVLYVKDGGEK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+AYHEI  +   A +   I AD+VGP+CETGD++AL+R++A+
Sbjct: 301 TFVIVDGAMNDLIRPTLYEAYHEIRPVTISAANAPRIRADVVGPVCETGDYLALDREMAM 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P+PGDL+ +   GAYGAVQ+GTYNSRLL+PE++V GS FH+IRPR T+ ELI LDS+PAW
Sbjct: 361 PKPGDLMAVSTAGAYGAVQAGTYNSRLLVPEVLVKGSDFHVIRPRRTYAELISLDSVPAW 420

Query: 420 LQ 421
           L 
Sbjct: 421 LD 422


>gi|150397736|ref|YP_001328203.1| diaminopimelate decarboxylase [Sinorhizobium medicae WSM419]
 gi|150029251|gb|ABR61368.1| diaminopimelate decarboxylase [Sinorhizobium medicae WSM419]
          Length = 422

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 254/422 (60%), Positives = 328/422 (77%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y +G L+AE+V L ++A  V TPFYCYST  +E++Y  FS AF  +D MVCYA+K
Sbjct: 1   MNHFQYRDGILYAEDVPLTEIARAVGTPFYCYSTATLERHYKVFSQAFADVDAMVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTL  LG+GLD+VSEGELRRALAA +P  RI+FSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLKTLGRLGAGLDVVSEGELRRALAAGIPPSRIMFSGVGKTAREMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ LNQR V  GK+AP++FR+NPD++A TH KISTGKKE+KFGI   +  S
Sbjct: 121 CFNVESEPELEVLNQRGVRAGKRAPVSFRINPDVDARTHAKISTGKKENKFGISWERARS 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A+TLPG++++G+DMHIGSQI +++ F  AFKLLR+L   LRS+GH I+H+D+GGGL
Sbjct: 181 VYAHAATLPGIEVTGIDMHIGSQITELQPFDDAFKLLRELVDTLRSDGHVIEHVDLGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+ PP   D YA ++      L CKI+ EPGR +V + GILVT+V+ +K   DK
Sbjct: 241 GIPYREDNNPPPLPDAYADVVKNQLKGLDCKIVTEPGRLIVGNAGILVTEVVYVKDGGDK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+AYHEI  +   A     I AD+VGP+CETGD++AL+R++A+
Sbjct: 301 TFVIVDGAMNDLIRPTLYEAYHEIRPVRISAASAPRIKADVVGPVCETGDYLALDREMAM 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           PR GDLL I   GAYGAVQ+GTYNSRLL+PE++V G +FH+IRPR  + ELI LDS+P W
Sbjct: 361 PRAGDLLAIGSAGAYGAVQAGTYNSRLLVPEVLVKGDRFHVIRPRKDYDELIGLDSVPDW 420

Query: 420 LQ 421
           L 
Sbjct: 421 LD 422


>gi|15891339|ref|NP_357011.1| diaminopimelate decarboxylase [Agrobacterium tumefaciens str. C58]
 gi|15159724|gb|AAK89796.1| diaminopimelate decarboxylase [Agrobacterium tumefaciens str. C58]
          Length = 422

 Score =  556 bits (1433), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 252/422 (59%), Positives = 333/422 (78%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y +G LHAENV + ++A  V TPFY YST  +E++Y  FS AF  +D MVCYA+K
Sbjct: 1   MNHFGYIDGVLHAENVPVPEIAKAVGTPFYVYSTATLERHYKVFSGAFADVDAMVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTLA LG+G+D+VS GELRRALAA VPA RI+FSGVGKT+ E+D AL++GIY
Sbjct: 61  ANSNQAVLKTLAKLGAGIDVVSGGELRRALAAGVPASRIMFSGVGKTVAEMDYALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ESE EL+ LN RAV  GK+A ++FR+NPD++A TH KISTGKKE+KFGI   +  +
Sbjct: 121 CFNIESEPELEVLNLRAVKAGKRAHVSFRINPDVDARTHAKISTGKKENKFGISYERARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A+TLPG++++G+DMHIGSQI +++ F  AF+LLR+L + LR++GH I H+D+GGGL
Sbjct: 181 VYAHAATLPGIEVTGIDMHIGSQITELQPFEDAFRLLRELVEVLRTDGHAISHVDIGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+ PP   D YA ++     +L CKI+ EPGR +V + GILVT+VI +K   DK
Sbjct: 241 GIPYRDDNNPPPLPDAYAHIVKNELKSLNCKIVTEPGRLIVGNAGILVTEVIYVKDGGDK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+AYH I  +V P+ +   I ADIVGP+CETGD++AL+R++A 
Sbjct: 301 TFVIVDGAMNDLIRPTLYEAYHGIRPVVQPSENAPRIKADIVGPVCETGDYLALDREMAA 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P+PGDL+ +   GAYGAVQ+GTYNSRLL+PE++V G +FH+IRPR T++ELI LDS+PAW
Sbjct: 361 PQPGDLIAVSSAGAYGAVQAGTYNSRLLVPEVLVKGDRFHVIRPRGTYEELIALDSVPAW 420

Query: 420 LQ 421
           L 
Sbjct: 421 LD 422


>gi|15966402|ref|NP_386755.1| diaminopimelate DAP decarboxylase protein [Sinorhizobium meliloti
           1021]
 gi|307315801|ref|ZP_07595314.1| diaminopimelate decarboxylase [Sinorhizobium meliloti BL225C]
 gi|307321017|ref|ZP_07600423.1| diaminopimelate decarboxylase [Sinorhizobium meliloti AK83]
 gi|15075673|emb|CAC47228.1| Probable diaminopimelate DAP decarboxylase [Sinorhizobium meliloti
           1021]
 gi|306893292|gb|EFN24072.1| diaminopimelate decarboxylase [Sinorhizobium meliloti AK83]
 gi|306898547|gb|EFN29221.1| diaminopimelate decarboxylase [Sinorhizobium meliloti BL225C]
          Length = 422

 Score =  556 bits (1433), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 252/422 (59%), Positives = 328/422 (77%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y +G L+AE+V L ++A  V TPFYCYST  +E++Y  FS AF  +D MVCYA+K
Sbjct: 1   MNHFQYRDGILYAEDVPLTEIARAVGTPFYCYSTATLERHYKVFSQAFADVDAMVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTL  LG+GLD+VSEGELRRALAA +PA RI+FSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLKTLGRLGAGLDVVSEGELRRALAAGIPAGRIMFSGVGKTAREMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ LNQRAV  G++AP++FR+NPD++A TH KISTGKKE+KFGI   +   
Sbjct: 121 CFNVESEPELEVLNQRAVRAGRRAPVSFRINPDVDARTHAKISTGKKENKFGISWERARG 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A+ LPG++++G+DMHIGSQI +++ F  AFKLLR+L   LRS+GH I+H+D+GGGL
Sbjct: 181 VYAHAAELPGIEVTGIDMHIGSQITELQPFDDAFKLLRELVDTLRSDGHVIEHVDIGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+ PP   D YA ++      L CKI+ EPGR +V + GILVT+V+ +K   DK
Sbjct: 241 GIPYREDNNPPPLPDAYADIVKNQLKGLDCKIVTEPGRLIVGNAGILVTEVVYVKDGGDK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+AYHEI  +   A     I AD+VGP+CETGD++AL+R++A+
Sbjct: 301 TFVIVDGAMNDLIRPTLYEAYHEIRPVKISAASAPRIKADVVGPVCETGDYLALDREMAM 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P+PGDL  I   GAYGAVQ+GTYNSRLL+PE++V G +FH+IRPR  + ELI LDS+P W
Sbjct: 361 PKPGDLFAIGSAGAYGAVQAGTYNSRLLVPEVLVKGDRFHVIRPRRDYDELIGLDSVPDW 420

Query: 420 LQ 421
           L 
Sbjct: 421 LD 422


>gi|332716389|ref|YP_004443855.1| Diaminopimelate decarboxylase [Agrobacterium sp. H13-3]
 gi|325063074|gb|ADY66764.1| Diaminopimelate decarboxylase [Agrobacterium sp. H13-3]
          Length = 422

 Score =  554 bits (1428), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 251/422 (59%), Positives = 331/422 (78%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y +G LHAENV + ++A  V TPFY YST  +E++Y  FS AF  +D MVCYA+K
Sbjct: 1   MNHFGYIDGVLHAENVPVPEIAKAVGTPFYVYSTATLERHYKVFSGAFADVDAMVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV++TLA LG+G+D+VS GELRRAL A VPA RI+FSGVGKT+ E+D AL++GIY
Sbjct: 61  ANSNQAVLRTLAKLGAGIDVVSGGELRRALGAGVPANRIMFSGVGKTVAEMDYALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ESE EL+ LN RAV  GK+A ++FR+NPD++A TH KISTGKKE+KFGI   +  +
Sbjct: 121 CFNIESEPELEVLNLRAVKAGKRAHVSFRINPDVDARTHAKISTGKKENKFGISYERARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A+TLPG++++G+DMHIGSQI +++ F  AF+LLR+L + LR++GH I H+D+GGGL
Sbjct: 181 VYAHAATLPGIEVTGIDMHIGSQITELQPFEDAFRLLRELVESLRADGHTISHVDIGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+ PP   D YA ++     +L CKII EPGR +V + GILVT+VI +K   +K
Sbjct: 241 GIPYREDNNPPPLPDAYAHIVKNELKSLNCKIITEPGRLIVGNAGILVTEVIYVKDGGEK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLY+AYH I  +V PA D   I ADIVGP+CETGD++AL+R++A 
Sbjct: 301 NFVIVDGAMNDLIRPTLYEAYHGIRPVVQPAVDAPRIKADIVGPVCETGDYLALDREMAA 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P+PGDL+ +   GAYGAVQ+GTYNSRLL+PE++V G +FH+IRPR T++ELI LDS+PAW
Sbjct: 361 PQPGDLIAVSSAGAYGAVQAGTYNSRLLVPEVLVKGDKFHVIRPRGTYEELIALDSVPAW 420

Query: 420 LQ 421
           L 
Sbjct: 421 LD 422


>gi|227823226|ref|YP_002827198.1| diaminopimelate decarboxylase [Sinorhizobium fredii NGR234]
 gi|227342227|gb|ACP26445.1| diaminopimelate decarboxylase [Sinorhizobium fredii NGR234]
          Length = 422

 Score =  551 bits (1421), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 251/422 (59%), Positives = 328/422 (77%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y +G L+AE+V +  +A  V TPFYCYST  +E++Y  F+ AF  +D MVCYA+K
Sbjct: 1   MNHFDYRDGILYAEDVPVTDIARAVGTPFYCYSTATLERHYRVFAQAFADVDAMVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTL  LG+G+D+VSEGELRRALAA +PAERI+FSGVGKT  E+DL L++GIY
Sbjct: 61  ANSNQAVLKTLGRLGAGIDVVSEGELRRALAAGIPAERIMFSGVGKTPREMDLGLEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ LNQRAV  GK+A ++FR+NPD++A TH KISTGKKE+KFGI   +  +
Sbjct: 121 CFNVESEPELEILNQRAVRAGKQAHVSFRINPDVDARTHAKISTGKKENKFGISWERARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A+TLPG+K++G+DMHIGSQI +++ F  AFKLLR+L   LRS+GH I H+D+GGGL
Sbjct: 181 VYAHAATLPGIKVTGIDMHIGSQITELQPFDDAFKLLRELVDTLRSDGHAIDHVDIGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+ PP   D YA ++      L CKI+ EPGR +V + GILVT+VI +K   +K
Sbjct: 241 GIPYREDNNPPPLPDAYADIVKNQLKGLDCKIVTEPGRLIVGNAGILVTEVIYVKDGGEK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+AYHEI  +   A +   I AD+VGP+CETGD++AL+R++A+
Sbjct: 301 TFVIVDGAMNDLIRPTLYEAYHEIRPVKISAANAPRIKADVVGPVCETGDYLALDREMAM 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P+PGDL  I   GAYGAVQ+GTYNSRLL+PE++V G +FH+IRPR  +  LI+LDS+P W
Sbjct: 361 PKPGDLFAIGSAGAYGAVQAGTYNSRLLVPEVLVKGDRFHVIRPRKDYDALIDLDSVPDW 420

Query: 420 LQ 421
           L 
Sbjct: 421 LD 422


>gi|222087349|ref|YP_002545886.1| diaminopimelate decarboxylase protein [Agrobacterium radiobacter
           K84]
 gi|221724797|gb|ACM27953.1| diaminopimelate decarboxylase protein [Agrobacterium radiobacter
           K84]
          Length = 423

 Score =  546 bits (1408), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 250/421 (59%), Positives = 328/421 (77%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y +G L+AE+V + ++A  V TPFY YST  +E++Y  FS AF  +D MVCYA+K
Sbjct: 1   MNHFQYRDGILYAEDVPVPEIAKAVGTPFYVYSTATLERHYRVFSEAFSDVDAMVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTL  LG+G+D+VS GEL+RALAA +PA RI+FSGVGKT  E+D+AL++GIY
Sbjct: 61  ANSNQAVLKTLGRLGAGVDVVSVGELQRALAAGIPANRIMFSGVGKTAQEMDVALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ LNQRAV  GK AP++FR+NPD++A TH KISTGKKE+KFGI   +  +
Sbjct: 121 CFNVESEPELEVLNQRAVRAGKIAPVSFRINPDVDARTHAKISTGKKENKFGISWERART 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+  +G+DMHIGSQI +++ F  AFKLLR+L + LR +GH+I H+D+GGGL
Sbjct: 181 VYARAANLPGIDATGIDMHIGSQITELQPFEDAFKLLRELVETLRGDGHDIHHVDIGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+ PP   D YA ++      L CKI+ EPGR +V + GILVT+VI +K   +K
Sbjct: 241 GIPYRDDNTPPPLPDAYAHIVKDQLRGLNCKIVTEPGRLIVGNAGILVTEVIYVKDGGNK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           +FVI+D AMND +RPTLY+AYHEI  +   A +   I ADIVGP+CETGD++AL+R++A+
Sbjct: 301 SFVIVDAAMNDLIRPTLYEAYHEIRPVEITAANAPRIKADIVGPVCETGDYLALDREMAM 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P+PGDLL +   GAYGAVQ+GTYNSRLL+PE++V GS FH+IR R T++ELI LDSIPAW
Sbjct: 361 PKPGDLLAVSSGGAYGAVQAGTYNSRLLVPEVLVKGSDFHVIRARRTYEELIGLDSIPAW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|222149957|ref|YP_002550914.1| diaminopimelate decarboxylase [Agrobacterium vitis S4]
 gi|221736939|gb|ACM37902.1| diaminopimelate decarboxylase [Agrobacterium vitis S4]
          Length = 423

 Score =  527 bits (1357), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 247/421 (58%), Positives = 329/421 (78%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y +G LHAE+VS+  +A  V TPFYCYST  +E++Y  FS AFDG+D+MVCYA+K
Sbjct: 1   MNHFQYRDGILHAEDVSVPDIAKAVGTPFYCYSTATLERHYRVFSEAFDGVDSMVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTL  LG+G+D+VSEGELRRALAA +P  RI+FSGVGKT  E+DL L+ GIY
Sbjct: 61  ANSNQAVLKTLGQLGAGVDVVSEGELRRALAAGIPPSRILFSGVGKTPSEMDLGLEVGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL  LNQRA+  GK A ++FR+NPD++A TH KISTG+KE+KFGI   +  +
Sbjct: 121 CFNVESEPELDVLNQRALKAGKTAHVSFRINPDVDAGTHAKISTGRKENKFGISYERARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A++L G+K++G+DMHIGSQI  ++ F +AFKLLRDL   LR+ GH I H+DVGGGL
Sbjct: 181 VYARAASLEGIKVTGIDMHIGSQITDLQPFAEAFKLLRDLVTTLRAEGHTIDHVDVGGGL 240

Query: 241 GIAYHSDHR-PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+  PP  + YA+++ Q   +L C+I+ EPGR +V + GILVT+VI +K   +K
Sbjct: 241 GIPYKDDNNPPPDPAAYAAIVKQQLASLDCRIVAEPGRLIVGNAGILVTEVIYVKDGGNK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLYDA+HE+  ++  A     I AD+VGP+CETGD++AL+R++++
Sbjct: 301 TFVIVDAAMNDLIRPTLYDAHHELRPVLLSAASAPRIRADVVGPVCETGDYLALDREMSM 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           PRPGDL+ I   GAYGAVQS TYN+R L+PE++V G QFH+IRPR +++++I LDS+P W
Sbjct: 361 PRPGDLIAIGSAGAYGAVQSSTYNTRRLVPEVLVKGDQFHVIRPRPSYEDMIRLDSLPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|260466687|ref|ZP_05812874.1| diaminopimelate decarboxylase [Mesorhizobium opportunistum WSM2075]
 gi|259029550|gb|EEW30839.1| diaminopimelate decarboxylase [Mesorhizobium opportunistum WSM2075]
          Length = 422

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 236/421 (56%), Positives = 320/421 (76%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y +G LHAE+V++  +A  V TPFYCYST  + ++Y  F+ AF G+D +VCYA+K
Sbjct: 1   MNHFDYRDGVLHAEDVAIPDIAAQVGTPFYCYSTATLTRHYRVFAQAFAGLDALVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV++TLA LG+G D+VSEGELRRALAA +PA +I+FSGVGKT  EID AL +GI 
Sbjct: 61  ANSNQAVLRTLARLGAGADVVSEGELRRALAAGIPAGKILFSGVGKTAREIDFALTAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+LGK API+ R+NPD++A THKKISTGK E+KFGIP  +   
Sbjct: 121 CFNVESEPELELLSSRAVALGKVAPISLRINPDVDARTHKKISTGKAENKFGIPWQRARQ 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+K++G+D HIGSQI +++ F  AF LL DL   LR++GH I+HIDVGGGL
Sbjct: 181 VYARAAELPGIKVTGIDTHIGSQITELQPFDDAFALLVDLVGALRADGHAIEHIDVGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+ PP   D YA ++ +Y   L  K++ EPGR +V + GILV++VI +K+   K
Sbjct: 241 GIPYRVDNNPPPLPDAYAQIVRKYVTKLGLKVMFEPGRLIVGNAGILVSEVIFVKEGDAK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+++D AMND +RPTLYDA+H++  +V P  D   +  D+VGP+CETGD+I L+R +  
Sbjct: 301 NFLVVDAAMNDLIRPTLYDAFHDVRPVVQPPADTPRMMVDVVGPVCETGDYIGLDRDLPR 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + GDL+ +   GAYGAVQ+GTYN+RLL+PE++V+G +FH++RPR+T+ +LI LDS+P W
Sbjct: 361 LKAGDLVAVSTAGAYGAVQAGTYNTRLLVPEVLVDGDRFHVVRPRLTYDDLIGLDSVPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|319781291|ref|YP_004140767.1| diaminopimelate decarboxylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167179|gb|ADV10717.1| diaminopimelate decarboxylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 422

 Score =  523 bits (1348), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 235/421 (55%), Positives = 322/421 (76%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y +G LHAE+V++  +A  V TPFYCYST  + ++Y  F+ +F G+DT+VCYA+K
Sbjct: 1   MNHFDYRDGVLHAEDVAIPDIAAQVGTPFYCYSTATLTRHYRVFAQSFAGLDTLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV++TLA LG+G D+VSEGELRRALAA +PA +I+FSGVGKT  E+D AL +GI 
Sbjct: 61  ANSNQAVLRTLAKLGAGADVVSEGELRRALAAGIPAGKILFSGVGKTAREMDFALAAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+LGK API+ R+NPD++A THKKISTGK E+KFGIP  +   
Sbjct: 121 CFNVESEPELELLSARAVALGKVAPISLRINPDVDARTHKKISTGKAENKFGIPWQRARQ 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+TLPG++I+G+D HIGSQI +++ F  AF LL DL   LR++GH I+HID+GGGL
Sbjct: 181 VYARAATLPGIRITGIDTHIGSQITELQPFDDAFALLVDLVGALRADGHAIEHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+ PP   D YA ++ ++   L  K++ EPGR +V + GILV++VI +K+   K
Sbjct: 241 GIPYRVDNNPPPLPDAYAQIVRKHVTKLGLKVMFEPGRLIVGNAGILVSEVIFVKEGDAK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+++D AMND +RPTLYDA+H+I  +V P  D   +  D+VGP+CETGD+I L+R +  
Sbjct: 301 NFLVVDAAMNDLIRPTLYDAFHDIRPVVQPPADTPRMMVDVVGPVCETGDYIGLDRDLPR 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + GDL+ +   GAYGAVQ+GTYN+RLL+PE++V+G +FH++RPR+T+ +LI LDS+P W
Sbjct: 361 LKAGDLIAVSTAGAYGAVQAGTYNTRLLVPEVLVDGDRFHVVRPRLTYDDLIGLDSVPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|156105141|gb|ABU49109.1| diaminopimelate decarboxylase [Mesorhizobium ciceri]
          Length = 422

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 235/421 (55%), Positives = 322/421 (76%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y +G LHAE+V++  +A  V TPFYCYST  + ++Y  F+ +F G+DT+VCYA+K
Sbjct: 1   MNHFDYRDGVLHAEDVAIPDIAAQVGTPFYCYSTATLTRHYRVFAQSFAGLDTLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV++TLA LG+G D+VSEGELRRALAA +PA +I+FSGVGKT  E+D AL +GI 
Sbjct: 61  ANSNQAVLRTLAKLGAGADVVSEGELRRALAAGIPAGKILFSGVGKTAREMDFALAAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+LGK API+ R+NPD++A THKKISTGK E+KFGIP  +   
Sbjct: 121 CFNVESEPELELLSARAVALGKVAPISLRINPDVDARTHKKISTGKAENKFGIPWQRARQ 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+TLPG++I+G+D HIGSQI +++ F  AF LL DL   LR++GH I+HID+GGGL
Sbjct: 181 VYARAATLPGIRITGIDTHIGSQITELQPFDDAFALLVDLVGALRADGHAIEHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+ PP   D YA ++ ++   L  K++ EPGR +V + GILV++VI +K+   K
Sbjct: 241 GIPYRVDNNPPPLPDAYAQIVRKHVTKLGLKVMFEPGRLIVGNAGILVSEVIFVKEGDAK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+++D AMND +RPTLYDA+H+I  +V P  D   +  D+VGP+CETGD+I L+R +  
Sbjct: 301 NFLVVDAAMNDLIRPTLYDAFHDIRPVVQPPADTPRMMVDVVGPVCETGDYIGLDRDLPR 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + GDL+ +   GAYGAVQ+GTYN+RLL+PE++V+G +FH++RPR+T+ +LI LDS+P W
Sbjct: 361 LKAGDLIAVSTAGAYGAVQAGTYNTRLLVPEVLVDGDRFHVVRPRLTYDDLIGLDSMPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|13473029|ref|NP_104596.1| diaminopimelate decarboxylase [Mesorhizobium loti MAFF303099]
 gi|14023777|dbj|BAB50382.1| diaminopimelate decarboxylase [Mesorhizobium loti MAFF303099]
          Length = 422

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 234/421 (55%), Positives = 321/421 (76%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y +G LHAE+V++  +A  V TPFYCYST  + ++Y  F+ AF G+D +VCYA+K
Sbjct: 1   MNHFDYRDGVLHAEDVAIPDIAAQVGTPFYCYSTATLTRHYRVFAQAFAGLDALVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV++TLA LG+G D+VSEGELRRALAA +PA +I+FSGVGKT  EIDLAL++GI 
Sbjct: 61  ANSNQAVLRTLARLGAGADVVSEGELRRALAAGIPASKILFSGVGKTAREIDLALEAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+LGK API+ R+NPD++A THKKISTGK E+KFGI   +   
Sbjct: 121 CFNVESEPELELLSARAVALGKVAPISLRINPDVDAKTHKKISTGKAENKFGIAWQRARQ 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+TLPG+K++G+D HIGSQI +++ F  AF LL DL   LR++GH I+H+D+GGGL
Sbjct: 181 VYARAATLPGIKVTGIDTHIGSQITELQPFDDAFALLVDLVGALRADGHAIEHVDLGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+ PP   D YA ++ ++   L  K++ EPGR +V + GILV++VI +K+   K
Sbjct: 241 GIPYRVDNNPPPLPDAYAQIVRKHVTKLGLKVMFEPGRLIVGNAGILVSEVIFVKEGDAK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+++D AMND +RPTLYDA+H+I  +V P  D   +  D+VG +CETGD++ L+R +  
Sbjct: 301 NFLVVDAAMNDLIRPTLYDAFHDIRPVVQPPADTPRMMVDVVGQVCETGDYLGLDRDLPR 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + GDL+ +   GAYGAVQ+GTYN+RLL+PE++V+G +FHI+RPR+T+ +LI LDS+P W
Sbjct: 361 LKAGDLVAVSTAGAYGAVQAGTYNTRLLVPEVLVDGDRFHIVRPRLTYDDLIGLDSVPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|163759920|ref|ZP_02167004.1| probable diaminopimelate dap decarboxylase protein [Hoeflea
           phototrophica DFL-43]
 gi|162282878|gb|EDQ33165.1| probable diaminopimelate dap decarboxylase protein [Hoeflea
           phototrophica DFL-43]
          Length = 422

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 244/422 (57%), Positives = 321/422 (76%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y EG L+AE VS+  +A  V TPFYCYST  + ++Y  F+ AF  +D+MVCYA+K
Sbjct: 1   MNHFEYREGVLYAEGVSVPDIAAEVGTPFYCYSTATLTRHYQVFAGAFSDIDSMVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTLA LGSG+D+VSEGELRRALAA +PA RI+FSGVGKTI E+D AL + IY
Sbjct: 61  ANSNQAVLKTLAKLGSGVDVVSEGELRRALAAGIPASRIMFSGVGKTIREMDAALAADIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ESE EL+ LN RA+++GK API+FR+NPD++A TH KISTGKKEDKFGI   +   
Sbjct: 121 CFNIESEPELEVLNARALAIGKVAPISFRINPDVDAKTHAKISTGKKEDKFGISWQRARD 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y +A+TLPGVK++G+DMHIGSQI +++ F  A KL+ +L   LRS+GH I H D+GGGL
Sbjct: 181 VYRHAATLPGVKVTGIDMHIGSQITELQPFDDALKLMIELIGVLRSDGHIIDHFDIGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y  D+ PP   D Y  ++    G+L CK+ILEPGR +VA+ G+LVT+V+ +K   DK
Sbjct: 241 GVPYRDDNTPPPDPDAYGKMVKARLGDLGCKVILEPGRLIVANAGVLVTEVVYVKDGGDK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLYDA+HE+  +   A     I ADIVGP+CE+GD++A +R++A 
Sbjct: 301 TFVIVDAAMNDLIRPTLYDAWHEVRAVRLSAASAPRIRADIVGPVCESGDYLAKDREMAA 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + GDLL +   GAYGAVQ+GTYN+R LIPE++V    FH++R R +++ELI LD IPAW
Sbjct: 361 VKAGDLLAVGSAGAYGAVQAGTYNTRPLIPEVLVKDDAFHVVRKRPSYEELIALDDIPAW 420

Query: 420 LQ 421
           L 
Sbjct: 421 LD 422


>gi|110635369|ref|YP_675577.1| diaminopimelate decarboxylase [Mesorhizobium sp. BNC1]
 gi|110286353|gb|ABG64412.1| diaminopimelate decarboxylase [Chelativorans sp. BNC1]
          Length = 421

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 234/421 (55%), Positives = 323/421 (76%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y +G LHAENV + ++   V TPFYCYST  +E++Y  FS A  G+D +VCYA+K
Sbjct: 1   MNHFQYRDGVLHAENVPIPRITAAVGTPFYCYSTATLERHYRVFSEALSGLDALVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTL +LG+G D+VS+GELRRALAA +PA +I+FSGVGKT +E+D AL +GI 
Sbjct: 61  ANSNQAVLKTLGNLGAGADVVSQGELRRALAAGIPANKILFSGVGKTGEEMDFALSAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L+ RA ++G KAP++ R+NPD++A THKKISTGK E+KFGIP     +
Sbjct: 121 CFNVESLPELELLSARARAIGVKAPVSLRINPDVDAKTHKKISTGKSENKFGIPWKDARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A++LPG++++G+DMHIGSQI +++ F +AF LL +LT+ LR++GH I+H+D+GGGL
Sbjct: 181 AYARAASLPGLEVTGIDMHIGSQITELQPFDQAFALLTELTETLRADGHAIKHVDLGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y  D+ PP   D YA ++ ++   L  K+I EPGR +V + G+L+++V+ +K+   K
Sbjct: 241 GVPYREDNEPPPLPDAYAEVVRRHVTRLGLKVIFEPGRLIVGNAGVLISRVLYLKEGEGK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+I+D AMND +RPTLYDAYH I  +  PA D  H+ AD+VGP+CETGDF+AL+R +  
Sbjct: 301 NFLIIDAAMNDLIRPTLYDAYHTIRPVAEPAADAPHLKADVVGPVCETGDFLALDRDLPR 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
             PGDL+ +   GAYGAV S TYNSRLL+PE++VNG +FHI+RPR T+++LI LDS+P W
Sbjct: 361 MEPGDLIAVGTAGAYGAVLSSTYNSRLLVPEVLVNGDRFHIVRPRPTYEQLIALDSLPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|239832987|ref|ZP_04681316.1| diaminopimelate decarboxylase [Ochrobactrum intermedium LMG 3301]
 gi|239825254|gb|EEQ96822.1| diaminopimelate decarboxylase [Ochrobactrum intermedium LMG 3301]
          Length = 421

 Score =  514 bits (1323), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 237/421 (56%), Positives = 317/421 (75%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y  G +HAEN+SL ++A  V TPFY YS   +E+++  FS AF GM+T+V YALK
Sbjct: 1   MNHFEYRNGVVHAENISLPEIAQAVGTPFYVYSRATVERHFRVFSEAFAGMETLVTYALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTLA LG+G D VSEGE+RRALAA +PA +IVFSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLKTLAKLGAGADTVSEGEIRRALAAGIPANKIVFSGVGKTPHEMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV  GK A ++ R+NPD++A TH KISTGK E+KFGIP  +   
Sbjct: 121 CFNVESEPELEILSARAVRAGKVASVSLRINPDVDAKTHAKISTGKSENKFGIPRVKARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A++LPG+ + G+DMHIGSQI  +E F  AF L+  L ++L+++GHNI+H+DVGGGL
Sbjct: 181 AYARAASLPGLDVVGIDMHIGSQIIDLEPFDDAFALMAQLVKELQADGHNIRHVDVGGGL 240

Query: 241 GIAYHSDHRPPS-SSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y +D+ PP     YA ++ ++   L  K + EPGR +V + G+LVT+VI +K+   K
Sbjct: 241 GIPYRTDNTPPPLPVAYAEIVARHIKPLGLKTVFEPGRLIVGNAGLLVTEVIFVKEGDAK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLYDA+H+I  +  P  D   I AD VGP+CETGD++ L+R++A 
Sbjct: 301 NFVIVDAAMNDLIRPTLYDAFHDIKPVTLPKDDAPRIRADFVGPVCETGDYLGLDREVAK 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P PGDL+ +  TGAYGAV S TYNSRLLIPE++V+G ++H++RPR T++EL+ LDS+P W
Sbjct: 361 PAPGDLIAVCTTGAYGAVLSSTYNSRLLIPEVLVDGDRYHVVRPRRTYEELLALDSVPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|254713605|ref|ZP_05175416.1| diaminopimelate decarboxylase [Brucella ceti M644/93/1]
 gi|254716041|ref|ZP_05177852.1| diaminopimelate decarboxylase [Brucella ceti M13/05/1]
 gi|261217809|ref|ZP_05932090.1| diaminopimelate decarboxylase [Brucella ceti M13/05/1]
 gi|261321343|ref|ZP_05960540.1| diaminopimelate decarboxylase [Brucella ceti M644/93/1]
 gi|260922898|gb|EEX89466.1| diaminopimelate decarboxylase [Brucella ceti M13/05/1]
 gi|261294033|gb|EEX97529.1| diaminopimelate decarboxylase [Brucella ceti M644/93/1]
          Length = 420

 Score =  513 bits (1320), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 239/420 (56%), Positives = 319/420 (75%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y  G LHAENVSL ++A  V TPFY YS   IE+++  F +AF  MDT+V YALK
Sbjct: 1   MNHFEYRNGVLHAENVSLPEIAKAVGTPFYVYSRATIERHFRVFHDAFADMDTLVTYALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+  LA LG+G D VS+GE+RRALAA +PA RIVFSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLTALAKLGAGADTVSQGEIRRALAAGIPANRIVFSGVGKTPREMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE ELK L+ RAV+ GK AP++ R+NPD++A TH KISTGK E+KFGIP  +  +
Sbjct: 121 CFNVESEPELKILSARAVAAGKVAPVSLRINPDVDAKTHAKISTGKSENKFGIPRDKARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A++LPG+ + G+DMHIGSQI  +E F  AF L+ +L ++L+++GHNI+H+DVGGGL
Sbjct: 181 AYARAASLPGLNVVGIDMHIGSQIIDLEPFDNAFALMAELVKELQADGHNIRHVDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y +D+ PP    YA ++ ++   L  K + EPGR +V + G+LVT+VI +K+   K 
Sbjct: 241 GIPYRTDNTPPPPVAYAQIVAKHIKPLGLKTVFEPGRLIVGNAGLLVTEVIFVKEGDAKN 300

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FVI+D AMND +RPTLYDA+H+I  ++ P  +   I AD VGP+CETGD++ L+R++A P
Sbjct: 301 FVIVDAAMNDLIRPTLYDAFHDIRPVIMPNDNAPRIRADFVGPVCETGDYLGLDREVAKP 360

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
            PGDL+ I  TGAYGAV S TYNSRLLIPE++V+G ++H++RPR T++EL+ LDS+P WL
Sbjct: 361 APGDLIAICTTGAYGAVLSSTYNSRLLIPEVLVDGERYHVVRPRRTYEELLALDSVPDWL 420


>gi|153008332|ref|YP_001369547.1| diaminopimelate decarboxylase [Ochrobactrum anthropi ATCC 49188]
 gi|151560220|gb|ABS13718.1| diaminopimelate decarboxylase [Ochrobactrum anthropi ATCC 49188]
          Length = 421

 Score =  511 bits (1316), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 238/421 (56%), Positives = 316/421 (75%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F++  G LHAENVSL ++A  V TPFY YS   IE+++  FS AF GM+T+V YALK
Sbjct: 1   MNHFEHRNGVLHAENVSLPEIAQAVGTPFYVYSRATIERHFRVFSEAFAGMETLVTYALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+KTLA LG+G D VSEGE+RRALAA +PA +IVFSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNLAVLKTLAKLGAGADTVSEGEIRRALAAGIPANKIVFSGVGKTPHEMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV  GK A ++ R+NPD++A TH KISTGK E+KFGIP  +   
Sbjct: 121 CFNVESEPELEILSARAVKAGKVASVSLRINPDVDAKTHAKISTGKSENKFGIPRVKARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A++LPG+ + G+DMHIGSQI  +E F  AF L+  L ++L+++GHNI+H+DVGGGL
Sbjct: 181 AYARAASLPGLDVVGIDMHIGSQIIDLEPFDNAFALMAQLVKELQADGHNIRHVDVGGGL 240

Query: 241 GIAYHSDHRPPS-SSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y +D+ PP     YA ++ ++   L  K + EPGR +V + G+LVT+VI +K+   K
Sbjct: 241 GIPYRTDNTPPPLPVAYAEIVAKHIKPLGLKTVFEPGRLIVGNAGLLVTEVIFVKEGDAK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLYDA+H+I  +  P  D   I AD VGP+CETGD++ L+R++A 
Sbjct: 301 NFVIVDAAMNDLIRPTLYDAFHDIKPVTLPKDDAPRIRADFVGPVCETGDYLGLDREVAK 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P PGDL+ +  TGAYGAV S TYNSRLLIPE++V+G ++H++RPR T++EL+ LDS+P W
Sbjct: 361 PAPGDLIAVCTTGAYGAVLSSTYNSRLLIPEVLVDGDRYHVVRPRRTYEELLALDSVPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|217979913|ref|YP_002364060.1| diaminopimelate decarboxylase [Methylocella silvestris BL2]
 gi|217505289|gb|ACK52698.1| diaminopimelate decarboxylase [Methylocella silvestris BL2]
          Length = 422

 Score =  509 bits (1311), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 240/423 (56%), Positives = 308/423 (72%), Gaps = 3/423 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+   G L+AENV L  LA  V TPFYCYS+  + ++Y  F +A +G+D++VCYA+K
Sbjct: 1   MHHFESENGVLYAENVDLAALADDVGTPFYCYSSATLSRHYRVFKSALEGIDSLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+ TLA LG+G+D+VSEGELRRALAA  PA +I FSGVGKT  E+  AL++GI+
Sbjct: 61  ANSNQAVLTTLARLGAGMDVVSEGELRRALAAGAPASQITFSGVGKTKQEMAFALKAGIF 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL  L++ A ++G  A IA RVNPD++A TH KISTGK E+KFG+PI +   
Sbjct: 121 CFNVESEPELLALSEVASAIGSTARIAIRVNPDVDAKTHAKISTGKSENKFGVPISRARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A  LP +K+SGVD+HIGSQI  +E F  +FKL       LR++GH+I H+DVGGGL
Sbjct: 181 VYAEAGRLPNIKVSGVDLHIGSQITDLEPFDASFKLAAGFVATLRADGHDIDHVDVGGGL 240

Query: 241 GIAYHSDHRPPS--SSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           GI Y     P S     YA ++    G L+C+I+ EPGR +V + GILVT+V+ +K+   
Sbjct: 241 GIPYREGDDPASYHPDRYARILRARLGPLECRIVCEPGRLIVGNAGILVTRVLYLKRGEA 300

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           KTFVI+D AMND +RPTLYDAYHEI   V P  D   I AD+VGP+CETGD++AL RK+A
Sbjct: 301 KTFVIVDAAMNDLIRPTLYDAYHEIR-PVRPRADAPEILADVVGPVCETGDYLALGRKMA 359

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
            P+PGDLL I   GAYGA QS TYNSRLLIPE++VNG+ + ++RPR  + ELI LD +PA
Sbjct: 360 APQPGDLLAIMSAGAYGATQSSTYNSRLLIPEVLVNGAAYAVVRPRPAYDELIGLDKLPA 419

Query: 419 WLQ 421
           WL+
Sbjct: 420 WLR 422


>gi|294851220|ref|ZP_06791893.1| diaminopimelate decarboxylase [Brucella sp. NVSL 07-0026]
 gi|294819809|gb|EFG36808.1| diaminopimelate decarboxylase [Brucella sp. NVSL 07-0026]
          Length = 421

 Score =  508 bits (1309), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 239/421 (56%), Positives = 319/421 (75%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y  G LHAENVSL ++A  V TPFY YS   IE+++  F +AF  MDT+V YALK
Sbjct: 1   MNHFEYRNGVLHAENVSLPEIAKAVGTPFYVYSRATIERHFRVFHDAFADMDTLVTYALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+  LA LG+G D VS+GE+RRALAA +PA RIVFSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLTALAKLGAGADTVSQGEIRRALAAGIPANRIVFSGVGKTPREMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+ GK AP++ R+NPD++A TH KISTGK E+KFGIP  +  +
Sbjct: 121 CFNVESEPELEILSARAVAAGKVAPVSLRINPDVDAKTHAKISTGKSENKFGIPRDKARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A++LPG+ + G+DMHIGSQI  +E F  AF L+ +L ++L+++GHNI+H+DVGGGL
Sbjct: 181 AYARAASLPGLNVVGIDMHIGSQIIDLEPFDNAFALMAELVKELQADGHNIRHVDVGGGL 240

Query: 241 GIAYHSDHRPPSSS-DYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y +D+ PP     YA ++ ++   L  K + EPGR +V + G+LVT+VI +KK   K
Sbjct: 241 GIPYRTDNTPPPPPVAYAQIVAKHIKPLGLKTVFEPGRLIVGNAGLLVTEVIFVKKGDAK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLYDA+H+I  ++ P  +   I AD VGP+CETGD++ L+R++A 
Sbjct: 301 NFVIVDAAMNDLIRPTLYDAFHDIRPVIMPNDNAPRIRADFVGPVCETGDYLGLDREVAK 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P PGDL+ I  TGAYGAV S TYNSRLLIPE++V+G ++H++RPR T++EL+ LDS+P W
Sbjct: 361 PAPGDLIAICTTGAYGAVLSSTYNSRLLIPEVLVDGERYHVVRPRRTYEELLALDSVPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|306843420|ref|ZP_07476021.1| diaminopimelate decarboxylase [Brucella sp. BO1]
 gi|306276111|gb|EFM57811.1| diaminopimelate decarboxylase [Brucella sp. BO1]
          Length = 421

 Score =  508 bits (1307), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 239/421 (56%), Positives = 319/421 (75%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y  G LHAENVSL ++A  V TPFY YS   IE+++  F +AF  MDT+V YALK
Sbjct: 1   MNHFEYRNGVLHAENVSLPEIAKAVGTPFYVYSRATIERHFRVFHDAFADMDTLVTYALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+  LA LG+G D VSEGE+RRALAA +PA RIVFSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLTALAKLGAGADTVSEGEIRRALAAGIPANRIVFSGVGKTPREMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+ GK AP++ R+NPD++A TH KISTGK E+KFGIP  +  +
Sbjct: 121 CFNVESEPELEILSARAVAAGKVAPVSLRINPDVDAKTHAKISTGKSENKFGIPRDKARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A++LPG+ + G+DMHIGSQI  +E F  AF L+ +L ++L+++GHNI+H+DVGGGL
Sbjct: 181 AYARAASLPGLNVVGIDMHIGSQIIDLEPFDNAFALMAELVKELQADGHNIRHVDVGGGL 240

Query: 241 GIAYHSDHRPPSSS-DYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y +D+ PP     YA ++ ++   L  K + EPGR +V + G+LVT+VI +K+   K
Sbjct: 241 GIPYRTDNTPPPPPVAYAEIVAKHIKPLGLKTVFEPGRLIVGNAGLLVTEVIFVKEGDAK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLYDA+H+I  ++ P  +   I AD VGP+CETGD++ L+R++A 
Sbjct: 301 NFVIVDAAMNDLIRPTLYDAFHDIRPVIVPNDNAPRIRADFVGPVCETGDYLGLDREVAK 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P PGDL+ I  TGAYGAV S TYNSRLLIPE++V+G ++H++RPR T++EL+ LDS+P W
Sbjct: 361 PAPGDLIAICTTGAYGAVLSSTYNSRLLIPEVLVDGERYHVVRPRRTYEELLALDSVPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|256112311|ref|ZP_05453232.1| diaminopimelate decarboxylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|265993744|ref|ZP_06106301.1| diaminopimelate decarboxylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|262764725|gb|EEZ10646.1| diaminopimelate decarboxylase [Brucella melitensis bv. 3 str.
           Ether]
          Length = 421

 Score =  508 bits (1307), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 238/421 (56%), Positives = 319/421 (75%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y  G LHAENVSL ++A  V TPFY YS   IE+++  F +AF  MDT+V YALK
Sbjct: 1   MNHFEYRNGVLHAENVSLPEIAKAVGTPFYVYSRATIERHFRVFHDAFADMDTLVTYALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+  LA LG+G D VS+GE+RRALAA +PA RIVFSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLTALAKLGAGADTVSQGEIRRALAASIPANRIVFSGVGKTPREMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+ GK AP++ R+NPD++A TH KISTGK E+KFGIP  +  +
Sbjct: 121 CFNVESEPELEILSARAVAAGKVAPVSLRINPDVDAKTHAKISTGKSENKFGIPRDKARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A++LPG+ + G+DMHIGSQI  +E F  AF L+ +L ++L+++GHNI+H+DVGGGL
Sbjct: 181 AYARAASLPGLNVVGIDMHIGSQIIDLEPFDNAFALMAELVKELQADGHNIRHVDVGGGL 240

Query: 241 GIAYHSDHRPPSSS-DYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y +D+ PP     YA ++ ++   L  K + EPGR +V + G+LVT+VI +K+   K
Sbjct: 241 GIPYRTDNTPPPPPVAYAQIVAKHIKPLGLKTVFEPGRLIVGNAGLLVTEVIFVKEGDAK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLYDA+H+I  ++ P  +   I AD VGP+CETGD++ L+R++A 
Sbjct: 301 NFVIVDAAMNDLIRPTLYDAFHDIRPVIMPNDNAPRIRADFVGPVCETGDYLGLDREVAK 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P PGDL+ I  TGAYGAV S TYNSRLLIPE++V+G ++H++RPR T++EL+ LDS+P W
Sbjct: 361 PAPGDLIAICTTGAYGAVLSSTYNSRLLIPEVLVDGERYHVVRPRRTYEELLALDSVPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|23502831|ref|NP_698958.1| diaminopimelate decarboxylase [Brucella suis 1330]
 gi|62290831|ref|YP_222624.1| LysA, diaminopimelate decarboxylase [Brucella abortus bv. 1 str.
           9-941]
 gi|82700743|ref|YP_415317.1| diaminopimelate decarboxylase [Brucella melitensis biovar Abortus
           2308]
 gi|148560505|ref|YP_001259800.1| diaminopimelate decarboxylase [Brucella ovis ATCC 25840]
 gi|161619901|ref|YP_001593788.1| diaminopimelate decarboxylase [Brucella canis ATCC 23365]
 gi|189025050|ref|YP_001935818.1| diaminopimelate decarboxylase [Brucella abortus S19]
 gi|225628182|ref|ZP_03786217.1| diaminopimelate decarboxylase [Brucella ceti str. Cudo]
 gi|225853419|ref|YP_002733652.1| diaminopimelate decarboxylase [Brucella melitensis ATCC 23457]
 gi|237816345|ref|ZP_04595338.1| diaminopimelate decarboxylase [Brucella abortus str. 2308 A]
 gi|254690121|ref|ZP_05153375.1| diaminopimelate decarboxylase [Brucella abortus bv. 6 str. 870]
 gi|254694611|ref|ZP_05156439.1| diaminopimelate decarboxylase [Brucella abortus bv. 3 str. Tulya]
 gi|254696236|ref|ZP_05158064.1| diaminopimelate decarboxylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700621|ref|ZP_05162449.1| diaminopimelate decarboxylase [Brucella suis bv. 5 str. 513]
 gi|254704991|ref|ZP_05166819.1| diaminopimelate decarboxylase [Brucella suis bv. 3 str. 686]
 gi|254707493|ref|ZP_05169321.1| diaminopimelate decarboxylase [Brucella pinnipedialis M163/99/10]
 gi|254708966|ref|ZP_05170777.1| diaminopimelate decarboxylase [Brucella pinnipedialis B2/94]
 gi|254731154|ref|ZP_05189732.1| diaminopimelate decarboxylase [Brucella abortus bv. 4 str. 292]
 gi|256030493|ref|ZP_05444107.1| diaminopimelate decarboxylase [Brucella pinnipedialis M292/94/1]
 gi|256158479|ref|ZP_05456377.1| diaminopimelate decarboxylase [Brucella ceti M490/95/1]
 gi|256253898|ref|ZP_05459434.1| diaminopimelate decarboxylase [Brucella ceti B1/94]
 gi|256258375|ref|ZP_05463911.1| diaminopimelate decarboxylase [Brucella abortus bv. 9 str. C68]
 gi|256263101|ref|ZP_05465633.1| diaminopimelate decarboxylase [Brucella melitensis bv. 2 str. 63/9]
 gi|260169399|ref|ZP_05756210.1| diaminopimelate decarboxylase [Brucella sp. F5/99]
 gi|260546098|ref|ZP_05821838.1| diaminopimelate decarboxylase [Brucella abortus NCTC 8038]
 gi|260567535|ref|ZP_05838005.1| diaminopimelate decarboxylase [Brucella suis bv. 4 str. 40]
 gi|260755660|ref|ZP_05868008.1| diaminopimelate decarboxylase [Brucella abortus bv. 6 str. 870]
 gi|260758885|ref|ZP_05871233.1| diaminopimelate decarboxylase [Brucella abortus bv. 4 str. 292]
 gi|260760609|ref|ZP_05872952.1| diaminopimelate decarboxylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884685|ref|ZP_05896299.1| diaminopimelate decarboxylase [Brucella abortus bv. 9 str. C68]
 gi|261214935|ref|ZP_05929216.1| diaminopimelate decarboxylase [Brucella abortus bv. 3 str. Tulya]
 gi|261221035|ref|ZP_05935316.1| diaminopimelate decarboxylase [Brucella ceti B1/94]
 gi|261314977|ref|ZP_05954174.1| diaminopimelate decarboxylase [Brucella pinnipedialis M163/99/10]
 gi|261316465|ref|ZP_05955662.1| diaminopimelate decarboxylase [Brucella pinnipedialis B2/94]
 gi|261751130|ref|ZP_05994839.1| diaminopimelate decarboxylase [Brucella suis bv. 5 str. 513]
 gi|261755692|ref|ZP_05999401.1| diaminopimelate decarboxylase [Brucella suis bv. 3 str. 686]
 gi|261758922|ref|ZP_06002631.1| diaminopimelate decarboxylase [Brucella sp. F5/99]
 gi|265987535|ref|ZP_06100092.1| diaminopimelate decarboxylase [Brucella pinnipedialis M292/94/1]
 gi|265996995|ref|ZP_06109552.1| diaminopimelate decarboxylase [Brucella ceti M490/95/1]
 gi|297247217|ref|ZP_06930935.1| diaminopimelate decarboxylase [Brucella abortus bv. 5 str. B3196]
 gi|23348856|gb|AAN30873.1| diaminopimelate decarboxylase [Brucella suis 1330]
 gi|62196963|gb|AAX75263.1| LysA, diaminopimelate decarboxylase [Brucella abortus bv. 1 str.
           9-941]
 gi|82616844|emb|CAJ11940.1| Orn/DAP/Arg decarboxylase, family 2:ATP/GTP-binding site motif A
           (P-loop):Diaminopimelate decarboxylase [Brucella
           melitensis biovar Abortus 2308]
 gi|148371762|gb|ABQ61741.1| diaminopimelate decarboxylase [Brucella ovis ATCC 25840]
 gi|161336712|gb|ABX63017.1| diaminopimelate decarboxylase [Brucella canis ATCC 23365]
 gi|189020622|gb|ACD73344.1| diaminopimelate decarboxylase [Brucella abortus S19]
 gi|225617007|gb|EEH14054.1| diaminopimelate decarboxylase [Brucella ceti str. Cudo]
 gi|225641784|gb|ACO01698.1| diaminopimelate decarboxylase [Brucella melitensis ATCC 23457]
 gi|237788412|gb|EEP62627.1| diaminopimelate decarboxylase [Brucella abortus str. 2308 A]
 gi|260096205|gb|EEW80081.1| diaminopimelate decarboxylase [Brucella abortus NCTC 8038]
 gi|260157053|gb|EEW92133.1| diaminopimelate decarboxylase [Brucella suis bv. 4 str. 40]
 gi|260669203|gb|EEX56143.1| diaminopimelate decarboxylase [Brucella abortus bv. 4 str. 292]
 gi|260671041|gb|EEX57862.1| diaminopimelate decarboxylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675768|gb|EEX62589.1| diaminopimelate decarboxylase [Brucella abortus bv. 6 str. 870]
 gi|260874213|gb|EEX81282.1| diaminopimelate decarboxylase [Brucella abortus bv. 9 str. C68]
 gi|260916542|gb|EEX83403.1| diaminopimelate decarboxylase [Brucella abortus bv. 3 str. Tulya]
 gi|260919619|gb|EEX86272.1| diaminopimelate decarboxylase [Brucella ceti B1/94]
 gi|261295688|gb|EEX99184.1| diaminopimelate decarboxylase [Brucella pinnipedialis B2/94]
 gi|261304003|gb|EEY07500.1| diaminopimelate decarboxylase [Brucella pinnipedialis M163/99/10]
 gi|261738906|gb|EEY26902.1| diaminopimelate decarboxylase [Brucella sp. F5/99]
 gi|261740883|gb|EEY28809.1| diaminopimelate decarboxylase [Brucella suis bv. 5 str. 513]
 gi|261745445|gb|EEY33371.1| diaminopimelate decarboxylase [Brucella suis bv. 3 str. 686]
 gi|262551463|gb|EEZ07453.1| diaminopimelate decarboxylase [Brucella ceti M490/95/1]
 gi|263093002|gb|EEZ17152.1| diaminopimelate decarboxylase [Brucella melitensis bv. 2 str. 63/9]
 gi|264659732|gb|EEZ29993.1| diaminopimelate decarboxylase [Brucella pinnipedialis M292/94/1]
 gi|297174386|gb|EFH33733.1| diaminopimelate decarboxylase [Brucella abortus bv. 5 str. B3196]
 gi|326409982|gb|ADZ67047.1| diaminopimelate decarboxylase [Brucella melitensis M28]
 gi|326539699|gb|ADZ87914.1| diaminopimelate decarboxylase [Brucella melitensis M5-90]
          Length = 421

 Score =  507 bits (1305), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 238/421 (56%), Positives = 319/421 (75%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y  G LHAENVSL ++A  V TPFY YS   IE+++  F +AF  MDT+V YALK
Sbjct: 1   MNHFEYRNGVLHAENVSLPEIAKAVGTPFYVYSRATIERHFRVFHDAFADMDTLVTYALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+  LA LG+G D VS+GE+RRALAA +PA RIVFSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLTALAKLGAGADTVSQGEIRRALAAGIPANRIVFSGVGKTPREMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+ GK AP++ R+NPD++A TH KISTGK E+KFGIP  +  +
Sbjct: 121 CFNVESEPELEILSARAVAAGKVAPVSLRINPDVDAKTHAKISTGKSENKFGIPRDKARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A++LPG+ + G+DMHIGSQI  +E F  AF L+ +L ++L+++GHNI+H+DVGGGL
Sbjct: 181 AYARAASLPGLNVVGIDMHIGSQIIDLEPFDNAFALMAELVKELQADGHNIRHVDVGGGL 240

Query: 241 GIAYHSDHRPPSSS-DYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y +D+ PP     YA ++ ++   L  K + EPGR +V + G+LVT+VI +K+   K
Sbjct: 241 GIPYRTDNTPPPPPVAYAQIVAKHIKPLGLKTVFEPGRLIVGNAGLLVTEVIFVKEGDAK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLYDA+H+I  ++ P  +   I AD VGP+CETGD++ L+R++A 
Sbjct: 301 NFVIVDAAMNDLIRPTLYDAFHDIRPVIMPNDNAPRIRADFVGPVCETGDYLGLDREVAK 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P PGDL+ I  TGAYGAV S TYNSRLLIPE++V+G ++H++RPR T++EL+ LDS+P W
Sbjct: 361 PAPGDLIAICTTGAYGAVLSSTYNSRLLIPEVLVDGERYHVVRPRRTYEELLALDSVPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|306842881|ref|ZP_07475518.1| diaminopimelate decarboxylase [Brucella sp. BO2]
 gi|306286968|gb|EFM58485.1| diaminopimelate decarboxylase [Brucella sp. BO2]
          Length = 421

 Score =  506 bits (1304), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 238/421 (56%), Positives = 319/421 (75%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y  G LHAENVSL ++A  V TPFY YS   IE+++  F +AF  MDT+V YALK
Sbjct: 1   MNHFEYRNGVLHAENVSLPEIAKAVGTPFYVYSRATIERHFRVFHDAFADMDTLVTYALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+  LA LG+G D VS+GE+RRALAA +PA RIVFSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLTALAKLGAGADTVSQGEIRRALAAGIPANRIVFSGVGKTPREMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+ GK AP++ R+NPD++A TH KISTGK E+KFGIP  +  +
Sbjct: 121 CFNVESEPELEILSARAVAAGKVAPVSLRINPDVDAKTHAKISTGKSENKFGIPRDKARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A++LPG+ + G+DMHIGSQI  +E F  AF L+ +L ++L+++GHNI+H+DVGGGL
Sbjct: 181 AYARAASLPGLNVVGIDMHIGSQIIDLEPFDNAFALMAELVKELQADGHNIRHVDVGGGL 240

Query: 241 GIAYHSDHRPPSSS-DYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y +D+ PP     YA ++ ++   L  K + EPGR +V + G+LVT+VI +K+   K
Sbjct: 241 GIPYRTDNTPPPPPVAYAEIVAKHIKPLGLKTVFEPGRLIVGNAGLLVTEVIFVKEGDAK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLYDA+H+I  ++ P  +   I AD VGP+CETGD++ L+R++A 
Sbjct: 301 NFVIVDAAMNDLIRPTLYDAFHDIRPVIVPNDNAPRIRADFVGPVCETGDYLGLDREVAK 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P PGDL+ I  TGAYGAV S TYNSRLLIPE++V+G ++H++RPR T++EL+ LDS+P W
Sbjct: 361 PAPGDLIAICTTGAYGAVLSSTYNSRLLIPEVLVDGERYHVVRPRRTYEELLALDSVPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|256059955|ref|ZP_05450139.1| diaminopimelate decarboxylase [Brucella neotomae 5K33]
 gi|261323926|ref|ZP_05963123.1| diaminopimelate decarboxylase [Brucella neotomae 5K33]
 gi|261299906|gb|EEY03403.1| diaminopimelate decarboxylase [Brucella neotomae 5K33]
          Length = 421

 Score =  506 bits (1303), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 237/421 (56%), Positives = 318/421 (75%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y  G LHAENVSL ++A  V TPFY YS   IE+++  F +AF  MDT+V YALK
Sbjct: 1   MNHFEYRNGVLHAENVSLPEIAKAVGTPFYVYSRATIERHFRVFHDAFADMDTLVTYALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+  LA LG+G D VS+GE+RRALAA +PA RIVFSG GKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLTALAKLGAGADTVSQGEIRRALAAGIPANRIVFSGAGKTPREMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+ GK AP++ R+NPD++A TH KISTGK E+KFGIP  +  +
Sbjct: 121 CFNVESEPELEILSARAVAAGKVAPVSLRINPDVDAKTHAKISTGKSENKFGIPRDKARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A++LPG+ + G+DMHIGSQI  +E F  AF L+ +L ++L+++GHNI+H+DVGGGL
Sbjct: 181 AYARAASLPGLNVVGIDMHIGSQIIDLEPFDNAFALMAELVKELQADGHNIRHVDVGGGL 240

Query: 241 GIAYHSDHRPPSSS-DYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y +D+ PP     YA ++ ++   L  K + EPGR +V + G+LVT+VI +K+   K
Sbjct: 241 GIPYRTDNTPPPPPVAYAQIVAKHIKPLSLKTVFEPGRLIVGNAGLLVTEVIFVKEGDAK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLYDA+H+I  ++ P  +   I AD VGP+CETGD++ L+R++A 
Sbjct: 301 NFVIVDAAMNDLIRPTLYDAFHDIRPVIMPNDNAPRIRADFVGPVCETGDYLGLDREVAK 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P PGDL+ I  TGAYGAV S TYNSRLLIPE++V+G ++H++RPR T++EL+ LDS+P W
Sbjct: 361 PAPGDLIAICTTGAYGAVLSSTYNSRLLIPEVLVDGERYHVVRPRRTYEELLALDSVPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|163844005|ref|YP_001628409.1| diaminopimelate decarboxylase [Brucella suis ATCC 23445]
 gi|163674728|gb|ABY38839.1| diaminopimelate decarboxylase [Brucella suis ATCC 23445]
          Length = 421

 Score =  506 bits (1302), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 238/421 (56%), Positives = 319/421 (75%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y  G LHAENVSL ++A  V TPFY YS   IE+++  F +AF  MDT+V YALK
Sbjct: 1   MNHFEYRNGVLHAENVSLPEIAKAVGTPFYVYSRATIERHFRVFHDAFADMDTLVTYALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+  LA LG+G D VS+GE+RRALAA +PA RIVFSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLTALAKLGAGADTVSQGEIRRALAAGIPANRIVFSGVGKTPREMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+ GK AP++ R+NPD++A TH KISTGK E+KFGIP  +  +
Sbjct: 121 CFNVESEPELEILSARAVAAGKVAPVSLRINPDVDAKTHAKISTGKSENKFGIPRDKARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A++LPG+ + G+DMHIGSQI  +E F  AF L+ +L ++L+++GHNI+H+DVGGGL
Sbjct: 181 AYARAASLPGLNVVGIDMHIGSQIIDLEPFDNAFALMAELVKELQADGHNIRHVDVGGGL 240

Query: 241 GIAYHSDHRPPSSS-DYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y +D+ PP     YA ++ ++   L  K + EPGR +V + G+LVT+VI +K+   K
Sbjct: 241 GIPYRTDNTPPPPPVAYAQIVAKHIKPLGLKTVFEPGRRIVGNAGLLVTEVIFVKEGDAK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLYDA+H+I  ++ P  +   I AD VGP+CETGD++ L+R++A 
Sbjct: 301 NFVIVDAAMNDLIRPTLYDAFHDIRPVIMPNDNAPRIRADFVGPVCETGDYLGLDREVAK 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P PGDL+ I  TGAYGAV S TYNSRLLIPE++V+G ++H++RPR T++EL+ LDS+P W
Sbjct: 361 PAPGDLIAICTTGAYGAVLSSTYNSRLLIPEVLVDGERYHVVRPRRTYEELLALDSVPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|256370385|ref|YP_003107896.1| diaminopimelate decarboxylase [Brucella microti CCM 4915]
 gi|256000548|gb|ACU48947.1| diaminopimelate decarboxylase [Brucella microti CCM 4915]
          Length = 421

 Score =  506 bits (1302), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 238/421 (56%), Positives = 318/421 (75%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y  G LHAENVSL ++A  V TPFY YS   IE+++  F +AF  MDT+V YALK
Sbjct: 1   MNHFEYRNGVLHAENVSLPEIAKAVGTPFYVYSRATIERHFRVFHDAFADMDTLVTYALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+  LA LG+G D VS GE+RRALAA +PA RIVFSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLTALAKLGAGADTVSHGEIRRALAAGIPANRIVFSGVGKTPREMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+ GK AP++ R+NPD++A TH KISTGK E+KFGIP  +  +
Sbjct: 121 CFNVESEPELEILSARAVAAGKVAPVSLRINPDVDAKTHAKISTGKSENKFGIPRDKARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A++LPG+ + G+DMHIGSQI  +E F  AF L+ +L ++L+++GHNI+H+DVGGGL
Sbjct: 181 AYARAASLPGLNVVGIDMHIGSQIIDLEPFDNAFALMAELVKELQADGHNIRHVDVGGGL 240

Query: 241 GIAYHSDHRPPSSS-DYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y +D+ PP     YA ++ ++   L  K + EPGR +V + G+LVT+VI +K+   K
Sbjct: 241 GIPYRTDNTPPPPPVAYAQIVAKHIKPLGLKTVFEPGRLIVGNAGLLVTEVIFVKEGDAK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLYDA+H+I  ++ P  +   I AD VGP+CETGD++ L+R++A 
Sbjct: 301 NFVIVDAAMNDLIRPTLYDAFHDIRPVIMPNDNAPRIRADFVGPVCETGDYLGLDREVAK 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P PGDL+ I  TGAYGAV S TYNSRLLIPE++V+G ++H++RPR T++EL+ LDS+P W
Sbjct: 361 PAPGDLIAICTTGAYGAVLSSTYNSRLLIPEVLVDGERYHVVRPRRTYEELLALDSVPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|256045584|ref|ZP_05448464.1| diaminopimelate decarboxylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260562895|ref|ZP_05833381.1| diaminopimelate decarboxylase [Brucella melitensis bv. 1 str. 16M]
 gi|265992008|ref|ZP_06104565.1| diaminopimelate decarboxylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260152911|gb|EEW88003.1| diaminopimelate decarboxylase [Brucella melitensis bv. 1 str. 16M]
 gi|263003074|gb|EEZ15367.1| diaminopimelate decarboxylase [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 421

 Score =  504 bits (1297), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 237/421 (56%), Positives = 318/421 (75%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y  G LHAENVSL ++A  V TPFY YS   IE+++  F +AF  MDT+V YALK
Sbjct: 1   MNHFEYRNGVLHAENVSLPEIAKAVGTPFYVYSRATIERHFRVFHDAFADMDTLVTYALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+  LA LG+G D VS+GE+RRALAA +PA RIVFSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLTALAKLGAGADTVSQGEIRRALAAGIPANRIVFSGVGKTPREMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+ GK AP++ R+NPD++A TH KISTGK E+KFGIP  +  +
Sbjct: 121 CFNVESEPELEILSARAVAAGKVAPVSLRINPDVDAKTHAKISTGKSENKFGIPRDKARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A++LPG+ + G+DMHIGSQI  +E F  AF L+ +L ++L+++GHNI+H+DVGGGL
Sbjct: 181 AYARAASLPGLNVVGIDMHIGSQIIDLEPFDNAFALMAELVKELQADGHNIRHVDVGGGL 240

Query: 241 GIAYHSDHRPPSSS-DYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y +D+ PP     YA ++ ++   L  K + EPGR +V + G+LVT+VI +K+   K
Sbjct: 241 GIPYRTDNTPPPPPVAYAQIVAKHIKPLGLKTVFEPGRLIVGNAGLLVTEVIFVKEGDAK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLYDA+H+I  ++ P  +   I AD VGP+CETGD++ L+R++A 
Sbjct: 301 NFVIVDAAMNDLIRPTLYDAFHDIRPVIMPNDNAPRIRADFVGPVCETGDYLGLDREVAK 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P PGDL+ I  TGAYGAV S TYNSRLLIPE++ +G ++H++RPR T++EL+ LDS+P W
Sbjct: 361 PAPGDLIAICTTGAYGAVLSSTYNSRLLIPEVLGDGERYHVVRPRRTYEELLALDSVPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|328541749|ref|YP_004301858.1| diaminopimelate decarboxylase [polymorphum gilvum SL003B-26A1]
 gi|326411501|gb|ADZ68564.1| Diaminopimelate decarboxylase [Polymorphum gilvum SL003B-26A1]
          Length = 424

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 233/424 (54%), Positives = 313/424 (73%), Gaps = 1/424 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+L AE+V +  +A  V TPFYCYST  + ++Y  FS+AF+G+ ++VCYA+K
Sbjct: 1   MHHFDYRDGALFAEDVPVAAIAEAVGTPFYCYSTATLTRHYEVFSSAFEGIPSLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+ TLA LG+G+D+VSEGELRRA AA VPA+RI+FSGVGKT  E  LA+   I 
Sbjct: 61  ANSNQAVLATLARLGAGMDVVSEGELRRARAAGVPADRIMFSGVGKTEAEQALAIDEDIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL  L++ A   G+ A ++ R+NPD++A THKKISTGK E+KFGIP  +  +
Sbjct: 121 CFNVESEPELVQLSRVATEKGRTARVSLRINPDVDARTHKKISTGKAENKFGIPWQRARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LYA A  LPG++++G+DMHIGSQI ++E F  AF  L DL + LR +GH+I+HID+GGGL
Sbjct: 181 LYAEAGELPGIEVTGLDMHIGSQITELEPFDAAFARLGDLVRDLRGDGHHIEHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSS-DYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y +D+ PP    +YA+++ ++   L C+II EPGR +  + GILVT+VI +K+  DK
Sbjct: 241 GIPYVTDNAPPPHPVEYAAVVKKHVDKLGCRIIFEPGRLIAGNAGILVTRVIYVKEGHDK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLYDAYHE+  +     D   I AD+VGP+CETGDF+A +R I  
Sbjct: 301 TFVIVDAAMNDLIRPTLYDAYHEVRPVRAAPADARRIRADVVGPVCETGDFLAHDRDIPE 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GD+L +   GAYGAVQ+GTYNSRLLIPE++VN  +F ++RPR ++ +LI LD +P+W
Sbjct: 361 VGQGDMLAVFSAGAYGAVQAGTYNSRLLIPEVLVNEGEFAVVRPRPSYDDLIGLDRLPSW 420

Query: 420 LQKT 423
           L + 
Sbjct: 421 LAEA 424


>gi|118591377|ref|ZP_01548775.1| diaminopimelate decarboxylase [Stappia aggregata IAM 12614]
 gi|118436049|gb|EAV42692.1| diaminopimelate decarboxylase [Stappia aggregata IAM 12614]
          Length = 424

 Score =  499 bits (1284), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 232/422 (54%), Positives = 306/422 (72%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G L AE+V +E +A  V TPFYCYST  + ++Y  F+ AF  + ++VCYA+K
Sbjct: 1   MHHFDYKNGELFAEDVPIETIAREVGTPFYCYSTATLTRHYQVFAAAFSDIPSLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTLA LG+G+D+VSEGELRRA AA VPA +IVFSGVGKT  E   ALQ  I 
Sbjct: 61  ANSNQAVLKTLAQLGAGMDVVSEGELRRARAAGVPASKIVFSGVGKTEAEQAYALQEDIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L++ A  +GK A ++ R+NPD++A TH KI+TGK E+KFGIP  +   
Sbjct: 121 CFNVESEPELRQLSRVASEMGKTARVSMRINPDVDAKTHAKIATGKAENKFGIPWQRARD 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+K++G+DMHIGSQI ++E F  AF  L DL   LRS GH I H+D+GGGL
Sbjct: 181 VYAEAAALPGIKVTGIDMHIGSQITELEPFDNAFARLGDLIADLRSQGHTIDHVDLGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y +D+ PP   D YA ++ ++   L C ++ EPGR +  + GILVT+VI +K  ADK
Sbjct: 241 GIPYITDNNPPPHPDAYAQVVKKHVRELDCMVMFEPGRMIAGNAGILVTEVIYVKDGADK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLY+AYHE+  +  PA +   I ADIVGP+CETGDF+A NR +  
Sbjct: 301 KFVIVDAAMNDLIRPTLYEAYHEVRPVREPAEETDRIKADIVGPVCETGDFLAQNRDMPS 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + G++L +   GAYGAVQS TYN+RLL+PE++VN  QF +IRPR ++++L+ LD IP W
Sbjct: 361 VKAGEMLAVYSAGAYGAVQSCTYNTRLLVPEVLVNADQFAVIRPRTSYEDLLGLDRIPDW 420

Query: 420 LQ 421
           L+
Sbjct: 421 LK 422


>gi|323135718|ref|ZP_08070801.1| diaminopimelate decarboxylase [Methylocystis sp. ATCC 49242]
 gi|322398809|gb|EFY01328.1| diaminopimelate decarboxylase [Methylocystis sp. ATCC 49242]
          Length = 421

 Score =  494 bits (1273), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 229/422 (54%), Positives = 308/422 (72%), Gaps = 3/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+LHAE+V++  +A  V TPFYCYS   I +++  F+ AFDG+D MVCYA+K
Sbjct: 1   MHHFDYRDGALHAEDVAVSAIADCVGTPFYCYSAATIRRHFRVFAQAFDGLDAMVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV++ LA  G+G+D+VS GEL RALAA  P  RI +SGVGKT +EI  AL + I+
Sbjct: 61  ANSNQAVLRLLAKEGAGMDVVSGGELARALAAGAPGGRITYSGVGKTEEEIAAALDADIF 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ +++ A  +GK A ++ RVNPD++A THKKISTGK E+KFG+P+     
Sbjct: 121 CFNVESEPELEAISRVATRMGKVARVSLRVNPDVDARTHKKISTGKAENKFGVPLSHARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+   GV I+G DMHIGSQ+  +E F +AF LL +L   LR++GH+I H+D+GGGL
Sbjct: 181 VYARAAKFRGVDITGADMHIGSQLTDLEPFDEAFSLLAELVVDLRADGHHISHVDLGGGL 240

Query: 241 GIAYHSDHRPPS--SSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           GI YH    P S     YA+++ ++F  L CK++LEPGR +V + G+LVT+VI +K    
Sbjct: 241 GIPYHEGDDPQSYHPERYAAIVRKHFAGLNCKLVLEPGRLIVGNAGVLVTRVIYVKHGEA 300

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           KTFVI+D  MND +RPTLYDA+H+I   V  A DR  I AD+VGP+CETGD++AL+RK+ 
Sbjct: 301 KTFVIVDAGMNDLVRPTLYDAHHDI-IPVRAAADREEITADVVGPVCETGDYLALDRKMP 359

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
             RPG+LL +   GAYGAVQ+GTYN+R LIPE++V+G +F +IRPR +  ELI +D +P 
Sbjct: 360 EARPGELLAVLTAGAYGAVQAGTYNTRPLIPEVLVDGERFAVIRPRPSVAELIAMDRVPD 419

Query: 419 WL 420
           WL
Sbjct: 420 WL 421


>gi|307943498|ref|ZP_07658842.1| diaminopimelate decarboxylase [Roseibium sp. TrichSKD4]
 gi|307773128|gb|EFO32345.1| diaminopimelate decarboxylase [Roseibium sp. TrichSKD4]
          Length = 424

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 232/424 (54%), Positives = 311/424 (73%), Gaps = 1/424 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y  G+L AE+VS+E +A  V TPFYCYST  + ++Y  FS+AF G+DT+VCYA+K
Sbjct: 1   MHHFQYKNGTLFAEDVSVEAIAEEVGTPFYCYSTATLTRHYEVFSSAFVGIDTLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV++TL+ LG+G+D+VSEGELRRA AA VPA+RI+FSGVGKT  E   AL   I 
Sbjct: 61  ANSNQAVLRTLSDLGAGMDVVSEGELRRARAAGVPADRILFSGVGKTEAEQAYALDEDIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL  L++ A  +GK A ++ R+NPD++A TH KISTGK E+KFGI   +   
Sbjct: 121 CFNVESEPELDQLSRVASQIGKTARVSLRINPDVDAKTHAKISTGKAENKFGISWRRARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A+ LPG+++SG+DMHIGSQI +++ F  AF  L +L   LRS+GH I HID+GGGL
Sbjct: 181 VYAHAAKLPGIQVSGIDMHIGSQITELQPFDDAFGRLGELIADLRSDGHAIDHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y +D+ PP   D YA ++ ++   L CKI+ EPGR +  + GILV+KVI +K+  DK
Sbjct: 241 GIPYVADNDPPPHPDAYAQVVKKHVDKLDCKIVFEPGRLIAGNAGILVSKVIYLKEGDDK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+I+D  MND +RPTLYDAYHE+  +  PA D   + AD+VGP+CETGD++A  R++  
Sbjct: 301 HFLIVDAGMNDLIRPTLYDAYHEVRPVREPADDTPRMTADVVGPVCETGDYLAQLRELPR 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + GDL+ +   GAYGAVQSGTYNSR LIPE++VN  +F +IRPR +  E+I +D IP W
Sbjct: 361 LQSGDLIAVYSAGAYGAVQSGTYNSRPLIPEVLVNKDEFAVIRPRPSLDEMIGIDRIPDW 420

Query: 420 LQKT 423
           L ++
Sbjct: 421 LTRS 424


>gi|17986368|ref|NP_539002.1| diaminopimelate decarboxylase [Brucella melitensis bv. 1 str. 16M]
 gi|17981958|gb|AAL51266.1| diaminopimelate decarboxylase [Brucella melitensis bv. 1 str. 16M]
          Length = 421

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 236/421 (56%), Positives = 317/421 (75%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y  G LHAENVSL ++A  V TPFY YS   IE+++  F +AF  MDT+V YALK
Sbjct: 1   MNHFEYRNGVLHAENVSLPEIAKAVGTPFYVYSRATIERHFRVFHDAFADMDTLVTYALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+  LA LG+G D VS+GE+RRALAA +PA RIVFSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLTALAKLGAGADTVSQGEIRRALAAGIPANRIVFSGVGKTPREMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+ GK AP++ R+NPD++A TH KISTGK E+KFGIP  +  +
Sbjct: 121 CFNVESEPELEILSARAVAAGKVAPVSLRINPDVDAKTHAKISTGKSENKFGIPRDKARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A++LPG+ + G+DMHIGSQI  +E F  AF L+ +L ++L+++GHNI+H+DVGGGL
Sbjct: 181 AYARAASLPGLNVVGIDMHIGSQIIDLEPFDNAFALMAELVKELQADGHNIRHVDVGGGL 240

Query: 241 GIAYHSDHRPPSSS-DYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y + + PP     YA ++ ++   L  K + EPGR +V + G+LVT+VI +K+   K
Sbjct: 241 GIPYRTPNTPPPPPVAYAQIVAKHIKPLGLKTVFEPGRLIVGNAGLLVTEVIFVKEGDAK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLYDA+H+I  ++ P  +   I AD VGP+CETGD++ L+R++A 
Sbjct: 301 NFVIVDAAMNDLIRPTLYDAFHDIRPVIMPNDNAPRIRADFVGPVCETGDYLGLDREVAK 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P PGDL+ I  TGAYGAV S TYNSRLLIPE++ +G ++H++RPR T++EL+ LDS+P W
Sbjct: 361 PAPGDLIAICTTGAYGAVLSSTYNSRLLIPEVLGDGERYHVVRPRRTYEELLALDSVPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|90420245|ref|ZP_01228153.1| diaminopimelate decarboxylase [Aurantimonas manganoxydans SI85-9A1]
 gi|90335579|gb|EAS49329.1| diaminopimelate decarboxylase [Aurantimonas manganoxydans SI85-9A1]
          Length = 424

 Score =  491 bits (1264), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 230/422 (54%), Positives = 315/422 (74%), Gaps = 4/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+  +G LHAE+VS+E +AH V TPFYCYST  + ++Y  F+ AF  +D +VCYA+K
Sbjct: 1   MNHFEIRDGVLHAEDVSVETIAHDVGTPFYCYSTATLTRHYTVFAEAFADIDALVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTLA LG+G D+VS GEL RAL A +PAE+I+FSGVGK++ EIDLAL SGI+
Sbjct: 61  ANSNQAVLKTLAALGAGADVVSGGELLRALRAGIPAEKIMFSGVGKSVPEIDLALASGIF 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ESE EL+ +  RAV+ G+ A ++FR+NPD++A TH KISTGKK DKFGI   +  +
Sbjct: 121 CFNIESEPELEMIAARAVAAGRTAHVSFRINPDVDARTHAKISTGKKSDKFGIAYERAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A +LPG+ +SG+DMHIGSQI ++E F +AF+ L  L ++LR  GH+I H+D+GGGL
Sbjct: 181 VYDRARSLPGIAVSGIDMHIGSQIVELEPFDQAFERLAGLVRRLRGAGHDIAHVDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y  ++  PP+   YA ++ ++  +L CK++ EPGR + A+ GILVT+V+ +K++  K
Sbjct: 241 GVPYSRTNTPPPAPPAYAEIVKRHVRDLDCKVVFEPGRLIAANAGILVTRVVYVKEAEGK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIV-NPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           TFVI+D  MND +RPTLYDA+H+I+ ++ +P   RL   AD+VGP+CE+GD+ A  R I 
Sbjct: 301 TFVIVDAGMNDLIRPTLYDAWHDIHPVIDDPDAPRL--VADVVGPVCESGDYFARARDIP 358

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
             + GDL+Y+   GAYGAVQSGTYNSR LI E++V G  FH IRPR T  E+I LD +P 
Sbjct: 359 AVKAGDLVYLSSAGAYGAVQSGTYNSRPLIAEVLVKGDAFHAIRPRQTIDEMIALDRLPP 418

Query: 419 WL 420
           WL
Sbjct: 419 WL 420


>gi|254501211|ref|ZP_05113362.1| diaminopimelate decarboxylase [Labrenzia alexandrii DFL-11]
 gi|222437282|gb|EEE43961.1| diaminopimelate decarboxylase [Labrenzia alexandrii DFL-11]
          Length = 424

 Score =  487 bits (1254), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 227/424 (53%), Positives = 306/424 (72%), Gaps = 1/424 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G+L AE+V++E++A  V TPFY YST  + ++Y  FS+AF  + ++VCYA+K
Sbjct: 1   MHHFDYKGGALFAEDVAIEEIAREVGTPFYVYSTATLTRHYEVFSSAFADIPSLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+ TLA LG+G+D+VSEGELRRA AA VPA +IVFSGVGKT  E   AL   I 
Sbjct: 61  ANSNQAVLATLAQLGAGMDVVSEGELRRARAAGVPANKIVFSGVGKTETEQAYALTEDIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL  L++ A  +GK A ++ R+NPD++A TH KI+TGK E+KFGIP  +   
Sbjct: 121 CFNVESEPELHQLSRVATKIGKTARVSMRINPDVDAKTHAKIATGKAENKFGIPWQRARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A++LPG+K++G+DMHIGSQI ++E F  AF  L +L   LR  GH I H+D+GGGL
Sbjct: 181 VYATAASLPGLKVTGIDMHIGSQITELEPFDSAFARLGELITDLRGQGHAIDHVDLGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y +D+ PP   D YA ++ ++   L CK++ EPGR +  + GILVT+VI +K+ ADK
Sbjct: 241 GIPYVTDNDPPPHPDAYAEVVKKHVRELDCKVMFEPGRMIAGNAGILVTQVIYVKEGADK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D  MND +RPTLY+AYHE+  +  P  +     AD+VGP+CETGDF+A NR +  
Sbjct: 301 NFVIVDAGMNDLIRPTLYEAYHEVRPVSEPDVNADRFTADVVGPVCETGDFLAQNRDMPK 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GD+L +   GAYG+VQS TYNSRLL+PE++VN  QF +IRPR +++EL++LD IP W
Sbjct: 361 VNAGDMLAVYSAGAYGSVQSSTYNSRLLVPEVLVNADQFAVIRPRPSYEELLDLDQIPDW 420

Query: 420 LQKT 423
           L+ +
Sbjct: 421 LKTS 424


>gi|254718034|ref|ZP_05179845.1| diaminopimelate decarboxylase [Brucella sp. 83/13]
 gi|265982981|ref|ZP_06095716.1| diaminopimelate decarboxylase [Brucella sp. 83/13]
 gi|306837594|ref|ZP_07470465.1| diaminopimelate decarboxylase [Brucella sp. NF 2653]
 gi|264661573|gb|EEZ31834.1| diaminopimelate decarboxylase [Brucella sp. 83/13]
 gi|306407301|gb|EFM63509.1| diaminopimelate decarboxylase [Brucella sp. NF 2653]
          Length = 421

 Score =  487 bits (1254), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 238/421 (56%), Positives = 318/421 (75%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y  G LHAENVSL ++A  V TPFY YS   IE+++  F +AF  MDT+V YALK
Sbjct: 1   MNHFEYRNGVLHAENVSLPEIAKAVGTPFYVYSRATIERHFRVFHDAFADMDTLVTYALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+  LA LG+G D VSEGE+RRALAA +PA RIVFSGVGKT  E+D AL++ IY
Sbjct: 61  ANSNQAVLAALAKLGAGADTVSEGEIRRALAAGIPANRIVFSGVGKTPREMDFALEARIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+ GK AP++ R+NPD++A TH KISTGK E+KFGIP  +  +
Sbjct: 121 CFNVESEPELEILSARAVAAGKVAPVSLRINPDVDAKTHAKISTGKSENKFGIPRDKARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A++LPG+ + G+DMHIGSQI  +E F  AF L+ +L ++L+++GHNI+H+DVGGGL
Sbjct: 181 AYARAASLPGLNVVGIDMHIGSQIIDLEPFDNAFALMAELVKELQADGHNIRHVDVGGGL 240

Query: 241 GIAYHSDHRPPSSS-DYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y +D+ PP     YA ++ ++   L  K + EPGR +V + G+LVT+VI +K+   K
Sbjct: 241 GIPYRTDNTPPPPPVAYAEIVAKHIKPLGLKTVFEPGRLIVGNAGLLVTEVIFVKEGDAK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLYDA+H+I  ++ P  +   I AD VGP+CETGD++ L+R++A 
Sbjct: 301 NFVIVDAAMNDLIRPTLYDAFHDIRPVIMPNDNAPRIRADFVGPVCETGDYLGLDREVAK 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P PGDL+ I  TGAYGAV S TYNSRLLIPE++V+G ++H++RPR T++EL+ LDS+P W
Sbjct: 361 PAPGDLIAICTTGAYGAVLSSTYNSRLLIPEVLVDGERYHVVRPRRTYEELLALDSVPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|304394204|ref|ZP_07376127.1| diaminopimelate decarboxylase [Ahrensia sp. R2A130]
 gi|303293644|gb|EFL88021.1| diaminopimelate decarboxylase [Ahrensia sp. R2A130]
          Length = 423

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 227/422 (53%), Positives = 310/422 (73%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y  G LHAE+VSL ++A  V TPFY YS+  + ++Y  F++AF  +D +VCYA+K
Sbjct: 1   MNHFDYRNGILHAEDVSLPRIAEEVGTPFYVYSSATLTRHYTVFADAFSELDALVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV++TLA LGSG D+VS GEL RA  A +PA +I+FSGVGKT+ E+DLAL   I 
Sbjct: 61  ANSNQAVLETLARLGSGADVVSGGELTRARRAGIPASKIMFSGVGKTVAEMDLALGEEIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ESE EL+ L+ RA ++GK A ++FR+NPD++A T +KISTGKK DKFGIP  +   
Sbjct: 121 CFNIESEPELEMLSARAAAMGKTAHVSFRINPDVDAKTIEKISTGKKTDKFGIPHEEASR 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+K++G+DMHIGSQI  +  F  AF  L DL   LR  GH+IQH+DVGGGL
Sbjct: 181 IYARAAELPGIKVTGIDMHIGSQITDLAPFDTAFGKLADLVGHLRGEGHDIQHVDVGGGL 240

Query: 241 GIAYH-SDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI YH  ++ PP+  DYA+++ ++   L  K+I EPGR +  + G+ VTKVI +K+   +
Sbjct: 241 GIPYHDDNNPPPNPDDYAAVVKKHVTGLDAKVIFEPGRLIAGNAGLFVTKVIYVKEGDAR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           +FVI+D AMND +RPTLY+AYHE+  +    G+     AD+VGP+CE+GD++A  R++  
Sbjct: 301 SFVIVDGAMNDLIRPTLYEAYHEVRSVDVNRGNGPRFTADVVGPVCESGDYLAKEREMQK 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           PRPGDL+ +   GAYGAVQ+GTYN+R L+PE+MV G Q+H+IRPR++  ELI+LDS+P W
Sbjct: 361 PRPGDLIALGSAGAYGAVQAGTYNTRALVPEVMVKGDQYHVIRPRLSLDELIDLDSVPDW 420

Query: 420 LQ 421
             
Sbjct: 421 FD 422


>gi|182677052|ref|YP_001831198.1| diaminopimelate decarboxylase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182632935|gb|ACB93709.1| diaminopimelate decarboxylase [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 423

 Score =  484 bits (1245), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 235/423 (55%), Positives = 306/423 (72%), Gaps = 2/423 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F    G +HAE+V LE+LA  + TPFYCYST  I ++Y  F  AF G D++VCYA+K
Sbjct: 1   MHHFALRNGVMHAEDVDLERLAETIGTPFYCYSTATITRHYEVFKAAFAGQDSLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV++TLA LG+G+D+VSEGELRRA AA VPA+R+ FSGVGKT  EI LAL  GI+
Sbjct: 61  ANSNQAVLQTLARLGAGMDVVSEGELRRARAAGVPADRVTFSGVGKTEREIALALDEGIF 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL  ++  AV+  K A IA RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 CFNVESEPELAAISALAVARNKTAHIALRVNPDVDAKTHAKIATGKSENKFGIPISRARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A  LPG+ I+GVD+HIGSQI  +  F  AF    +    LR++GH I H+D+GGGL
Sbjct: 181 VYRMAKNLPGIAITGVDLHIGSQITDLTPFDHAFARAAEFVALLRADGHAIDHVDLGGGL 240

Query: 241 GIAYHSDHRPPS--SSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           GI YHS   P +     YA +I +  G L  K++LEPGR +V + G+LVT+V+ +K+  +
Sbjct: 241 GIPYHSGDDPETYHPDLYAGIIKKRLGGLGLKLVLEPGRLIVGNAGVLVTRVLYVKQGEN 300

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           KTFVI+D AMND +RPTLY+A+HEI  +  P  D   + ADIVGP+CETGD++AL R++ 
Sbjct: 301 KTFVIVDAAMNDLVRPTLYEAHHEIAPLRPPLQDAPGVVADIVGPVCETGDYLALARRMP 360

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
            PRPGD L I   GAYGAVQ+ TYN+RLL+PE++V G+ + ++RPR T++ELI LD IPA
Sbjct: 361 EPRPGDYLAILSAGAYGAVQACTYNTRLLVPEVLVKGAAYAVVRPRGTYEELIGLDKIPA 420

Query: 419 WLQ 421
           WL+
Sbjct: 421 WLE 423


>gi|220921674|ref|YP_002496975.1| diaminopimelate decarboxylase [Methylobacterium nodulans ORS 2060]
 gi|219946280|gb|ACL56672.1| diaminopimelate decarboxylase [Methylobacterium nodulans ORS 2060]
          Length = 430

 Score =  483 bits (1243), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 228/422 (54%), Positives = 306/422 (72%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G+LHAE V L +LA  + TPFYCY++  +E++Y  F+ AF G D +VCYA+K
Sbjct: 1   MHHFTYRNGTLHAEEVDLAQLAGEIGTPFYCYASATLERHYRVFAEAFAGDDPLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+ TLA LG+G+DIVSEGELRRALAA VPAERIVFSGV KT  E++ ALQ+GI 
Sbjct: 61  ANSNQAVLATLARLGAGMDIVSEGELRRALAAGVPAERIVFSGVAKTKAEMEAALQAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL  L++ A  LG+ AP++ RVNPD++A TH KISTGK E+KFGIPI +   
Sbjct: 121 CFNVESEPELAALSEVAQGLGRDAPVSIRVNPDVDARTHAKISTGKSENKFGIPISRARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+TLPG++++GVDMHIGSQI  +  F  A  LL +L + L + GH + HID GGGL
Sbjct: 181 VYARAATLPGLRLAGVDMHIGSQITDLAPFDNAAALLAELARDLMAAGHRLHHIDFGGGL 240

Query: 241 GIAYHSDHR-PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+  PP  S +A+++  +F  L  + + E GR +  + GILVT+V+ +K+   +
Sbjct: 241 GIPYRDDNAPPPDPSAFAAVLRPHFRPLGLRPVFEIGRMIAGNAGILVTRVVYVKQGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+AYH I  +  P      + AD+VGP+CE+GD++AL R++  
Sbjct: 301 TFVIVDAAMNDLIRPTLYEAYHAIRPVAQPDPHAPRLTADVVGPVCESGDYLALGREMPA 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
             PGDL+ +   GAYGAVQ+GTYN+R L+PE++V G+   ++RPR T++ELI LD +P W
Sbjct: 361 VAPGDLIAVMTAGAYGAVQAGTYNTRRLVPEVLVRGADHAVVRPRQTYEELIGLDRVPDW 420

Query: 420 LQ 421
           L+
Sbjct: 421 LE 422


>gi|163851214|ref|YP_001639257.1| diaminopimelate decarboxylase [Methylobacterium extorquens PA1]
 gi|163662819|gb|ABY30186.1| diaminopimelate decarboxylase [Methylobacterium extorquens PA1]
          Length = 422

 Score =  481 bits (1237), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 225/421 (53%), Positives = 306/421 (72%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE+V L  LA  V TPFYCYST  +E++Y  F+ AF G D +VC+A+K
Sbjct: 1   MHHFHYRDGRLHAEDVDLTALAEEVGTPFYCYSTATLERHYRVFAEAFAGDDALVCFAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+ TLAH G+G+DIVSEGELRRALAA VP ERIVFSGVGKT +E+  AL + I 
Sbjct: 61  ANSNQAVLATLAHQGAGMDIVSEGELRRALAAGVPGERIVFSGVGKTREEMAAALDANIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL  L++ AV+ G+KAP++ RVNPD++A TH KISTGK ++KFGIPI +  +
Sbjct: 121 CFNVESEPELAALSEVAVARGRKAPVSIRVNPDVDALTHAKISTGKSDNKFGIPISRARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG++I GVD HIGSQI  +  F  A +LL +L + L ++GH + H+D GGGL
Sbjct: 181 VYAGAARLPGLEIVGVDAHIGSQITDLTPFDNAARLLCELARDLLADGHRLHHVDFGGGL 240

Query: 241 GIAYHSDHR-PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+  PP  +  A+++  +F  L  + + E GR +  + GILVT+VI +K + +K
Sbjct: 241 GIPYRDDNAPPPDPTALAAILRPHFKPLGLRPVFEIGRMIAGNAGILVTRVIYVKPTDEK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+A+H +  +  PA D   + AD+VGP+CE+GD++AL R++ +
Sbjct: 301 TFVIVDGAMNDLIRPTLYEAFHALRPVREPAPDTPRLTADVVGPVCESGDYLALGREMPM 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
             PGDL+ +   GAYGAVQ+ TYNSR L+PE++V G +  ++RPR ++ +LI LD +P W
Sbjct: 361 VAPGDLIAVMSAGAYGAVQACTYNSRRLVPEVLVTGDRSAVVRPRPSYDDLIRLDRLPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|154245684|ref|YP_001416642.1| diaminopimelate decarboxylase [Xanthobacter autotrophicus Py2]
 gi|154159769|gb|ABS66985.1| diaminopimelate decarboxylase [Xanthobacter autotrophicus Py2]
          Length = 422

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/421 (54%), Positives = 298/421 (70%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G L AE+V +  LA  V+TPFYCYS+  +E++Y  F  AF G D ++CYALK
Sbjct: 1   MHHFDYRNGRLFAEDVDITPLAAEVRTPFYCYSSATLERHYQVFMEAFSGRDVLLCYALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQ+VI TLA LG+G DIVS GEL RA AA VPAERIVFSGVGKT +E+  AL  GI 
Sbjct: 61  ANSNQSVIATLARLGAGADIVSAGELARARAAGVPAERIVFSGVGKTREEMAAALDGGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL  L++ A ++G  AP++ RVNPD++A THKKISTGK   KFGIPI +   
Sbjct: 121 CFNVESEPELAALSEVATAMGVSAPVSIRVNPDVDAKTHKKISTGKSATKFGIPISRARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y YA+ LPG+ I+GVDMHIGSQI  +  F  A  LL +L + L + GH + H+D+GGGL
Sbjct: 181 VYDYAARLPGLAITGVDMHIGSQITDMAPFDNAVTLLAELARDLLAAGHRLHHMDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y  SD  PP  S YA ++ +  G+L+  ++ E GR LVA+ GILVT+VI +K+   K
Sbjct: 241 GVPYAASDPVPPPPSAYAEVVSRALGDLKLPLVFEMGRMLVANAGILVTRVIYVKEGEGK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFV++D AMND +RPTLY+A+H+I  +V PA D   + AD+VGP+CETGDF+AL+R +  
Sbjct: 301 TFVVVDAAMNDLIRPTLYEAHHDIIPVVEPAADAPLVVADVVGPVCETGDFLALDRPLPR 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + GDLL +   GAYGAVQ+ TYN+R L+PE++V G+   ++RPR+   +LI LD    W
Sbjct: 361 LKAGDLLAVMTAGAYGAVQASTYNTRPLVPEVLVRGAAAAVVRPRLEVADLIALDRPAPW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|163869282|ref|YP_001610538.1| hypothetical protein Btr_2591 [Bartonella tribocorum CIP 105476]
 gi|161018985|emb|CAK02543.1| Diaminopimelate decarboxylase [Bartonella tribocorum CIP 105476]
          Length = 424

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 226/424 (53%), Positives = 303/424 (71%), Gaps = 1/424 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y +G LHAE  SL  LA  V TPFYCYS  A+   +  +  AF GM T++ YA+K
Sbjct: 1   MNFFPYHQGMLHAEGCSLTDLAQEVGTPFYCYSANALVTRFKDYQKAFQGMPTLIAYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQA+++ LA  G+G D+VSEGELRRALA  +PA RIV+SGVGKT+ EID AL   IY
Sbjct: 61  ANSNQAILRLLAANGAGADVVSEGELRRALAVGIPAHRIVYSGVGKTVREIDFALSQNIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+QRAV+L K A ++ R+NPD++A THKKI+TGK E+KFGIP+     
Sbjct: 121 CFNVESEPELEQLSQRAVALSKTARVSLRINPDVDAKTHKKITTGKSENKFGIPLFLARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A++LPG+++ G+DMHIGSQI  ++ F +AF L+ D  +QL S+G  I HID+GGGL
Sbjct: 181 AYKKAASLPGLQVCGIDMHIGSQICDLKPFEEAFLLIADCVRQLWSDGCAITHIDIGGGL 240

Query: 241 GIAYHSD-HRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GIAY  + H  PS  DYA+L+ ++   L   I++EPGR +V   G+LVT V+ +KK   +
Sbjct: 241 GIAYGCEQHTLPSPFDYAALVKKHIAPLGIDIVVEPGRSIVGQAGVLVTSVLYLKKGQGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND MRPTLYDA+  +  +   A D   I ADIVG +CETGD++AL+R + +
Sbjct: 301 NFVIVDAAMNDLMRPTLYDAWQNVVLVKQAAKDAPLIRADIVGSVCETGDYLALDRCLPI 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
             PGDLL I + GAYGAV + TYNSRLLIPE++V  +++ +IRPR+ + +L+E D IP W
Sbjct: 361 LAPGDLLAITQAGAYGAVMASTYNSRLLIPEVLVQDTRYAVIRPRLDYAQLMECDHIPDW 420

Query: 420 LQKT 423
           ++ +
Sbjct: 421 VEHS 424


>gi|115526828|ref|YP_783739.1| diaminopimelate decarboxylase [Rhodopseudomonas palustris BisA53]
 gi|115520775|gb|ABJ08759.1| diaminopimelate decarboxylase [Rhodopseudomonas palustris BisA53]
          Length = 421

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 224/421 (53%), Positives = 300/421 (71%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G LHAE V+L  LA  V TPFYCYST  +E++Y  F+ AF   D +VCYA+K
Sbjct: 1   MHHFDYNAGVLHAEAVNLAVLAEAVGTPFYCYSTATLERHYRVFTEAFADTDALVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQ+V++TLA LG+G D+VS GE+ RALAA +P  +IVFSGVGKT+DE+  AL   I 
Sbjct: 61  ANSNQSVLRTLAKLGAGADVVSGGEMARALAAGIPPSKIVFSGVGKTVDELRAALDHDIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           C NVESE EL+ L+  A+S+GK A I+ RVNPD+++ TH KISTGK E+KFGIP+ +   
Sbjct: 121 CINVESEPELEMLSALAMSMGKTATISIRVNPDVDSGTHAKISTGKSENKFGIPLVKARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG++++GVD+HIGSQI  +     AF+LL D    LR +GH I H+D GGGL
Sbjct: 181 VYARAAALPGLRVTGVDVHIGSQITDLGPMEAAFRLLADFVTVLRGDGHTISHVDFGGGL 240

Query: 241 GIAYHSD-HRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y+ D   PP    YA+++ +   NL C+++ EPGR +V + GILV +VI +K    K
Sbjct: 241 GIPYYEDPTTPPEPLAYAAMVKRITHNLGCRLMFEPGRMIVGNAGILVARVIHVKHGDGK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+AYH+I  I  PA     I AD+VGP+CETGD++AL+R++  
Sbjct: 301 TFVIIDAAMNDLIRPTLYEAYHDILPIKAPAPGAGEITADVVGPVCETGDYLALSRRLPA 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + GDL+ I   GAYGAVQ+ TYN+R L+PE++V G Q+ +IRPR++ ++LI LD+   W
Sbjct: 361 LKSGDLIAIMTAGAYGAVQACTYNTRPLVPEVLVKGDQYAVIRPRLSVEQLIALDTPAPW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|296445377|ref|ZP_06887335.1| diaminopimelate decarboxylase [Methylosinus trichosporium OB3b]
 gi|296257138|gb|EFH04207.1| diaminopimelate decarboxylase [Methylosinus trichosporium OB3b]
          Length = 422

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/422 (54%), Positives = 303/422 (71%), Gaps = 2/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G LHAE+V+L K+A  V  PFYCYS   I +++  FS AF G+D +VCYA+K
Sbjct: 1   MHHFDYRAGVLHAEDVALPKIAEDVGAPFYCYSAATIRRHFTVFSAAFAGLDALVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+  LA LG+G+D+VS GELRRA AA VPA +I FSGVGKT  EI LA+  GI+
Sbjct: 61  ANSNQAVLALLAGLGAGMDVVSGGELRRARAAGVPASKITFSGVGKTAQEIALAIDEGIF 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ +   A + G++A I+ RVNPD++A TH KISTG  E+KFG+P+ +   
Sbjct: 121 CFNVESEPELEAIAAIAAAKGRRAHISLRVNPDVDAKTHAKISTGLAENKFGVPLSRARD 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+ I GVDMHIGSQI  +  F  AF LL +L   LR++GH I H+D+GGGL
Sbjct: 181 IYAQAARLPGLDIVGVDMHIGSQITDLRPFDAAFSLLAELVVGLRADGHAISHVDLGGGL 240

Query: 241 GIAYHSDHRPPS--SSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           GI YH+   P S     YA ++ ++ G L CK++ EPGR +V + G+LVT+V+ +K+   
Sbjct: 241 GIPYHAGEDPASYHPDRYAEIVRRHMGALGCKLLFEPGRLIVGNAGVLVTRVLYVKQGEA 300

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           KTFVI+D  MND +RPTLYDA+HEI  +  PA  R  I AD+VGP+CETGD+IAL R I 
Sbjct: 301 KTFVIVDAGMNDLVRPTLYDAWHEIIPVTEPARGRNEILADVVGPVCETGDYIALGRSIP 360

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
            P  GDLL +  +GAYGAVQ+GTYNSR LIPE++V+G+++ ++R R + + LI LDS+P 
Sbjct: 361 APAQGDLLAVLTSGAYGAVQAGTYNSRPLIPEVLVDGARWAVVRARPSIESLIALDSVPD 420

Query: 419 WL 420
           WL
Sbjct: 421 WL 422


>gi|75674910|ref|YP_317331.1| diaminopimelate decarboxylase [Nitrobacter winogradskyi Nb-255]
 gi|74419780|gb|ABA03979.1| diaminopimelate decarboxylase [Nitrobacter winogradskyi Nb-255]
          Length = 421

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 219/421 (52%), Positives = 297/421 (70%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE+V L  LA  V TPFYCYST  +E++Y  F+ AF G D ++CYA+K
Sbjct: 1   MHHFDYRDGVLHAEDVDLSTLAEAVGTPFYCYSTATLERHYRVFAEAFAGTDHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQ+V++T+A LG+G D+VS GEL+RALAA +PA +I+FSGVGKT  E+  AL + + 
Sbjct: 61  ANSNQSVLRTMARLGAGADVVSGGELKRALAANIPASKILFSGVGKTESELRAALAADVL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           C NVESE EL  L++ AV  G+ A I+ RVNPD+++ TH KISTG+ E+KFGIPI Q  +
Sbjct: 121 CINVESEPELDLLSRVAVETGRTARISVRVNPDVDSGTHAKISTGRLENKFGIPITQARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+K++G DMHIGSQI  +     AF+LL D    LR++GH I H+D GGGL
Sbjct: 181 VYARAAKLPGIKVTGADMHIGSQITDLGPMETAFRLLADFVGTLRADGHVISHVDFGGGL 240

Query: 241 GIAYHSDHR-PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y+ D   PP    YA ++ +   +L C ++ EPGR +V + G+LVT+VI +K    +
Sbjct: 241 GIPYYEDRSAPPEPLAYAEMVRRVTRDLDCTLMFEPGRMIVGNAGVLVTRVIYVKHGNAR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLY+AYH+I  +     D   + AD+VGP+CETGD++AL R +  
Sbjct: 301 NFVIIDAAMNDLIRPTLYEAYHQIMPVRAAPRDAAVMVADVVGPVCETGDYLALGRNLPE 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P+ GDLL I   GAYGAVQSGTYN+R L+PE++V G+Q+  +RPR+   +LI +D +  W
Sbjct: 361 PQAGDLLAIMTAGAYGAVQSGTYNTRALVPEVLVRGNQYATVRPRIEVDQLIAMDKLAPW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|300021574|ref|YP_003754185.1| diaminopimelate decarboxylase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299523395|gb|ADJ21864.1| diaminopimelate decarboxylase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 423

 Score =  474 bits (1221), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 221/421 (52%), Positives = 300/421 (71%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G LHAE+VSL ++A  V TPFY YST  +E++Y   + AF     ++C+A+K
Sbjct: 1   MHHFHYKNGILHAEDVSLARIADEVGTPFYVYSTATLERHYKVLAEAFRDQKALICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+ T+A LG+G+D+VSEGELRRA AA VPA +I+F+GVGKT  E+  AL+ GI 
Sbjct: 61  ANSNQAVLATMARLGAGMDVVSEGELRRARAAGVPASKIIFAGVGKTRGEMAYALEEGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE EL  L++ A +LGK A IA RVNPD++A TH KISTGK E+KFG+P      
Sbjct: 121 GFNVESEPELLALSEVATALGKTASIAIRVNPDVDAKTHAKISTGKAENKFGVPFEDARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LYA A+TLPG+KISG+ MHIGSQI  +  F  AF LL DL + L ++G  ++H+D+GGGL
Sbjct: 181 LYARAATLPGLKISGIHMHIGSQITDLAPFRDAFALLHDLARDLIADGIRLEHLDIGGGL 240

Query: 241 GIAYH-SDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y  ++  PP+  +YA+++    G+L  KI+LEPGR +V + G+LVT+V  +K+  DK
Sbjct: 241 GVPYRGANDIPPTPDEYAAVVKAALGDLGLKIVLEPGRMIVGNAGLLVTRVTYVKEGEDK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TF I+D AMND +RPTLY+AYHEI  +     D   +  DIVGP+CETGDF+A +R +  
Sbjct: 301 TFTIVDAAMNDLIRPTLYEAYHEIWPVAEQRNDMAPVQQDIVGPVCETGDFLAEDRALPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
             PGDLL +   GAYGAV S TYN+RLL+PE++V+G ++ ++RPR ++ +LI  D +P W
Sbjct: 361 SEPGDLLAVMTAGAYGAVMSSTYNTRLLVPEVLVSGDRYAVVRPRPSYDDLIGADKLPPW 420

Query: 420 L 420
           +
Sbjct: 421 I 421


>gi|92118935|ref|YP_578664.1| diaminopimelate decarboxylase [Nitrobacter hamburgensis X14]
 gi|91801829|gb|ABE64204.1| diaminopimelate decarboxylase [Nitrobacter hamburgensis X14]
          Length = 421

 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 221/421 (52%), Positives = 299/421 (71%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE+V+L  LA VV TPFYCYST  +E++Y  F++AF G+D +VCYA+K
Sbjct: 1   MRHFDYRDGVLHAESVNLSALAEVVGTPFYCYSTATLERHYRVFADAFAGVDHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQ+V++TLA LG+G D+VS GEL+RALAA +PA +I+FSGVGKT  E+  AL   + 
Sbjct: 61  ANSNQSVLRTLAKLGAGADVVSGGELKRALAAGIPASKILFSGVGKTDAELRAALAVDVL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           C NVESE EL  L++ A   G+ A I+ RVNPD+++ TH KISTG+ E+KFGIPI +  +
Sbjct: 121 CINVESEPELDLLSKLASEAGRTARISIRVNPDVDSGTHAKISTGRSENKFGIPIARARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A+ LPG+ ++GVDMHIGSQI  +     AF+LL D    LR++GH I H+D GGGL
Sbjct: 181 VYAHAAKLPGIAVTGVDMHIGSQITDLGPMEAAFRLLADFVTTLRADGHTISHVDFGGGL 240

Query: 241 GIAYHSDH-RPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y+ D   PP    YA ++ +   NL C ++ EPGR +V + GILVT+VI +K    +
Sbjct: 241 GIPYYEDRAAPPEPLAYAEMVRRVTHNLGCTLMFEPGRMIVGNAGILVTRVIYVKHGDAR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+I+D AMND +RPTLY+AYH+I  +     D   + AD+VGP+CETGD++AL R +  
Sbjct: 301 NFIIIDAAMNDLIRPTLYEAYHQIIPVRAAPKDAPVMVADVVGPVCETGDYLALGRNLPE 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P+ GDLL I   GAYGAVQSGTYN+R LIPE++V   Q+ ++RPR+  ++LI +D    W
Sbjct: 361 PQAGDLLAIMTAGAYGAVQSGTYNTRALIPEVLVKDDQYAVVRPRIEVEQLIAMDMSAPW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|49476269|ref|YP_034310.1| diaminopimelate decarboxylase [Bartonella henselae str. Houston-1]
 gi|49239077|emb|CAF28380.1| Diaminopimelate decarboxylase [Bartonella henselae str. Houston-1]
          Length = 421

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 223/421 (52%), Positives = 304/421 (72%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE +SL  LA  V TPFYCYS +A+  N+  + NAF  M +++ YA+K
Sbjct: 1   MRFFSYNQGVLHAEGLSLSALAQDVGTPFYCYSASAVVTNFKDYQNAFLDMPSLIAYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV++ LA  G+G D+VSEGELRRALAA +PA RIV+SGVGKT+ EID AL   IY
Sbjct: 61  ANSNQAVLRLLAANGAGADVVSEGELRRALAAGIPAHRIVYSGVGKTVKEIDFALAHDIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+  AV+L K A ++ R+NPD++A TH+KI+TGK E+KFGIP+     
Sbjct: 121 CFNVESEPELEQLSVCAVALSKTARVSLRINPDVDARTHRKITTGKSENKFGIPLSLAWD 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LPG+++ GVDMHIGSQI  ++ F  AF ++ D  +QLRS+G+ + HID+GGGL
Sbjct: 181 VYKKAAQLPGIQVCGVDMHIGSQICDLKPFEDAFLIVADFVRQLRSHGYALTHIDIGGGL 240

Query: 241 GIAYHSDHRP-PSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y ++H   PS SDYA+L+ ++   L   IILEPGR +V D G+LVT V+ +K+   +
Sbjct: 241 GIDYGNEHHSVPSLSDYAALVRKHIAPLGIHIILEPGRSIVGDAGVLVTSVLYLKRGNGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND MRPTLYDA+  +  +   + D L + ADIVG +CETGD++AL+R++  
Sbjct: 301 NFVIVDAAMNDLMRPTLYDAWQNVLLVEQASKDALLMKADIVGAVCETGDYLALDRRVPT 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDLL I + GAYGAV + TYNSRLL+PE++V  +++ +IRPR+ + +LI  D +P W
Sbjct: 361 LATGDLLAIMEAGAYGAVMASTYNSRLLVPEVLVQDTRYAVIRPRLDYAQLIGCDYVPDW 420

Query: 420 L 420
           +
Sbjct: 421 I 421


>gi|319407825|emb|CBI81478.1| Diaminopimelate decarboxylase [Bartonella sp. 1-1C]
          Length = 423

 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 225/422 (53%), Positives = 300/422 (71%), Gaps = 2/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y++G LHAEN+SL  LA  V TPFYCYS   +  N+  +  AF  M +++ YA+K
Sbjct: 1   MHFFSYYQGELHAENLSLSILAQKVGTPFYCYSARTLITNFENYQQAFQDMPSLIAYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQA+++ LA  G+G D+VSEGELRRALAA +PA RI++SGVGKT+ EID AL   I+
Sbjct: 61  ANSNQAILRLLARSGAGADVVSEGELRRALAAGIPAHRIIYSGVGKTVKEIDFALTQNIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RA +L   API+ R+NPD++A THKKI+TGK E+KFGIP+     
Sbjct: 121 CFNVESEPELEQLSARAAALSTTAPISLRINPDVDAKTHKKITTGKSENKFGIPLSSARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LP + I GVD+HIGSQI  ++ F  AF +  D  +QL ++G+ I H+D+GGGL
Sbjct: 181 VYKKAAQLPSLYICGVDIHIGSQICDLKPFEDAFLITADFVRQLWNDGYTITHVDIGGGL 240

Query: 241 GIAYHSDHRP-PSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y S+H   PS  DYA+L+ ++   L   IILEPGR +V + GILVT VI +K+  ++
Sbjct: 241 GIPYGSEHHSVPSPFDYAALVRKHIAPLGINIILEPGRSIVGEAGILVTSVIHLKRGKER 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMNDF+RPTLY+A+  +  +V    D   I+ADIVGP+CETGD++ LNR + L
Sbjct: 301 NFVIVDAAMNDFIRPTLYEAWQNV-LLVKEKIDTPLINADIVGPVCETGDYLGLNRSLPL 359

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDLL +   GAYGAV S TYNSRLLIPE++V   ++ IIRPR+ + +LI LD IP W
Sbjct: 360 LSKGDLLVVTGAGAYGAVMSNTYNSRLLIPEVLVQDMRYAIIRPRLDYAQLIGLDQIPDW 419

Query: 420 LQ 421
           ++
Sbjct: 420 IE 421


>gi|86747955|ref|YP_484451.1| diaminopimelate decarboxylase [Rhodopseudomonas palustris HaA2]
 gi|86570983|gb|ABD05540.1| diaminopimelate decarboxylase [Rhodopseudomonas palustris HaA2]
          Length = 421

 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 226/421 (53%), Positives = 295/421 (70%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE V LE LA  V TPFYCYST  +E++Y  FS AF G D +VCYA+K
Sbjct: 1   MRHFDYRDGVLHAEGVGLEVLAREVGTPFYCYSTATLERHYRVFSEAFAGTDALVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQ+V++TLA LG+G D+VS GEL+RALAA +PA +IVFSGVGKT  E+  AL   I 
Sbjct: 61  ANSNQSVLRTLARLGAGADVVSGGELQRALAAGIPASKIVFSGVGKTEAELRAALAHDIK 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           C NVESE EL+ L++ AV  G+ A I+ RVNPD+++ TH KISTGK E+KFGIP+     
Sbjct: 121 CLNVESEPELELLSRLAVETGRTARISIRVNPDVDSGTHAKISTGKSENKFGIPLVHARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+ ISGVD+HIGSQI  +     AF+L+ +   QLR +GH I H+D GGGL
Sbjct: 181 VYARAAKLPGILISGVDVHIGSQIIDLAPMEAAFRLVAEFVHQLRGDGHTISHVDFGGGL 240

Query: 241 GIAYHSDH-RPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y+ D   PP    YA ++ +   NL C ++ EPGR +V + GILV +VI +K    K
Sbjct: 241 GIPYYEDRDAPPEPFAYAQMVKRVTHNLGCALLFEPGRMIVGNAGILVARVIYVKHGDGK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+AYHEI  +  PA     I AD+VGP+CETGD++AL+R++  
Sbjct: 301 TFVIIDAAMNDLIRPTLYEAYHEILPVAAPAPGAKLITADVVGPVCETGDYLALDRQLPE 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + GDL+ I   GAYGAVQ+ TYN+R L+PE++V   Q+ ++RPR+  ++LI LD    W
Sbjct: 361 LKSGDLIAIMTAGAYGAVQACTYNTRALVPEVLVKDDQYAVVRPRIEVEQLIALDRPAPW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|240851353|ref|YP_002972756.1| diaminopimelate decarboxylase [Bartonella grahamii as4aup]
 gi|240268476|gb|ACS52064.1| diaminopimelate decarboxylase [Bartonella grahamii as4aup]
          Length = 424

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 222/424 (52%), Positives = 301/424 (70%), Gaps = 1/424 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE  SL  LA  V TPFYCYS  A+   +  +  AF GM +++ YA+K
Sbjct: 1   MDFFSYHQGMLHAEGCSLAVLAQEVGTPFYCYSANALVTRFKDYKKAFQGMPSLLAYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV++ LA+ G+G D+VSEGELRRALA  +PA RIV+SGVGKT+ EID AL   IY
Sbjct: 61  ANSNQAVLRLLANNGAGADVVSEGELRRALAVGIPAHRIVYSGVGKTMREIDFALAQDIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+QRAV+L K A ++ R+NPD++A THKKI+TGK E+KFGIP+     
Sbjct: 121 CFNVESEPELEQLSQRAVALSKIARVSLRINPDVDAKTHKKITTGKSENKFGIPLLLARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A +LPG+++ G+DMHIGSQI  ++ F +AF L+ D  +QL S+G+ I HID+GGGL
Sbjct: 181 AYKKADSLPGLQVCGIDMHIGSQICDLKPFEEAFFLIADCVRQLWSDGYAITHIDIGGGL 240

Query: 241 GIAYHSD-HRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GIAY  + H  PS  DYA+L+ +Y   L   I++EPGR +V   G+L+T V+ +K+   +
Sbjct: 241 GIAYGCEQHTVPSPFDYAALVKKYIAPLGINIVVEPGRSIVGQAGVLMTSVLYLKRGQGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND MRPTLYDA+  +  +   A D   I ADIVG +CETGD++AL+R + +
Sbjct: 301 NFVIVDAAMNDLMRPTLYDAWQNVVLVKKAAKDAPLIRADIVGSVCETGDYLALDRCLPI 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
             PGDLL I + GAYGAV + TYNSRLL+PE++V  + + ++RPR+ + +L+  D IP W
Sbjct: 361 LAPGDLLAITQAGAYGAVMASTYNSRLLVPEVLVQDTCYAVVRPRLDYAQLMGCDHIPDW 420

Query: 420 LQKT 423
           ++ +
Sbjct: 421 VENS 424


>gi|319406349|emb|CBI79988.1| Diaminopimelate decarboxylase [Bartonella sp. AR 15-3]
          Length = 424

 Score =  471 bits (1212), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 223/423 (52%), Positives = 299/423 (70%), Gaps = 1/423 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y++G LHAE++SL  LA  V TPFYCYS   +  N+  +  AF  M  ++ YA+K
Sbjct: 1   MHFFSYYQGELHAEDLSLSMLAQEVGTPFYCYSARTLITNFENYQQAFQNMPYLIAYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQA+++ LA  G+G D+VSEGELRRALAA +P  RIV+SGVGKT+ EID AL   I+
Sbjct: 61  ANSNQAILRLLAQSGAGADVVSEGELRRALAAGIPTHRIVYSGVGKTVKEIDFALTQNIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+L   A I+ R+NPD++A THKKI+TGK E+KFGIP+     
Sbjct: 121 CFNVESEPELEQLSARAVALSTTARISLRINPDVDAKTHKKITTGKSENKFGIPLSSARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LPG+ + GVD+HIGSQI  +  F  AF +  D  +QL ++G+ I H+D+GGGL
Sbjct: 181 VYKKAAQLPGLYVCGVDIHIGSQICDLTPFEDAFLITADFVRQLWNDGYAITHVDIGGGL 240

Query: 241 GIAYHSDHRP-PSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI+Y S+H   PS  DYA+L+ ++   L   IILEPGR +V + GILVT VI +K+  ++
Sbjct: 241 GISYGSEHYSVPSPFDYAALVRKHIAPLGINIILEPGRSIVGEAGILVTSVIHLKRGKER 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMNDF+RPTLY+A+  +  +     D L I+ADIVGP+CETGD++ LNR + +
Sbjct: 301 NFVIVDAAMNDFIRPTLYEAWQNVLLVKEKPIDTLLINADIVGPVCETGDYLGLNRSLPI 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDLL I   GAYGAV S TYNSRLLIPE++V  + + +IRPR+ + +LI LD IP W
Sbjct: 361 LSTGDLLVITGAGAYGAVMSNTYNSRLLIPEVLVQDAHYAVIRPRLDYGQLIGLDQIPNW 420

Query: 420 LQK 422
           ++ 
Sbjct: 421 IEN 423


>gi|114706749|ref|ZP_01439649.1| diaminopimelate decarboxylase protein [Fulvimarina pelagi HTCC2506]
 gi|114537697|gb|EAU40821.1| diaminopimelate decarboxylase protein [Fulvimarina pelagi HTCC2506]
          Length = 422

 Score =  471 bits (1212), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 227/422 (53%), Positives = 304/422 (72%), Gaps = 2/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F++ +G LHAE+V +  +A  + TPFYCYST  + ++Y  FS+AF  +D MVCYA+K
Sbjct: 1   MNHFEFKDGLLHAEDVPVTTIAKDIGTPFYCYSTATLLRHYDVFSSAFADIDAMVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTLA  G+G D+VS GEL RAL   +  ++I+FSGVGKTI EID+A+ SGI+
Sbjct: 61  ANSNQAVLKTLADRGAGADVVSGGELLRALRVGIDPKKIMFSGVGKTIAEIDMAIASGIF 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ESE+EL+ ++ RAV  G  A ++FR+NPD++A TH KISTG+K DKFGI   +  S
Sbjct: 121 CFNIESENELELISARAVDAGLTAHVSFRINPDVDAKTHAKISTGRKSDKFGIAYDRAES 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A  LPGV+++G+DMHIGSQI  ++ F +AF  L  L  +LR+ GH I HID+GGGL
Sbjct: 181 IYARARELPGVEVTGIDMHIGSQIIDLKPFDEAFDRLATLVHRLRAAGHEISHIDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y ++D  PP    YA ++ ++  +L  KI+ EPGR +VA+ GILV +V+ +KK   K
Sbjct: 241 GVPYKNADATPPEPHAYAEIVKRHVRDLGAKIVFEPGRMIVANAGILVARVLYVKKDEGK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+A+HEI   V  A +R  I ADIVGPICE+GDF+  +R+I  
Sbjct: 301 TFVIVDAAMNDLIRPTLYEAWHEIQP-VERAANRKTITADIVGPICESGDFLGKDREIVE 359

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+++   GAYGAVQS TYNSR LI E +V G ++ +IR R T  ELI LD IP W
Sbjct: 360 VAEGDLVFLSSAGAYGAVQSSTYNSRPLIAETLVKGGEYAVIRERQTIDELIGLDHIPEW 419

Query: 420 LQ 421
           L 
Sbjct: 420 LD 421


>gi|27376494|ref|NP_768023.1| diaminopimelate decarboxylase [Bradyrhizobium japonicum USDA 110]
 gi|27349634|dbj|BAC46648.1| diaminopimelate decarboxylase [Bradyrhizobium japonicum USDA 110]
          Length = 421

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/421 (52%), Positives = 304/421 (72%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y  G LHAE V+L +LA  V TPFYCYST  +E++Y  F++AF G   +VCYA+K
Sbjct: 1   MNHFDYRNGVLHAEAVNLSELAATVGTPFYCYSTATLERHYRVFADAFAGEKVLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQ+V++TLA LG+G D+VS GEL+RALAA +PA +I+FSGVGKT DE+  AL + I 
Sbjct: 61  ANSNQSVLRTLARLGAGADVVSGGELKRALAAGIPARKILFSGVGKTEDELRAALAADIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           C NVESE EL+ L++ A  +GK A I+ RVNPD++A TH KISTGK E+KFGIPI     
Sbjct: 121 CLNVESEPELELLSRLATEMGKTARISVRVNPDVDAGTHAKISTGKSENKFGIPIAHARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG++++G D+HIGSQI  +     AF++L +  Q LR++GH+I H+D GGGL
Sbjct: 181 VYARAAKLPGIQVTGTDVHIGSQITDLSKMETAFRILSEFVQTLRADGHDISHVDFGGGL 240

Query: 241 GIAYHSDHR-PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y+ D   PP+   YA+++ +   NL C ++ EPGR +V + GILV KVI +K    K
Sbjct: 241 GIPYYMDREAPPAPDAYAAMVKRVSHNLGCTLMFEPGRMIVGNAGILVAKVIYVKHGDGK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLY+A+H+I  +  PA D   + AD+VGP+CETGD++AL+R +  
Sbjct: 301 NFVIIDAAMNDLIRPTLYEAHHDILPVTQPARDAATMVADVVGPVCETGDYLALDRTLPT 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P+ GDLL I   GAYGAVQ+GTYN+R L+PE++V   Q+ ++RPR+  ++LI +D+   W
Sbjct: 361 PKAGDLLAIMTAGAYGAVQAGTYNTRPLVPEVLVKDDQYAVVRPRIDVEQLIAMDTPAPW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|319899468|ref|YP_004159565.1| Diaminopimelate decarboxylase [Bartonella clarridgeiae 73]
 gi|319403436|emb|CBI77004.1| Diaminopimelate decarboxylase [Bartonella clarridgeiae 73]
          Length = 424

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 221/422 (52%), Positives = 301/422 (71%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE++S+  LA  + TPFYCYS  A+  N+  + NAF  M  ++ YA+K
Sbjct: 1   MHFFSYHQGELHAEDLSISTLAQDIGTPFYCYSARALITNFENYQNAFRDMPYLIAYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQA+++ LA  G+G DIVSEGELRRAL+A +PA +IV+SGVGKTI EID AL   I 
Sbjct: 61  ANSNQAILRLLARSGAGADIVSEGELRRALSAGIPAHKIVYSGVGKTIKEIDFALAQDIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+L   A I+ R+NPD++A THKKI+TGK E+KFGIP+     
Sbjct: 121 CFNVESEPELEQLSARAVALSTTARISLRINPDVDAKTHKKITTGKSENKFGIPLSSARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LPG+ + GVD+HIGSQI  ++ F  AF +  D  +QL  +G  I H+D+GGGL
Sbjct: 181 VYKKAAQLPGLYVCGVDIHIGSQICNLKPFENAFIITADFVRQLWGDGCAITHVDIGGGL 240

Query: 241 GIAYHSDHRP-PSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI+Y ++H   PS  DYA+L+ ++   L   IILEPGR +V + GILVT VI++K+  ++
Sbjct: 241 GISYGAEHYSLPSPFDYAALVRKHIAPLGINIILEPGRSIVGEAGILVTSVINLKRGKER 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D AMNDF+RPTLY+A+  +  +     D L I+AD+VGPICETGD++ LNR + +
Sbjct: 301 NFFIVDAAMNDFIRPTLYEAWQNVLLVKEAPMDALLINADVVGPICETGDYLGLNRSLPI 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDLL +   GAYGAV S TYNSRLLIPE++V G+++ ++RPR+ + +LI LD IP W
Sbjct: 361 LSAGDLLAVTGAGAYGAVMSNTYNSRLLIPEVLVQGARYAVVRPRLDYAQLINLDRIPNW 420

Query: 420 LQ 421
           ++
Sbjct: 421 IE 422


>gi|312115134|ref|YP_004012730.1| diaminopimelate decarboxylase [Rhodomicrobium vannielii ATCC 17100]
 gi|311220263|gb|ADP71631.1| diaminopimelate decarboxylase [Rhodomicrobium vannielii ATCC 17100]
          Length = 422

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 224/423 (52%), Positives = 300/423 (70%), Gaps = 3/423 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G LHAE  +L+ +A  V TPFYCYST  IE++Y  F+ AF G+D +VCYA+K
Sbjct: 1   MHHFSYKNGILHAEGAALDAIARDVGTPFYCYSTATIERHYRVFAEAFTGLDALVCYAIK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN +VI+TLA LGSG D+VSEGE+RRALAA +PA++IVFSGVGKT  E+  AL +GIY
Sbjct: 61  ANSNVSVIRTLAKLGSGADVVSEGEIRRALAAGIPADKIVFSGVGKTEAEMAFALDAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE+EL+ L+Q A   G+ A IAFR+NPD++A TH KISTGK E KFG+      +
Sbjct: 121 GFNVESEAELRALSQVASGRGRTARIAFRINPDVDAKTHAKISTGKSEHKFGVSWRDARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LYA A  LPG+ ++GV MHIGSQI  +E F  AF L+ +L + LR +GH I ++++GGGL
Sbjct: 181 LYALARDLPGLDVAGVHMHIGSQITHMEPFRDAFDLMANLVEDLRRDGHTISYVNLGGGL 240

Query: 241 GIAYHSDHR-PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D   PP  SDYA ++      L  +++ EPGR +V + GILVT+VI  K S +K
Sbjct: 241 GIPYRWDQEVPPLPSDYAEIVIGLSNRLGARLLFEPGRIIVGNAGILVTQVIYSKHSGEK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHI-HADIVGPICETGDFIALNRKIA 358
            FVI+D  MND +RPTLYDAYH+I + VN A     I  AD+VGP+CETGDF+A +R + 
Sbjct: 301 RFVIVDAGMNDLVRPTLYDAYHDI-WPVNEAQRNASIGRADVVGPVCETGDFLAKDRDMP 359

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
              PGDL+ +   GAYGA QS TYN+R L+PE++VNG+ + ++RPR ++++++  + +  
Sbjct: 360 ELAPGDLIAVMTAGAYGAAQSSTYNTRRLVPEVLVNGADYAVVRPRPSYEDMLRAEPLAG 419

Query: 419 WLQ 421
           WL+
Sbjct: 420 WLR 422


>gi|85714907|ref|ZP_01045893.1| diaminopimelate decarboxylase [Nitrobacter sp. Nb-311A]
 gi|85698393|gb|EAQ36264.1| diaminopimelate decarboxylase [Nitrobacter sp. Nb-311A]
          Length = 421

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 220/421 (52%), Positives = 297/421 (70%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE V L  LA VV TPFYCYST  +E++Y  F+ AF G D +VCYA+K
Sbjct: 1   MHHFDYRDGVLHAEGVDLSTLAEVVGTPFYCYSTATLERHYRVFAEAFAGTDHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQ+V++T+A LG+G D+VS GEL+RALAA +PA +I+FSGVGKT  E+  AL + + 
Sbjct: 61  ANSNQSVLRTMAKLGAGADVVSGGELKRALAAEIPANKILFSGVGKTEAELRAALAADVL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           C NVESE EL  L++ A   G+ A ++ R+NPD+++  H KISTG+ E+KFGIPI Q  +
Sbjct: 121 CINVESEPELDLLSRLASETGRTARVSVRINPDVDSGAHAKISTGRLENKFGIPITQARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+K++GVDMHIGSQI  +     AF+LL D    LR++GH + H+D GGGL
Sbjct: 181 VYARAAKLPGIKVTGVDMHIGSQITDLGPMETAFRLLADFVSTLRADGHVVSHVDFGGGL 240

Query: 241 GIAYHSDHR-PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y+ D   PP    YA ++ +   NL C ++ EPGR +V + GILVT+VI +K    +
Sbjct: 241 GIPYYEDRSAPPEPLAYADMVRRVTRNLDCTLMFEPGRMIVGNAGILVTRVIYVKHGNAR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLY+AYH+I  +     D   + AD+VGP+CETGD++AL R +  
Sbjct: 301 NFVIIDAAMNDLIRPTLYEAYHQIMPVRAAPKDAAVMVADVVGPVCETGDYLALERNLPE 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P+ GDLL I   GAYGAVQSGTYN+R LIPE++V G Q+ ++RPR+  ++LI +D +  W
Sbjct: 361 PQAGDLLAIMTAGAYGAVQSGTYNTRALIPEVLVKGDQYAVVRPRIEVEQLIAMDKLAPW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|319404864|emb|CBI78465.1| Diaminopimelate decarboxylase [Bartonella rochalimae ATCC BAA-1498]
          Length = 424

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 224/422 (53%), Positives = 300/422 (71%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y++G LHAE++SL  LA  V TPFYCYS   +  N+  +  AF  M  ++ YA+K
Sbjct: 1   MHFFSYYQGELHAEDLSLSILAQKVGTPFYCYSARTLITNFENYQQAFQDMPYLIAYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQA+++ LA  G+G D+VSEGELRRALAA +PA RIV+SGVGKT+ EID AL   I+
Sbjct: 61  ANSNQAILRLLARSGAGADVVSEGELRRALAAGIPAHRIVYSGVGKTMKEIDFALTQNIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+L   A I+ R+NPD++A THKKI+TGK E+KFGIP+     
Sbjct: 121 CFNVESEPELEQLSARAVALSTTARISLRINPDVDAKTHKKITTGKSENKFGIPLSSARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LPG+ I GVD+HIGSQI  ++ F  AF +  D   QL ++G+ I H+D+GGGL
Sbjct: 181 VYKKAAQLPGLYICGVDIHIGSQICNLKPFEDAFLITADFICQLWNDGYTITHVDIGGGL 240

Query: 241 GIAYHSDHRP-PSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y S+H   PS  +YA+L+ ++   L   IILEPGR +V + GILVT VI +K+  ++
Sbjct: 241 GIPYGSEHHSVPSPFEYAALVRKHIAPLGINIILEPGRSIVGEAGILVTSVIHLKRGKER 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMNDF+RPTLY+A+  +  +     D   I+ADIVGP+CETGD++ LNR +AL
Sbjct: 301 NFVIVDAAMNDFIRPTLYEAWQNVLLVKEKPIDTPLINADIVGPVCETGDYLGLNRSLAL 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDLL +   GAYGAV S TYNSRLLIPE++V   ++ +IRPR+ +++LI LD IP W
Sbjct: 361 LSQGDLLVVTGAGAYGAVMSNTYNSRLLIPEVLVQDMRYAVIRPRLDYEQLIGLDQIPDW 420

Query: 420 LQ 421
           ++
Sbjct: 421 IE 422


>gi|188580974|ref|YP_001924419.1| diaminopimelate decarboxylase [Methylobacterium populi BJ001]
 gi|179344472|gb|ACB79884.1| diaminopimelate decarboxylase [Methylobacterium populi BJ001]
          Length = 422

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 224/421 (53%), Positives = 305/421 (72%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE+V L  LA  V TPFYCYST  +E++Y  F+ AF G D +VC+A+K
Sbjct: 1   MHHFHYRDGRLHAEDVDLTALADEVGTPFYCYSTATLERHYRVFAQAFAGDDALVCFAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+ TLA  G+G+DIVSEGELRRALAA VP ERIVFSGVGKT +E+  AL + I 
Sbjct: 61  ANSNQAVLATLARQGAGMDIVSEGELRRALAAGVPGERIVFSGVGKTREEMAAALDANIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL  L++ A S G+KAP++ RVNPD++A TH KISTGK ++KFGIPI +  +
Sbjct: 121 CFNVESEPELAALSEVAASRGRKAPVSIRVNPDVDALTHAKISTGKSDNKFGIPISRARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG++I GVD HIGSQI  +  F  A +LL +L + L ++GH + H+D GGGL
Sbjct: 181 VYAGAARLPGLEIVGVDAHIGSQITDLTPFDNAARLLCELARDLLADGHRLHHVDFGGGL 240

Query: 241 GIAYH-SDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y   +  PP  +  A+++  +F  L  + + E GR +  + GILVT+VI +K + +K
Sbjct: 241 GIPYRDDNAPPPDPAALAAILRPHFKPLGLRPVFEIGRMIAGNAGILVTRVIYVKPTDEK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+A+H +  +  PA D   + AD+VGP+CE+GD++AL R++ +
Sbjct: 301 TFVIVDGAMNDLIRPTLYEAFHALRPLREPAPDTPRLTADVVGPVCESGDYLALGREMPM 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
             PGDL+ +   GAYGAVQ+GTYNSR L+PE++V+G +  ++RPR ++ +LI LD +P W
Sbjct: 361 AAPGDLIAVMSAGAYGAVQAGTYNSRRLVPEVLVSGDRAAVVRPRPSYDDLIRLDRLPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|148252717|ref|YP_001237302.1| diaminopimelate decarboxylase [Bradyrhizobium sp. BTAi1]
 gi|146404890|gb|ABQ33396.1| diaminopimelate decarboxylase [Bradyrhizobium sp. BTAi1]
          Length = 421

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/421 (52%), Positives = 300/421 (71%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y +G LHAE V+L  LA  V TPFYCYST  +E++Y  F+ AF G D ++CYA+K
Sbjct: 1   MNHFDYRDGVLHAEAVNLAGLAAQVGTPFYCYSTATLERHYRVFAEAFTGQDVLICYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQ+V++TLA LG+G D+VS GEL+RALAA +PA +IVFSGVGKT  E+  AL + I+
Sbjct: 61  ANSNQSVLRTLAKLGAGADVVSGGELKRALAAGIPARKIVFSGVGKTEAELRAALAADIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           C N+ESE EL  L + A   G  A I+ RVNPD++A TH KISTGK E+KFGIP+     
Sbjct: 121 CLNIESEPELDLLARLANETGHTARISVRVNPDVDAGTHAKISTGKSENKFGIPLEHARK 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ + G++++GVD+HIGSQI  +     AF++L +  Q LR++GH I H+D GGGL
Sbjct: 181 VYARAAKMKGIEVTGVDVHIGSQITDLGPMETAFRILAEFVQTLRADGHTISHVDFGGGL 240

Query: 241 GIAYHSDHR-PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI YH D   PP  + YA+++ +   NL C ++ EPGR +V + GILV KVI +K    K
Sbjct: 241 GIPYHMDRAVPPEPAAYAAMVKRVSHNLGCTLMFEPGRMIVGNAGILVAKVIYVKHGEAK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLY+A+H+I  ++ PA +     AD+VGP+CE+GD++AL+R +  
Sbjct: 301 NFVIIDAAMNDLIRPTLYEAHHDILPVIQPAPNAPAFVADVVGPVCESGDYLALDRTLPE 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           PRPGDLL I  +GAYGAVQ+ TYN+R L+PE++V G Q  +IRPR+  ++LI +D+   W
Sbjct: 361 PRPGDLLAIMTSGAYGAVQACTYNTRALVPEVLVKGDQSAVIRPRIEVEQLIAMDTPAPW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|316936209|ref|YP_004111191.1| diaminopimelate decarboxylase [Rhodopseudomonas palustris DX-1]
 gi|315603923|gb|ADU46458.1| diaminopimelate decarboxylase [Rhodopseudomonas palustris DX-1]
          Length = 421

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 219/421 (52%), Positives = 294/421 (69%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE VSL  +A  V TPFYCYST  +E++Y  F+ AF G+D +VCYA+K
Sbjct: 1   MRHFDYRDGVLHAEGVSLASIAKDVGTPFYCYSTATLERHYRVFTEAFAGLDALVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQ+V++TLA LG+G D+VS GEL+RALAA +P  +IVFSGVGKT  E+  AL   I 
Sbjct: 61  ANSNQSVLRTLARLGAGADVVSGGELQRALAAGIPPGKIVFSGVGKTEAELRAALAHDIK 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           C NVESE EL+ L++ AV  G+ A I+ RVNPD+++ TH KISTGK E+KFGIPI     
Sbjct: 121 CLNVESEPELELLSRLAVETGRTARISLRVNPDVDSGTHAKISTGKSENKFGIPIRHARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG++++GVD+HIGSQI  +     AF+ + +    LR +GH + H+D GGGL
Sbjct: 181 VYARAARLPGIQVTGVDVHIGSQIIDLAPMEAAFRKVAEFVHVLRGDGHTVSHVDFGGGL 240

Query: 241 GIAYHSDH-RPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y+ D   PP    YA ++ +   NL C ++ EPGR +V + GILV +VI +K    K
Sbjct: 241 GIPYYEDRDAPPEPFAYAEMVKRVTHNLGCALLFEPGRMIVGNAGILVARVIYVKHGDGK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+AYHEI  +  PA     + AD+VGP+CETGD++AL+RK+  
Sbjct: 301 TFVIIDAAMNDLIRPTLYEAYHEIVAVQQPAPGAASMVADVVGPVCETGDYLALDRKLPE 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + GDL+ I  +GAYGAVQ+ TYN+R L+PE++V   Q  ++RPR T ++LI +D    W
Sbjct: 361 LKAGDLIAIMTSGAYGAVQACTYNTRPLVPEVLVKDDQVAVVRPRFTVEQLIAMDQPAPW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|90426344|ref|YP_534714.1| diaminopimelate decarboxylase [Rhodopseudomonas palustris BisB18]
 gi|90108358|gb|ABD90395.1| diaminopimelate decarboxylase [Rhodopseudomonas palustris BisB18]
          Length = 421

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 218/421 (51%), Positives = 294/421 (69%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G LHAE V+L  LA  V TPFYCYST  +E++Y  FS AF G+D +VCYA+K
Sbjct: 1   MHHFDYRNGVLHAEAVNLSSLADAVGTPFYCYSTATLERHYRVFSEAFAGVDALVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQ+V++TLA LG+G D+VS GEL+RA+AA +P ++I+FSGVGKT  E+  AL   I 
Sbjct: 61  ANSNQSVLRTLAKLGAGADVVSGGELQRAVAAGIPPQKILFSGVGKTATELRAALAHDIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           C NVESE EL+ L++ A  +G+ A I+ RVNPD+++ +H KISTGK E+KFGIPI +   
Sbjct: 121 CINVESEPELELLSRIASEMGRTARISVRVNPDVDSGSHAKISTGKSENKFGIPISRARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+K++GVDMHIGSQI  +     AF+LL D    LR +GH I H+D GGGL
Sbjct: 181 VYARAAKLPGLKVTGVDMHIGSQITDLAPLEVAFRLLADFVTVLRGDGHTISHVDFGGGL 240

Query: 241 GIAYHSDHR-PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  +   PP    YA+++ +   NL C ++ EPGR +V + GILV +V  +K+   K
Sbjct: 241 GIPYFEEPGVPPEPQAYAAMVKRVTHNLGCTLMFEPGRLIVGNAGILVARVTYVKRGDAK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLY+AYH+I  +   A     I AD+VGP+CE+GD++AL+R +  
Sbjct: 301 NFVIIDAAMNDLIRPTLYEAYHDILPVQQAAPGSRDIVADVVGPVCESGDYLALDRSMPE 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P PGDL+ I   GAYGAVQ+ TYN+R L+PE++V G  + ++RPR+  ++LI LD    W
Sbjct: 361 PAPGDLIAIMTAGAYGAVQACTYNTRALVPEVLVKGDNYAVVRPRVDVEQLIALDQPAPW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|254560913|ref|YP_003068008.1| diaminopimelate decarboxylase [Methylobacterium extorquens DM4]
 gi|254268191|emb|CAX24106.1| diaminopimelate decarboxylase [Methylobacterium extorquens DM4]
          Length = 422

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 223/421 (52%), Positives = 306/421 (72%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y +G LHAE+V L  LA  V TPFYCYST  +E++Y  F+ AF G D +VC+A+K
Sbjct: 1   MHHFQYRDGRLHAEDVDLTALAEEVGTPFYCYSTATLERHYRVFAEAFAGDDALVCFAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+ TLAH G+G+DIVSEGELRRALAA VP ERIVFSGVGKT +E+  AL + I 
Sbjct: 61  ANSNQAVLATLAHQGAGMDIVSEGELRRALAAGVPGERIVFSGVGKTREEMAAALDANIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL  L++ AV+ G+KAP++ RVNPD++A TH KISTGK ++KFGIPI +  +
Sbjct: 121 CFNVESEPELAALSEVAVARGRKAPVSIRVNPDVDALTHAKISTGKSDNKFGIPISRARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG++I GVD HIGSQI  +  F  A +LL +L + L ++GH + H+D GGGL
Sbjct: 181 VYAGAARLPGLEIVGVDAHIGSQITDLTPFDNAARLLCELARDLLADGHRLHHVDFGGGL 240

Query: 241 GIAYH-SDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y   +  PP  +  A+++  +F  L  + + E GR +  + GILVT+VI +K + +K
Sbjct: 241 GIPYRDDNAPPPDPAALAAILRPHFKPLGLRPVFEIGRMIAGNAGILVTRVIYVKPTDEK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+A+H +  +  PA +   + AD+VGP+CE+GD++AL R++ +
Sbjct: 301 TFVIVDGAMNDLIRPTLYEAFHALRPVRKPAPNTPRLTADVVGPVCESGDYLALGREMPM 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
             PGDL+ +   GAYGAVQ+ TYNSR L+PE++V G +  ++RPR ++ +LI LD +P W
Sbjct: 361 VAPGDLIAVMSAGAYGAVQACTYNSRRLVPEVLVTGDRSAVVRPRPSYDDLIRLDRLPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|240138367|ref|YP_002962839.1| diaminopimelate decarboxylase [Methylobacterium extorquens AM1]
 gi|240008336|gb|ACS39562.1| diaminopimelate decarboxylase [Methylobacterium extorquens AM1]
          Length = 422

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 223/421 (52%), Positives = 305/421 (72%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE+V L  LA  V TPFYCYST  +E++Y  F+ AF G D +VC+A+K
Sbjct: 1   MHHFHYRDGRLHAEDVDLTALAEDVGTPFYCYSTATLERHYRVFAEAFAGDDALVCFAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+ TLAH G+G+DIVSEGELRRALAA VP ERIVFSGVGKT +E+  AL + I 
Sbjct: 61  ANSNQAVLATLAHQGAGMDIVSEGELRRALAAGVPGERIVFSGVGKTREEMAAALDANIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL  L++ AV+ G+KAP++ RVNPD++A TH KISTGK ++KFGIPI +  +
Sbjct: 121 CFNVESEPELAALSEVAVARGRKAPVSIRVNPDVDALTHAKISTGKSDNKFGIPISRARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG++I GVD HIGSQI  +  F  A +LL +L + L ++GH + H+D GGGL
Sbjct: 181 VYAGAARLPGLEIVGVDAHIGSQITDLTPFDNAARLLCELARDLLADGHRLHHVDFGGGL 240

Query: 241 GIAYH-SDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y   +  PP  +  A+++  +F  L  + + E GR +  + G+LVT+VI +K + +K
Sbjct: 241 GIPYRDDNAPPPDPAALAAILRPHFKPLGLRPVFEIGRMIAGNAGVLVTRVIYVKPTDEK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+A+H +  +  PA D   + AD+VGP+CE+GD++AL R++ +
Sbjct: 301 TFVIVDGAMNDLIRPTLYEAFHALRPVREPAPDTPRLTADVVGPVCESGDYLALGREMPM 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
             PGDL+ +   GAYGAVQ+ TYNSR L+PE++V G +  ++RPR ++ +LI LD +P W
Sbjct: 361 VAPGDLIAVMSAGAYGAVQACTYNSRRLVPEVLVTGDRSAVVRPRPSYDDLIRLDRLPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|298293363|ref|YP_003695302.1| diaminopimelate decarboxylase [Starkeya novella DSM 506]
 gi|296929874|gb|ADH90683.1| diaminopimelate decarboxylase [Starkeya novella DSM 506]
          Length = 422

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 225/421 (53%), Positives = 295/421 (70%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE+ SL  +AH V TPFY YST  +E++Y  F+ AF      +CYALK
Sbjct: 1   MHHFAYRDGLLHAEDASLVDIAHAVGTPFYAYSTATLERHYKVFTEAFADARATLCYALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAVI T A LG+G DIVS GEL+RALAA +   +IVFSGVGKT +E+  AL +G+ 
Sbjct: 61  ANSNQAVIATFAKLGAGADIVSGGELKRALAAGIAPHKIVFSGVGKTREEMAAALDAGVM 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL TL++ AVS G  API+ RVNPD++A TH KISTGK E+KFGIPI +   
Sbjct: 121 CFNVESEPELLTLSEVAVSHGVAAPISVRVNPDVDAKTHHKISTGKSENKFGIPISRARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y +A+ LPG++I+GVDMHIGSQI  +  F  A  LL +L + L ++GH + H+D+GGGL
Sbjct: 181 VYRHAAALPGIRITGVDMHIGSQITDLTPFDNATALLVELARDLMADGHRLTHLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y   D  PP    YA L+ ++  NL   ++ E GR LVA+ GILVT+V+ +K+   K
Sbjct: 241 GVPYVAGDPEPPLPLHYAELVKRHTHNLGLGLVFEIGRMLVANAGILVTRVLYVKEGEGK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLYDA+HEI  +         I AD+VGP+CE+GDF+AL R++  
Sbjct: 301 RFVIVDAAMNDLIRPTLYDAHHEILPVREAKSGEGQIVADVVGPVCESGDFLALGRRLPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + GDL+ +  TGAYGAVQ+ TYN+R L+PE++V G QF ++RPR+    LI LD +P W
Sbjct: 361 LKAGDLVAVMTTGAYGAVQASTYNTRPLVPEVLVKGEQFALVRPRVDADALIALDRVPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|91975418|ref|YP_568077.1| diaminopimelate decarboxylase [Rhodopseudomonas palustris BisB5]
 gi|91681874|gb|ABE38176.1| diaminopimelate decarboxylase [Rhodopseudomonas palustris BisB5]
          Length = 421

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 217/421 (51%), Positives = 294/421 (69%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE+VSL  +A  V TPFYCYST  +E++Y  F+ A  G+D +VCYA+K
Sbjct: 1   MRHFDYRDGVLHAEDVSLASIAQAVGTPFYCYSTATLERHYRVFTEALSGVDALVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQ+V++TLA LG+G D+VS GEL+RALAA +P  +IVFSGVGKT  E+  AL   I 
Sbjct: 61  ANSNQSVLRTLAKLGAGADVVSGGELKRALAAGIPPGKIVFSGVGKTEAELRAALAHDIK 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           C NVESE EL+ L++ AV  G+ A I+ RVNPD+++ TH KISTGK E+KFGIPI     
Sbjct: 121 CLNVESEPELELLSRLAVETGRIARISIRVNPDVDSGTHAKISTGKSENKFGIPIRHARD 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG++++GVD+HIGSQI  +     AF+L+ +    LR +GH I H+D GGGL
Sbjct: 181 VYARAAKLPGIQVTGVDVHIGSQIIDLAPMESAFRLVAEFVHVLRGDGHTISHVDFGGGL 240

Query: 241 GIAYHSDH-RPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y+ D   PP    YA ++ +   NL C ++ EPGR +V + GILV +VI +K    K
Sbjct: 241 GIPYYEDRAAPPEPFSYAEMVKRITHNLGCTLMFEPGRTIVGNAGILVAQVIYVKHGDGK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFV++D AMND +RPTLY+AYHEI  +  PA     I  D+VGP+CETGD++AL+R++  
Sbjct: 301 TFVVIDAAMNDLIRPTLYEAYHEILPVAEPAPGVKMITGDVVGPVCETGDYLALDRQLPE 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + GDL+ I   GAYGAVQ+ TYN+R L+PE++V   Q+ ++RPR+  ++LI +D    W
Sbjct: 361 LKSGDLIAIMTAGAYGAVQACTYNTRALVPEVLVKDDQYAVVRPRIEVEQLIAMDQPAPW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|192293581|ref|YP_001994186.1| diaminopimelate decarboxylase [Rhodopseudomonas palustris TIE-1]
 gi|192287330|gb|ACF03711.1| diaminopimelate decarboxylase [Rhodopseudomonas palustris TIE-1]
          Length = 421

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/421 (51%), Positives = 293/421 (69%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE VSL  +A  V TPFYCYS+  +E++Y  F+ AF G+D +VCYA+K
Sbjct: 1   MRHFDYRDGVLHAEGVSLASIAQDVGTPFYCYSSATLERHYRVFTEAFAGLDALVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQ+V++TLA LG+G D+VS GEL+RALAA +P  +IVFSGVGKT  E+  AL   I 
Sbjct: 61  ANSNQSVLRTLAKLGAGADVVSGGELQRALAAGIPPSKIVFSGVGKTEAELRAALAHDIK 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           C NVESE EL+ L++ AV  G+ A I+ RVNPD+++ TH KISTGK E+KFGIPI     
Sbjct: 121 CLNVESEPELEQLSRIAVETGRTARISLRVNPDVDSGTHAKISTGKSENKFGIPIRHARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG++++GVD+HIGSQI  +     AF+ + +    LR +GH + H+D GGGL
Sbjct: 181 VYARAAKLPGIQVTGVDVHIGSQIVDLAPMEAAFRKVAEFIHVLRGDGHTVSHVDFGGGL 240

Query: 241 GIAYHSDH-RPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y+ D   PP    YA ++ +   NL C ++ EPGR +V + GILV KVI +K    K
Sbjct: 241 GIPYYEDRDAPPEPFAYAEMVKRVTHNLGCTLLFEPGRMIVGNAGILVAKVIYVKHGDGK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+AYHEI  +  PA     + AD+VGP+CETGD++AL+RK+  
Sbjct: 301 TFVIIDAAMNDLIRPTLYEAYHEIIAVQQPAPGVATMVADVVGPVCETGDYLALDRKLPE 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + GDL+ I   GAYGAVQ+ TYN+R L+PE++V   Q  ++RPR+  ++LI +D    W
Sbjct: 361 LKAGDLIAIMTAGAYGAVQACTYNTRALVPEVLVKDDQVAVVRPRIEVEQLIAMDKPAPW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|39937799|ref|NP_950075.1| diaminopimelate decarboxylase [Rhodopseudomonas palustris CGA009]
 gi|39651659|emb|CAE30181.1| diaminopimelate decarboxylase [Rhodopseudomonas palustris CGA009]
          Length = 421

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/421 (51%), Positives = 293/421 (69%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE VSL  +A  V TPFYCYS+  +E++Y  F+ AF G+D +VCYA+K
Sbjct: 1   MRHFDYRDGVLHAEGVSLASIAQDVGTPFYCYSSATLERHYRVFTEAFAGLDALVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQ+V++TLA LG+G D+VS GEL+RALAA +P  +IVFSGVGKT  E+  AL   I 
Sbjct: 61  ANSNQSVLRTLAKLGAGADVVSGGELQRALAAGIPPSKIVFSGVGKTEAELRAALDHDIK 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           C NVESE EL+ L++ AV  G+ A I+ RVNPD+++ TH KISTGK E+KFGIPI     
Sbjct: 121 CLNVESEPELEQLSRIAVETGRTARISLRVNPDVDSGTHAKISTGKSENKFGIPIRHARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG++++GVD+HIGSQI  +     AF+ + +    LR +GH + H+D GGGL
Sbjct: 181 VYARAAKLPGIQVTGVDVHIGSQIIDLAPMEAAFRKVAEFIHVLRGDGHTVNHVDFGGGL 240

Query: 241 GIAYHSDH-RPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y+ D   PP    YA ++ +   NL C ++ EPGR +V + GILV KVI +K    K
Sbjct: 241 GIPYYEDRDAPPEPFAYAEMVKRVTHNLGCTLLFEPGRMIVGNAGILVAKVIYVKHGDGK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+AYHEI  +  PA     + AD+VGP+CETGD++AL+RK+  
Sbjct: 301 TFVIIDAAMNDLIRPTLYEAYHEILPVAAPAPGVATMVADVVGPVCETGDYLALDRKLPE 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + GDL+ I   GAYGAVQ+ TYN+R L+PE++V   Q  ++RPR+  ++LI +D    W
Sbjct: 361 LKAGDLIAIMTAGAYGAVQACTYNTRALVPEVLVKDDQVAVVRPRIEVEQLIAMDKPAPW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|218508585|ref|ZP_03506463.1| diaminopimelate decarboxylase protein [Rhizobium etli Brasil 5]
          Length = 350

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 208/346 (60%), Positives = 273/346 (78%), Gaps = 1/346 (0%)

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           +  SNQAV+KTL  LG+G+D+VSEGELRRALAA + A RI+FSGVGKT  E+D AL++GI
Sbjct: 5   EGESNQAVLKTLGRLGAGIDVVSEGELRRALAADISASRIMFSGVGKTPSEMDFALEAGI 64

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
           YCFNVESE EL+ LNQRAVS GKKAP++FR+NPD++A TH KISTGKKE+KFGI   +  
Sbjct: 65  YCFNVESEPELEILNQRAVSAGKKAPVSFRINPDVDAKTHSKISTGKKENKFGISWERAR 124

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           ++YA+A+ LPG+ ++G+DMHIGSQI +++ F  AFKLLRDL   LR++GH I H+D+GGG
Sbjct: 125 AIYAHAAKLPGIDVTGIDMHIGSQITELQPFDDAFKLLRDLVATLRADGHTIDHVDIGGG 184

Query: 240 LGIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D+ PP   D YA+++     +L CK+I EPGR +V + GILVT+V+ +K   +
Sbjct: 185 LGVPYKDDNNPPPLPDAYAAIVKNQLRDLNCKVITEPGRLIVGNAGILVTEVLYVKDGGE 244

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           KTFVI+D AMND +RPTLY+AYHEI  +   A +   I AD+VGP+CETGD++AL+R++A
Sbjct: 245 KTFVIVDGAMNDLIRPTLYEAYHEIRPVTISAANAPRIRADVVGPVCETGDYLALDREMA 304

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPR 404
           +P+PGDLL +   GAYGAVQ+GTYNSRLL+PE++V G  FH IRPR
Sbjct: 305 MPKPGDLLAVSTAGAYGAVQAGTYNSRLLVPEVLVKGGDFHAIRPR 350


>gi|170742956|ref|YP_001771611.1| diaminopimelate decarboxylase [Methylobacterium sp. 4-46]
 gi|168197230|gb|ACA19177.1| diaminopimelate decarboxylase [Methylobacterium sp. 4-46]
          Length = 423

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 217/421 (51%), Positives = 302/421 (71%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+LHAE V L +LA  V TPFYCY++  +E+++  F+ AF G D +VC+A+K
Sbjct: 1   MHHFTYRDGTLHAEEVDLARLAEAVGTPFYCYASATLERHFRVFAEAFAGDDPLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+ +LA LG+G+DIVSEGELRRALAA VP ERIVFSGV KT  E+ +AL +GI 
Sbjct: 61  ANSNQAVLASLARLGAGMDIVSEGELRRALAAGVPGERIVFSGVAKTRAEMAVALDAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L++ A + G+ AP++ RVNPD++A TH KISTGK E+KFGIPI +   
Sbjct: 121 CFNVESEPELEALSEVARARGQTAPVSIRVNPDVDARTHAKISTGKSENKFGIPISRARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+ ++GVDMHIGSQI  +  +  A  LL +L + L + GH + HID GGGL
Sbjct: 181 VYARAAALPGLAVAGVDMHIGSQITDLAPYDNAASLLAELARDLMAAGHRLHHIDFGGGL 240

Query: 241 GIAYH-SDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y   +  PP  + +A++I  +F  L  + + E GR +  + GILVT+V+ +K+   +
Sbjct: 241 GIPYRDDNAPPPDPAAFAAVIRPHFRPLGLRPVFEIGRMIAGNAGILVTRVVYVKEGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           +FVI+D  MND +RPTLY+AYH +  +  P  +   + AD+VGP+CE+GD++AL R++  
Sbjct: 301 SFVIVDAGMNDLIRPTLYEAYHALRPVRQPDPEAPRLTADVVGPVCESGDYLALGREMPA 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
             PGDLL +   GAYGAVQ+GTYN+R L+PE++V G+   ++RPR +++ELI LD +P W
Sbjct: 361 VAPGDLLAVMSAGAYGAVQAGTYNTRRLVPEVLVRGAAHAVVRPRQSYEELIGLDRVPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|146343265|ref|YP_001208313.1| diaminopimelate decarboxylase [Bradyrhizobium sp. ORS278]
 gi|146196071|emb|CAL80098.1| diaminopimelate decarboxylase [Bradyrhizobium sp. ORS278]
          Length = 446

 Score =  461 bits (1186), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/421 (51%), Positives = 299/421 (71%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y +G LHAE V+L +LA  V TPFYCYST  +E++Y  F++AF G D ++CYA+K
Sbjct: 26  MNHFDYRDGVLHAEAVNLAELASRVGTPFYCYSTATLERHYRVFADAFAGQDVLICYAMK 85

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQ+V++TLA LG+G D+VS GEL+RALAA +P+ +IVFSGVGKT  E+  AL + I+
Sbjct: 86  ANSNQSVLRTLAKLGAGADVVSGGELKRALAAGIPSRKIVFSGVGKTEAELRAALAADIH 145

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           C N+ESE EL  L + AV  G  A I+ RVNPD++A TH KISTGK E+KFGIP+     
Sbjct: 146 CLNIESEPELDLLARLAVETGHTARISIRVNPDVDAGTHAKISTGKSENKFGIPLDHARR 205

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ + G+K++GVD+HIGSQI  +     AF++L +  Q LR++GH+I H+D GGGL
Sbjct: 206 VYARAAKMKGIKVTGVDVHIGSQITDLGPMETAFRILTEFVQTLRADGHDISHVDFGGGL 265

Query: 241 GIAYHSDHR-PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI YH D   PP  + YA+++ +   NL C ++ EPGR +V + GIL+ KVI +K    K
Sbjct: 266 GIPYHMDRAVPPEPAAYAAMVKRVSHNLGCTLMFEPGRMIVGNAGILLAKVIYVKHGEAK 325

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND +RPTLY+A+H+I  +     D     AD+VGP+CE+GD++AL+R +  
Sbjct: 326 NFVIIDAAMNDLIRPTLYEAHHDILPVKQAPPDAPAFVADVVGPVCESGDYLALDRALPE 385

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
           P PGDLL I   GAYGAVQ+ TYN+R L+PE++V G Q  +IRPR+  ++LI +D+   W
Sbjct: 386 PAPGDLLAIMTAGAYGAVQACTYNTRALVPEVLVKGDQAAVIRPRIEVEQLIAMDTPAPW 445

Query: 420 L 420
           L
Sbjct: 446 L 446


>gi|218530082|ref|YP_002420898.1| diaminopimelate decarboxylase [Methylobacterium chloromethanicum
           CM4]
 gi|218522385|gb|ACK82970.1| diaminopimelate decarboxylase [Methylobacterium chloromethanicum
           CM4]
          Length = 422

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 223/421 (52%), Positives = 304/421 (72%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE+V L  LA  V TPFYCYST  +E++Y  F+ AF G D +VC+A+K
Sbjct: 1   MHHFHYRDGRLHAEDVDLTALAEEVGTPFYCYSTATLERHYRVFAEAFAGDDALVCFAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+ TLAH G+G+DIVSEGELRRALAA V  ERIVFSGVGKT +E+  AL + I 
Sbjct: 61  ANSNQAVLATLAHQGAGMDIVSEGELRRALAAGVQGERIVFSGVGKTREEMAAALDANIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL  L++ AV+ G+KAP++ RVNPD++A TH KISTGK ++KFGIPI +  +
Sbjct: 121 CFNVESEPELAALSEVAVARGRKAPVSIRVNPDVDALTHAKISTGKSDNKFGIPISRARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG++I GVD HIGSQI  +  F  A +LL +L + L ++GH + H+D GGGL
Sbjct: 181 VYAGAARLPGLEIVGVDAHIGSQITDLIPFDNAARLLCELARDLLADGHRLHHVDFGGGL 240

Query: 241 GIAYH-SDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y   +  PP  +  A+++  +F  L  + + E GR +  + GILVT+VI +K + +K
Sbjct: 241 GIPYRDDNAPPPDPAALAAILRPHFKPLGLRPVFEIGRMIAGNAGILVTRVIYVKPTDEK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+A+H +  +  PA D   + AD+VGP+CE+GD++AL R++ +
Sbjct: 301 TFVIVDGAMNDLIRPTLYEAFHALRPVREPAPDTPRLTADVVGPVCESGDYLALGREMPM 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
             PGDL+ +   GAYGAVQ+ TYNSR L+PE++V G +  ++RPR ++ +LI LD +P W
Sbjct: 361 VAPGDLIAVMSAGAYGAVQACTYNSRRLVPEVLVTGDRSAVVRPRPSYDDLIRLDRLPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|299132212|ref|ZP_07025407.1| diaminopimelate decarboxylase [Afipia sp. 1NLS2]
 gi|298592349|gb|EFI52549.1| diaminopimelate decarboxylase [Afipia sp. 1NLS2]
          Length = 421

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 222/423 (52%), Positives = 297/423 (70%), Gaps = 5/423 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G LHAE+V +++LA  V TPFYCYST  +E++Y  F+ AF G+DT+VCYA+K
Sbjct: 1   MHHFHYRNGVLHAEDVDIDRLAEAVGTPFYCYSTATLERHYRVFAEAFAGLDTLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQ+V++TLA LG+G D+VS GEL RA AA +PA+RIVFSGVGKT  E+  AL   I 
Sbjct: 61  ANSNQSVLRTLARLGAGADVVSGGELMRARAAGIPADRIVFSGVGKTESELRQALAENIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           C NVESE EL  L++ A   G  A I+ R+NPDI A  H KISTGK E+KFGIP+    +
Sbjct: 121 CINVESEPELDLLSRIAHETGNTARISLRLNPDIGAGGHAKISTGKSENKFGIPLEGARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG++++GVDMHIGSQI  +     AF LL D  + LR++GH I HID GGGL
Sbjct: 181 VYARAAKLPGIRVTGVDMHIGSQITDLGPMESAFTLLVDFVRTLRADGHAIDHIDFGGGL 240

Query: 241 GIAYHSD-HRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y SD   PP+   YA ++ +    L C ++ EPGR +V + GILV++VI +K    +
Sbjct: 241 GIPYESDLPVPPAPDAYADVVKRVTRGLDCTLMFEPGRMIVGNAGILVSRVIYVKHGEAR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYI--VNPAGDRLHIHADIVGPICETGDFIALNRKI 357
            FVI+D AMND +RPTLY+A+H+I  +  V+  GD   I AD+VGP+CETGD++AL R +
Sbjct: 301 NFVIIDAAMNDLIRPTLYEAHHDIIPVREVSSPGD--GIVADVVGPVCETGDYLALGRHL 358

Query: 358 ALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIP 417
              + GDL+ +  +GAYGAVQ+GTYN+R L+PE++V G Q+ ++RPR+   +LI +D I 
Sbjct: 359 PALKAGDLVAVMSSGAYGAVQAGTYNTRGLVPEVLVKGDQYAVVRPRIDPAQLIGMDRIA 418

Query: 418 AWL 420
            WL
Sbjct: 419 PWL 421


>gi|49474787|ref|YP_032829.1| diaminopimelate decarboxylase [Bartonella quintana str. Toulouse]
 gi|49240291|emb|CAF26766.1| Diaminopimelate decarboxylase [Bartonella quintana str. Toulouse]
          Length = 424

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 218/422 (51%), Positives = 295/422 (69%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE +SL  LA  V TPFYCYS  A+   +  + NAF  M +++ YA+K
Sbjct: 1   MRFFSYNQGVLHAEGLSLSALAQDVGTPFYCYSANALVTRFKDYQNAFRDMPSLIAYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV++ LA  G+G D+VSEGELRRALAA +PA  IV+SGVGKT+ EID AL   I 
Sbjct: 61  ANSNQAVLQLLAANGAGADVVSEGELRRALAAGIPAHCIVYSGVGKTVKEIDFALAHDIC 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+  K A I+ R+NPD++A THKKI+TGK E+KFGIP+     
Sbjct: 121 CFNVESEPELEQLSARAVAFSKTARISLRINPDVDAKTHKKITTGKYENKFGIPLSLAWD 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LPG+ + GVDMHIGSQI  ++ F  AF ++ D  + L S+G+ + H+D+GGGL
Sbjct: 181 VYKKAAQLPGIHVCGVDMHIGSQICDLKPFEDAFLIVADFVRHLSSSGYALTHVDIGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GIAY H  H  PS  DYA+L+ ++   L  KII+EPGR ++ + G+LVT VI +K+   +
Sbjct: 241 GIAYGHEQHSVPSLFDYAALVKRHIAPLGLKIIVEPGRSIIGEAGVLVTSVIYLKRGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FV++D AMND +RPTLYDA+  +  +     D   I ADIVG +CETGD++AL+R++ +
Sbjct: 301 NFVVVDAAMNDLIRPTLYDAWQNVLLVKQAPEDASFIRADIVGSVCETGDYLALDRRVPI 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDLL I   GAY AV + TYNSRLL+PE++V  +++ IIRPR+ + +LI  D IP W
Sbjct: 361 LAAGDLLAITGAGAYSAVMASTYNSRLLVPEVLVQDTRYAIIRPRLDYAQLIGCDHIPDW 420

Query: 420 LQ 421
           ++
Sbjct: 421 IE 422


>gi|209883910|ref|YP_002287767.1| diaminopimelate decarboxylase [Oligotropha carboxidovorans OM5]
 gi|209872106|gb|ACI91902.1| diaminopimelate decarboxylase [Oligotropha carboxidovorans OM5]
          Length = 422

 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 216/422 (51%), Positives = 297/422 (70%), Gaps = 2/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y  G LHAE+V + +LA  + TPFYCYST  +E++Y  F+ AF G+DT+VCYA+K
Sbjct: 1   MHHFQYRNGVLHAEDVDIGRLAEQLGTPFYCYSTATLERHYRVFTEAFAGVDTLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQ+V++TLA LG+G D+VS GEL RA AA +PA++IVFSGVGKT  E+  AL   I 
Sbjct: 61  ANSNQSVLRTLARLGAGADVVSGGELMRARAAGIPADKIVFSGVGKTEGELRQALAENIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           C NVESE EL  L++ A   G+ A ++ R+NPDI A  H KISTGK E+KFGIP+ +   
Sbjct: 121 CINVESEPELDLLSRVADETGQVARVSLRLNPDIGAGGHAKISTGKSENKFGIPLSRARG 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG++++GVDMHIGSQI  +     AF LL D  + LR++GH I HID GGGL
Sbjct: 181 VYARAAKLPGIRLTGVDMHIGSQITDLAPLEAAFALLVDFVRTLRADGHAIDHIDFGGGL 240

Query: 241 GIAYHSD-HRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           GI Y SD   PP+ + YA ++ +    L  C+++ EPGR +V + GILV++VI +K    
Sbjct: 241 GIPYESDLPVPPTPAAYAEVVKRVTRGLDDCRLLFEPGRMIVGNAGILVSRVIYVKHGEG 300

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           + FVI+D AMND +RPTLY+A+H+I  +   A +   + AD+VGP+CETGD++AL R++ 
Sbjct: 301 RNFVIIDAAMNDLIRPTLYEAHHDILPVREAAPNDPSLVADVVGPVCETGDYLALGRRLP 360

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
               GDL+ +  +GAYGAVQ+GTYN+R L+PE++V G  + ++RPR+   +LI LD I  
Sbjct: 361 ALAAGDLVAVMSSGAYGAVQAGTYNTRPLVPEVLVKGGDYAVVRPRVDAAQLIALDQIAP 420

Query: 419 WL 420
           WL
Sbjct: 421 WL 422


>gi|163744294|ref|ZP_02151654.1| diaminopimelate decarboxylase [Oceanibulbus indolifex HEL-45]
 gi|161381112|gb|EDQ05521.1| diaminopimelate decarboxylase [Oceanibulbus indolifex HEL-45]
          Length = 421

 Score =  455 bits (1171), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 219/421 (52%), Positives = 296/421 (70%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE+VSL ++A  V TP Y YST  + +++  F +A  GMD +VCYA+K
Sbjct: 1   MDHFLYKDGVLHAEDVSLAEIAAAVGTPVYVYSTATLLRHFHLFDDALSGMDHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV++TLA  G+G+D+VS GE RRA AA V  +RIVFSGVGKT +EI+LAL  GI 
Sbjct: 61  ANSNQAVLRTLAQAGAGMDVVSGGEYRRAKAAGVAGDRIVFSGVGKTREEIELALTGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E+  L+  A  LGK API  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMILLDIVARELGKVAPITIRVNPDVDAKTHAKIATGKSENKFGIPIARARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+TLPG++I G+D+HIGSQ+  +  F +A+  + +LT+ LR++GHNI+ +D+GGGL
Sbjct: 181 VYAMAATLPGLEIIGIDVHIGSQLTDLAPFEQAYGKVAELTEVLRADGHNIRRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP  +DY +++ +  G+L C+I +EPGR +  + G+LV++VI +K    +
Sbjct: 241 GIPYERSNSAPPLPTDYGAMVQRTLGHLDCEIEIEPGRLIAGNAGVLVSEVIYLKSGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP +YDA+H+I  +  PA        DIVGP+CE+GD  A  R + +
Sbjct: 301 DFLILDAAMNDLIRPAMYDAWHDIVPLNEPAPGAEPRPVDIVGPVCESGDTFAKQRMMPV 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV S  YNSR LIPE++VNG QF +IRPR +F E+I  D+IP W
Sbjct: 361 LGSGDLVAFRSAGAYGAVMSSEYNSRPLIPEVLVNGDQFAVIRPRPSFDEMINRDTIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|121602458|ref|YP_988394.1| diaminopimelate decarboxylase [Bartonella bacilliformis KC583]
 gi|120614635|gb|ABM45236.1| diaminopimelate decarboxylase [Bartonella bacilliformis KC583]
          Length = 424

 Score =  455 bits (1170), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 216/422 (51%), Positives = 297/422 (70%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y +G LHAE +SL  LA  V TPFYCYS+ A+  ++  +  AF  M +++ YA+K
Sbjct: 1   MNFFSYHQGELHAEGLSLSTLAKDVGTPFYCYSSGALVAHFKEYQEAFHDMPSLIAYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV++ LA  G+G D+VSEGELRRALA  +  +RIV+SGVGKT+ EID AL   I+
Sbjct: 61  ANSNQAVLRILAAKGAGADVVSEGELRRALAVGITPQRIVYSGVGKTVREIDFALSQDIF 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+L K A I+ R+NPD++A THKKI+TG+ ++KFGIP+    S
Sbjct: 121 CFNVESEPELEQLSARAVALSKTARISLRINPDVDAKTHKKITTGRFDNKFGIPLSLACS 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A+ LPG+++ G+DMHIGSQI  ++ F  AF +  D  + L   G+ I HID+GGGL
Sbjct: 181 AYKKAAQLPGLQVRGMDMHIGSQICDLKPFEDAFLIAADFVRHLWREGYAITHIDIGGGL 240

Query: 241 GIAYHSDHR-PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI+YH +    PS +DYA+L+ ++   L   IILEPGR +    G+LVT VI +K+   +
Sbjct: 241 GISYHPEQNMVPSPADYAALVRKHIAPLGINIILEPGRSIAGHAGVLVTSVIYLKRGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FV++D AMNDF+RPTLYDA+  +  +     D   I ADIVGP+CETGD++ LNR + +
Sbjct: 301 NFVVVDGAMNDFLRPTLYDAWQTVVPVKKAPEDAPLIMADIVGPVCETGDYLGLNRSLPM 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDLL I   GAYGAV + TYNSRLL+PEI+V  +++ +IRPR+ +++L+ LD IP W
Sbjct: 361 VAAGDLLAITGAGAYGAVMASTYNSRLLVPEILVQNTRYDVIRPRLDYEQLMGLDHIPDW 420

Query: 420 LQ 421
           ++
Sbjct: 421 IE 422


>gi|158426283|ref|YP_001527575.1| diaminopimelate decarboxylase [Azorhizobium caulinodans ORS 571]
 gi|158333172|dbj|BAF90657.1| diaminopimelate decarboxylase [Azorhizobium caulinodans ORS 571]
          Length = 420

 Score =  455 bits (1170), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 218/422 (51%), Positives = 300/422 (71%), Gaps = 4/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F + +G L AE+V +  LA  V TPFYCYST  +E++Y  F  AF   + ++CYALK
Sbjct: 1   MHHFIHHDGRLKAEDVDIATLAEEVGTPFYCYSTATLERHYRVFKAAFAEREMLLCYALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAVI TLA +G+G DIVS GEL+RALAA +P ERIVFSGVGKT +E+  AL++GI 
Sbjct: 61  ANSNQAVIATLARMGAGADIVSGGELKRALAAGIPGERIVFSGVGKTREEMAQALEAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL  L+Q A ++G+ A I+ R+NPD++A TH KISTGK E+KFGIPI +  +
Sbjct: 121 CFNVESEPELSALSQVATAMGRTANISIRINPDVDAKTHAKISTGKSENKFGIPISRART 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+TLPG+K++G+DMHIGSQI  +  F  A  L+ +L + L + GH + H+D+GGGL
Sbjct: 181 VYAEAATLPGLKVAGIDMHIGSQITDLGPFENATLLMAELARDLLAQGHALHHLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y   D  PPS   YA++I +    L   ++ E GR +VA+ GILV +VI +K    K
Sbjct: 241 GVPYVAGDPVPPSPDAYAAVITRALKGLDLPLVFEMGRMIVANAGILVARVIYVKHGEGK 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYI-VNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           TFVI+D AMND +RPTLY+A+H+I  +   P+     +  D+VGP+CETGD++AL+R++ 
Sbjct: 301 TFVIVDAAMNDLIRPTLYEAHHDIVPVHQRPSAPTAKV--DVVGPVCETGDYLALDRELP 358

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
              PGDL+ +   GAYGAVQ+ TYN+R LI E++V+G Q  ++RPR+  ++LI LD +P+
Sbjct: 359 ELMPGDLIAVMTAGAYGAVQASTYNTRPLIAEVLVSGHQAAVVRPRVEVEQLIGLDRLPS 418

Query: 419 WL 420
           W 
Sbjct: 419 WF 420


>gi|260431546|ref|ZP_05785517.1| diaminopimelate decarboxylase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415374|gb|EEX08633.1| diaminopimelate decarboxylase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 421

 Score =  454 bits (1169), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 216/421 (51%), Positives = 293/421 (69%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+LHAE+V +  +A  V TPFY YST  + ++Y  F  A  G D +VCYA+K
Sbjct: 1   MDHFLYRDGALHAEDVPIAHIAEAVGTPFYIYSTATLLRHYRLFDEALAGTDHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SNQA++KTLA  G+G+D+VS GE  RA AA VP ++IVFSGVGKT +EI  AL  GI 
Sbjct: 61  AASNQAILKTLAQAGAGMDVVSGGEYLRAKAAGVPGDKIVFSGVGKTAEEIRTALTGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E++ +N  A+ LG  API  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMEVINAVALELGVIAPITVRVNPDVDAKTHAKIATGKSENKFGIPIARAPQ 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A++LPG+K+ G+D+HIGSQ+  +E F  A+  + +LT+QLR+ GH+I+ +D+GGGL
Sbjct: 181 VYAHAASLPGLKVVGIDVHIGSQLTDLEPFRLAYSKVAELTEQLRAQGHDIRRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP   +Y ++I +  G+L C+I +EPGR +  + G++V+KVI +K    +
Sbjct: 241 GIPYARSNEAPPLPVEYGAMIKETLGHLGCEIEIEPGRLIAGNAGLMVSKVIYVKSGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP +YDAYH+I  ++ PA        DIVGP+CETGD  A  R +  
Sbjct: 301 DFLILDGAMNDLIRPAMYDAYHDIVPVIEPAPGVEQRPYDIVGPVCETGDTFAKQRNMPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            RPGDL+     GAYGAV +  YN+R LIPE++VNG QF +IR R TF E+I  D+IP W
Sbjct: 361 LRPGDLVAFRSAGAYGAVMASEYNTRPLIPEVLVNGDQFAVIRERPTFDEIINRDTIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|163734181|ref|ZP_02141622.1| diaminopimelate decarboxylase [Roseobacter litoralis Och 149]
 gi|161392717|gb|EDQ17045.1| diaminopimelate decarboxylase [Roseobacter litoralis Och 149]
          Length = 421

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 216/421 (51%), Positives = 297/421 (70%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE+V + ++A  V TPFY YST  + +++  F  A DGMD +VCYA+K
Sbjct: 1   MDHFLYRDGVLHAEDVPVPEIAATVGTPFYLYSTATLLRHFRLFDEALDGMDHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SNQA++KTLA  G+G+D+VS GE  RA AA VP ++IVFSGVGKT  EI LAL+ GI 
Sbjct: 61  AASNQAILKTLAQAGAGMDVVSGGEYLRAKAAGVPGDKIVFSGVGKTAAEIRLALEGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E++ LN  A+++G  API  RVNPD++A TH KI+TGK E+KFGIPI + H 
Sbjct: 121 QFNVESEPEMEVLNATALAMGVTAPITIRVNPDVDAKTHAKIATGKSENKFGIPISRAHE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A++L G+++ G+D+HIGSQ+  +  F  A+  + +LT QLR+ GHNI+ +D+GGGL
Sbjct: 181 VYALAASLKGLEVIGIDVHIGSQLTDLAPFEAAYDKVAELTGQLRAQGHNIRRLDLGGGL 240

Query: 241 GIAYHSDHR-PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D++ PP  SDY ++I +  G+L C+I +EPGR +V + GI+V++VI +K   D+
Sbjct: 241 GIPYTRDNQAPPLPSDYGAMIKRKLGHLGCEIEIEPGRLIVGNAGIMVSEVIYVKSGEDR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+I+D AMND +RP +Y+AYH+I  +V P      +  DIVGP+CE+GD  A  R +  
Sbjct: 301 DFLIIDGAMNDLIRPAMYEAYHDIIPVVEPDPGIEQVKFDIVGPVCESGDTFARARVMPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              G+L+     GAYGAV S  YNSR LIPE++V+  QF +IRPR TF E+I+ D+IP W
Sbjct: 361 VAAGELVAFRSAGAYGAVMSSEYNSRPLIPEVLVHEDQFAVIRPRPTFDEMIKRDTIPTW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|110678901|ref|YP_681908.1| diaminopimelate decarboxylase [Roseobacter denitrificans OCh 114]
 gi|109455017|gb|ABG31222.1| diaminopimelate decarboxylase [Roseobacter denitrificans OCh 114]
          Length = 421

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 215/421 (51%), Positives = 297/421 (70%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE+VS+ ++A  V TPFY YST  + +++  F  A DGMD +VCYA+K
Sbjct: 1   MDHFLYRDGVLHAEDVSVPEIAAAVGTPFYLYSTATLLRHFRLFDEALDGMDHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SNQA++KTLA  G+G+D+VS GE  RA AA VP ++IVFSGVGKT  EI LAL+ GI 
Sbjct: 61  AASNQAILKTLAQAGAGMDVVSGGEYLRAKAAGVPGDKIVFSGVGKTAAEIRLALEGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E++ LN  A+ +G  API  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMEVLNAAALEMGVTAPITIRVNPDVDAKTHAKIATGKSENKFGIPISRARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+++ G+++ G+D+HIGSQ+ ++  F  A+  + +LT+QLR+ GHNI+ +D+GGGL
Sbjct: 181 VYALAASMKGLEVIGIDVHIGSQLTELAPFEAAYDKVAELTEQLRAEGHNIRRLDLGGGL 240

Query: 241 GIAYHSDHR-PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D++ PP  SDY ++I +  G+L C+I +EPGR +V + GI+V++VI +K   D+
Sbjct: 241 GIPYARDNQAPPLPSDYGAMIKRKLGHLGCEIEIEPGRLIVGNAGIMVSEVIYVKSGEDR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+I+D AMND +RP +Y+AYH+I  +V P      +  DIVGP+CETGD  A  R +  
Sbjct: 301 DFLIIDGAMNDLIRPAMYEAYHDIIPVVEPDPGVEQVKFDIVGPVCETGDTFARARIMPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              G+ +     GAYGAV S  YNSR LIPE++V+  QF +IRPR TF E+I+ D+IP W
Sbjct: 361 VAAGERVAFRSAGAYGAVMSSEYNSRPLIPEVLVHEDQFAVIRPRPTFDEMIKRDTIPTW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|86139003|ref|ZP_01057574.1| diaminopimelate decarboxylase [Roseobacter sp. MED193]
 gi|85824234|gb|EAQ44438.1| diaminopimelate decarboxylase [Roseobacter sp. MED193]
          Length = 421

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 215/421 (51%), Positives = 296/421 (70%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+L+AE+V + ++A  V TPFY YST  + +++  F  A +GMD +VCYA+K
Sbjct: 1   MDHFLYRDGALYAEDVPVAEIAAAVGTPFYVYSTATLLRHFRLFDEALEGMDHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SNQA++KTLA  G+G+D+VS+GE  RA AA VP ++IVFSGVGKT DEI  AL  GI 
Sbjct: 61  AASNQAILKTLAQAGAGMDVVSQGEYLRAKAAGVPGDKIVFSGVGKTADEIRCALSGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E+  +N  A+ LG+ API  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMAVINAVALELGQVAPITIRVNPDVDAKTHAKIATGKSENKFGIPISRARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A+TLPG+K+ GVD HIGSQ+ ++E F KA++ + +LT+ LR++GH+I  +D+GGGL
Sbjct: 181 VYAHAATLPGLKVIGVDCHIGSQLTELEPFRKAYEKIAELTESLRADGHDIHRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP   +Y  LI +  G+L C+I +EPGR +  + G++V+KVI +K   D+
Sbjct: 241 GIPYTRSNEAPPLPVEYGQLIKETLGHLGCEIEIEPGRLIAGNAGLMVSKVIYVKSGEDR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+I+D AMND +RP +Y+A+H+I  +  PA    +   DIVGP+CETGD  A  R +  
Sbjct: 301 EFLIVDGAMNDLIRPAMYEAHHDIVAVNEPAPGIENRPYDIVGPVCETGDTFAKQRDMPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV +  YNSR LIPE++V+G QF +IRPR  F E+I  D+IP W
Sbjct: 361 LAAGDLIAFRSAGAYGAVMASEYNSRPLIPEVLVHGDQFAVIRPRPDFDEMINRDTIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|254510199|ref|ZP_05122266.1| diaminopimelate decarboxylase [Rhodobacteraceae bacterium KLH11]
 gi|221533910|gb|EEE36898.1| diaminopimelate decarboxylase [Rhodobacteraceae bacterium KLH11]
          Length = 421

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 213/421 (50%), Positives = 295/421 (70%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+L AE+V + ++A  V TPFY YST  +++++  F +A DG D +VCYA+K
Sbjct: 1   MDHFLYRDGALFAEDVPISEIAAAVGTPFYVYSTATLQRHFKLFDDALDGTDHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SNQA++KTLA  G+G+D+VS GE  RA AA VP ++IVFSGVGKT DEI  AL  GI 
Sbjct: 61  AASNQAILKTLAQAGAGMDVVSGGEYLRAKAAGVPGDKIVFSGVGKTADEIRTALTGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E++ +N  A+ LGK API  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMQVINAVALDLGKVAPITIRVNPDVDAKTHAKIATGKSENKFGIPISRASE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A++LPG+++ G+D+HIGSQ+ ++E F  A+  + +LT++LRS GHNI+ +D+GGGL
Sbjct: 181 VYALAASLPGLEVIGIDVHIGSQLTELEPFELAYTKVAELTERLRSEGHNIRRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP   +Y ++I +  G+L C+I +EPGR +  + G++V+ VI +K   D+
Sbjct: 241 GIPYTRSNDAPPLPVEYGAMIQKTLGHLGCEIEIEPGRLIAGNAGLMVSSVIYVKSGEDR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP +Y+A+H+I  +  PA        DIVGP+CETGD  A  R +  
Sbjct: 301 DFLILDGAMNDLIRPAMYEAHHDIVAVEEPAAGVEQRPYDIVGPVCETGDTFARQRNMPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + GDL+     GAYGAV S  YN+R LIPE++VNG QF +IR R +F E+I  D+IP W
Sbjct: 361 LKSGDLIAFRSAGAYGAVMSSEYNTRPLIPEVLVNGDQFAVIRERPSFDEIINRDTIPGW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|144899443|emb|CAM76307.1| Diaminopimelate decarboxylase [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 421

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 213/422 (50%), Positives = 287/422 (68%), Gaps = 3/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFD--GMDTMVCYA 58
           M+ F Y  G L AE V + ++A  V TPFYCYST  + ++Y  F+ A    G+D  VC+A
Sbjct: 1   MNHFDYVNGQLQAEQVPVAEIAAQVGTPFYCYSTATLVRHYTVFTQALAEAGLDAQVCFA 60

Query: 59  LKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSG 118
           LKAN N AV++T A LG+G D+VSEGELRRALAA VP +RIVFSGVGKT  E+  A+  G
Sbjct: 61  LKANPNVAVVRTFAQLGAGADVVSEGELRRALAAGVPVDRIVFSGVGKTEAELTFAVAKG 120

Query: 119 IYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQI 178
           I   NVESE EL+ L++ A + G + PIA RVNPD++A TH KI+TGKKE+KFGI   + 
Sbjct: 121 IMQINVESEPELEALSKIAAARGIRMPIALRVNPDVDAGTHAKITTGKKENKFGIEWTRA 180

Query: 179 HSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGG 238
           H +Y  A  LPG+++ G+  HIGSQ+  +E F +AF  +RDL   LR++G NI+ +D+GG
Sbjct: 181 HEVYNKARALPGIEVVGIACHIGSQLTDVEPFRQAFLRVRDLVAMLRADGFNIRRLDLGG 240

Query: 239 GLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           GLGI Y S+  PP  + YA  I    G+L CKI+LEPGR LV + GILV++V+ +K+ A 
Sbjct: 241 GLGIPYESEE-PPHPAVYAKAIKDTLGDLGCKIVLEPGRLLVGNAGILVSRVVYVKEGAT 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           +TF+I D AMND MRP LY+A+H I  ++ PA D   +  D+VGP+CETGD  A  R + 
Sbjct: 300 RTFLIADAAMNDLMRPALYEAHHTIEPVIEPAKDAPRLPVDVVGPVCETGDTFAKQRSLP 359

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
             + GDL+     GAYGA  S TYN+R L+PE++V    F ++R R +F +++ LDS+P 
Sbjct: 360 PIKAGDLIVFRTAGAYGAAMSSTYNTRPLVPEVLVKDDSFAVVRARPSFDDMLALDSVPD 419

Query: 419 WL 420
           WL
Sbjct: 420 WL 421


>gi|85705851|ref|ZP_01036947.1| diaminopimelate decarboxylase [Roseovarius sp. 217]
 gi|85669439|gb|EAQ24304.1| diaminopimelate decarboxylase [Roseovarius sp. 217]
          Length = 421

 Score =  452 bits (1162), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 216/421 (51%), Positives = 291/421 (69%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G L AE+V L ++A  V TPFYCYST  +E+++  F  A  GMD +VCYA+K
Sbjct: 1   MDHFLYHNGVLQAEDVPLSEIAEAVGTPFYCYSTATLERHFRLFDEALTGMDHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SNQA++KTLA LG+G+D+VS GE  RA AA VP ERIVFSGVGKT +E+ LAL  GI 
Sbjct: 61  AASNQAILKTLARLGAGMDVVSGGEYARAKAAGVPGERIVFSGVGKTREEMRLALMGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E+  L+  AV LG +API  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMGVLSAVAVELGLRAPITIRVNPDVDAKTHAKIATGKSENKFGIPIARARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+++ G+D+HIGSQ+  +  F  A++ + +LTQ LR +GH+I+ +D+GGGL
Sbjct: 181 VYAQAAALPGLEVIGIDVHIGSQLTDLAPFRLAYEKVAELTQVLREDGHDIRRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP  ++Y +LI +  G+L C+I +EPGR +  + GILV++VI +K    +
Sbjct: 241 GIPYTRSNEAPPLPTEYGALIREVLGHLGCEIEIEPGRLIAGNAGILVSRVIYLKSGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP +YDA+H+I  +V PA        D+VGP+CE+GD  A  R +  
Sbjct: 301 DFLILDAAMNDLIRPAMYDAHHDIVPLVEPAPGVEQQPYDVVGPVCESGDTFAKGRMLPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV S  YN+R L+PE++V+G  F +IR R TF E+I  D+IP W
Sbjct: 361 LAEGDLVAFRSAGAYGAVMSSEYNTRPLVPEVLVHGRDFAVIRGRPTFDEMINRDTIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|71279638|ref|YP_267983.1| diaminopimelate decarboxylase [Colwellia psychrerythraea 34H]
 gi|71145378|gb|AAZ25851.1| diaminopimelate decarboxylase [Colwellia psychrerythraea 34H]
          Length = 420

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 212/420 (50%), Positives = 298/420 (70%), Gaps = 3/420 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           +S F +    +  EN++L  +A  VQTPFYCYS+TAIE ++  + NAF   D ++CYA+K
Sbjct: 4   VSYFPHKNNEMFVENIALSDIAQHVQTPFYCYSSTAIETSFQAYKNAFSSQDALICYAVK 63

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+ TLA LGSG D+VS GE+RRA+ A +PA++IV+SGV KT +EI  AL  GI+
Sbjct: 64  ANSNQAVLATLAKLGSGADVVSMGEIRRAITAGIPADKIVYSGVAKTEEEIHYALSLGIF 123

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE EL+ +++ A SL K A IAFR+NPD+ A TH KISTGK E+KFG+PI +   
Sbjct: 124 QFNVESEPELELISKVATSLNKTAAIAFRINPDVCAQTHAKISTGKAENKFGVPISKARI 183

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A++LPG+K+ GVD+HIGSQ+  +  F +A++ + +L  +LR++GH I  +DVGGGL
Sbjct: 184 AYKRAASLPGIKVQGVDVHIGSQLTSLAPFEEAYQRIAELVNELRADGHEISVVDVGGGL 243

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  D   PS   YA L+    G+L CKII+EPGR L+ + GILV+ V+ IK   ++ 
Sbjct: 244 GITYL-DEIIPSKQSYADLVKAQLGHLNCKIIIEPGRSLLGNAGILVSSVVFIKNGEERQ 302

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F+ILD  MND +RP++Y+AYH+I   VN   + L  + D+VGP+CETGD  A  R++   
Sbjct: 303 FLILDAGMNDLIRPSMYEAYHQI-IAVNKGANELKTY-DVVGPVCETGDTFAKARQVHKS 360

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
             GDL+ I  +GAYG+V S +YN+R+L PE+MV G++F I++ R +++E+I+ D IP+WL
Sbjct: 361 DAGDLIAIMSSGAYGSVMSSSYNTRMLAPEVMVKGNEFAIVKKRPSYEEIIKQDIIPSWL 420


>gi|163741842|ref|ZP_02149232.1| diaminopimelate decarboxylase [Phaeobacter gallaeciensis 2.10]
 gi|161385015|gb|EDQ09394.1| diaminopimelate decarboxylase [Phaeobacter gallaeciensis 2.10]
          Length = 421

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 212/421 (50%), Positives = 297/421 (70%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+L+AE+V + ++A  V TPFY YST  + +++  F++A  GMD +VCYA+K
Sbjct: 1   MDHFLYRDGALYAEDVPVAEIAATVGTPFYLYSTATLLRHFHLFNDALKGMDHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SNQA++KTLA  G+G+D+VS+GE  RA AA VP +RIVFSGVGKT DEI  AL  GI 
Sbjct: 61  AASNQAILKTLAQAGAGMDVVSQGEYLRAKAAGVPGDRIVFSGVGKTQDEIRTALSGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E+  +N  A+ LG  API  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMDVINAVALELGVVAPITVRVNPDVDAKTHAKIATGKSENKFGIPIARARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A++LPG+K+ G+D+HIGSQ+ ++  F  A++ + +LT+QLR++GH+I  +D+GGGL
Sbjct: 181 VYARAASLPGLKVIGIDVHIGSQLTELAPFELAYQKVAELTEQLRADGHDIHRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP   +Y +++ +  G+L C+I +EPGR +  + GI+V+KVI +K   D+
Sbjct: 241 GIPYTRSNDTPPLPVEYGAMVQRTLGHLGCEIEIEPGRLIAGNAGIMVSKVIYVKSGEDR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+I+D AMND +RP +Y+AYH+I  ++ P+        DIVGP+CETGD  A +R ++ 
Sbjct: 301 DFLIIDGAMNDLIRPAMYEAYHDIVPVIEPSAGVEQRAYDIVGPVCETGDTFARHRDMSP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV +  YNSR LIPE++VNG QF +IR R  F E+I  D+IP W
Sbjct: 361 LEAGDLVAFRSAGAYGAVMASEYNSRPLIPEVLVNGDQFAVIRRRPDFDEMINRDTIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|83951152|ref|ZP_00959885.1| diaminopimelate decarboxylase [Roseovarius nubinhibens ISM]
 gi|83839051|gb|EAP78347.1| diaminopimelate decarboxylase [Roseovarius nubinhibens ISM]
          Length = 421

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 208/421 (49%), Positives = 294/421 (69%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G L+AE+V + ++A  V TPFY YST  +E+++  F  A +G+D +VCYA+K
Sbjct: 1   MDHFLYRDGELYAEDVPVAEIAAAVGTPFYVYSTATLERHFRLFDEALEGIDHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SNQA++KTLA LG+G+D+VS GE  RA+AA VP +RIVFSGVGKT DE+  AL  GI 
Sbjct: 61  AASNQAILKTLARLGAGMDVVSGGEYARAIAAGVPGDRIVFSGVGKTRDEMRAALTGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E+  LN+ A+ LG +API  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMAALNEVALELGTRAPITVRVNPDVDAKTHAKIATGKSENKFGIPIARARD 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ +PG+++ G+D+HIGSQ+  +E F  A++ + +LT+ LR+ GH+I+ +D+GGGL
Sbjct: 181 VYAQAAAMPGLEVIGIDVHIGSQLTDLEPFRLAYRKVAELTETLRAEGHDIRRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y   +  PP   +Y  +I +  G+L C+I +EPGR +  + G++V++VI +K   D+
Sbjct: 241 GIPYARGNEAPPLPVEYGKMIKEELGHLGCEIEIEPGRLVAGNAGLMVSRVIYVKSGEDR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP +YDA+H+I  +V P         D+VGP+CE+GD  A  R + +
Sbjct: 301 EFLILDGAMNDLIRPAMYDAHHDIVPVVEPQAGAEQRPYDVVGPVCESGDTFAKGRNLPV 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV S  YN+R LIPE++V+G QF +IR R +F E+I  D+IP W
Sbjct: 361 LNAGDLVAFRSAGAYGAVMSSEYNTRPLIPEVLVHGHQFAVIRARPSFDEMINRDTIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|260576231|ref|ZP_05844223.1| diaminopimelate decarboxylase [Rhodobacter sp. SW2]
 gi|259021499|gb|EEW24803.1| diaminopimelate decarboxylase [Rhodobacter sp. SW2]
          Length = 421

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 216/422 (51%), Positives = 295/422 (69%), Gaps = 3/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  GSLHAE+V+L ++A  V TPFYCYS   + ++Y  F+ A + +  +VC+A+K
Sbjct: 1   MDHFLYRNGSLHAEDVALTEIAASVGTPFYCYSAATLTRHYALFTEALNPLPHLVCFAIK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN AV+K L  LG+G+D+VS GE RRA AA VP +RIVFSGVGKT DE+ LALQ GI 
Sbjct: 61  SLSNLAVLKLLGDLGAGMDVVSGGEYRRARAAGVPGDRIVFSGVGKTRDEMRLALQGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE EL+ L+Q A  LG  APIA RVNPD++A TH+KI+TGKKE+KFGIPI +   
Sbjct: 121 QFNVESEPELRALSQVATELGLTAPIALRVNPDVDARTHEKIATGKKENKFGIPISRAPQ 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+++ G+D+HIGSQ+ ++E F +AF+ + DLTQ LR+ GH+I+ +D+GGGL
Sbjct: 181 VYAEAARLPGLQVVGIDVHIGSQLTELEPFEQAFQKIADLTQTLRAQGHDIRRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP   DY ++I +  G+L C+I +EPGR +  + G+LV  VI +K+  D+
Sbjct: 241 GIPYTRSNEAPPLPLDYGAMIQRTLGHLGCEIEIEPGRLISGNAGVLVAGVIYVKQGEDR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVN-PAGDRLHIHADIVGPICETGDFIALNRKIA 358
            F+ILD AMND  RP++Y A+H+I  +   P G  +  + D+VGP+CETGD  A  R + 
Sbjct: 301 DFLILDAAMNDLARPSMYGAHHDILPVTEAPPGTEMQPY-DVVGPVCETGDSFAKGRALP 359

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
               GDL+     GAYGAV +  YNSR LIPE++V G  + +IR R TF E++  D+IP 
Sbjct: 360 PLAEGDLVAFRSAGAYGAVMASEYNSRPLIPEVLVQGDHYAVIRARPTFDEILNRDTIPE 419

Query: 419 WL 420
           WL
Sbjct: 420 WL 421


>gi|163738911|ref|ZP_02146324.1| diaminopimelate decarboxylase [Phaeobacter gallaeciensis BS107]
 gi|161387716|gb|EDQ12072.1| diaminopimelate decarboxylase [Phaeobacter gallaeciensis BS107]
          Length = 421

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 212/421 (50%), Positives = 295/421 (70%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+L+AE+V + ++A  V TPFY YST  + +++  F +A  GMD +VCYA+K
Sbjct: 1   MDHFLYRDGALYAEDVPVAEIAATVGTPFYLYSTATLLRHFNLFDDALKGMDHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SNQA++KTLA  G+G+D+VS+GE  RA AA VP +RIVFSGVGKT DEI  AL  GI 
Sbjct: 61  AASNQAILKTLAQAGAGMDVVSQGEYLRAKAAGVPGDRIVFSGVGKTQDEIRTALSGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E+  +N  A+ LG  API  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMDVINAVALELGVVAPITVRVNPDVDAKTHAKIATGKSENKFGIPIARARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A++LPG+K+ G+D+HIGSQ+ ++  F  A++ + +LT+QLR++GH+I  +D+GGGL
Sbjct: 181 VYARAASLPGLKVIGIDVHIGSQLTELAPFELAYQKVAELTEQLRADGHDIHRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP   +Y +++ +  G+L C+I +EPGR +  + GI+V+KVI +K   D+
Sbjct: 241 GIPYTRSNDTPPLPVEYGAMVQRTLGHLGCEIEIEPGRLIAGNAGIMVSKVIYVKSGEDR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+I+D AMND +RP +Y+AYH+I  ++ P+        DIVGP+CETGD  A +R +  
Sbjct: 301 DFLIIDGAMNDLIRPAMYEAYHDIVPVIEPSAGVEQRAYDIVGPVCETGDTFARHRDMPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV +  YNSR LIPE++VNG QF +IR R  F E+I  D+IP W
Sbjct: 361 LEAGDLVAFRSAGAYGAVMASEYNSRPLIPEVLVNGDQFAVIRRRPDFDEMINRDTIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|259415035|ref|ZP_05738957.1| diaminopimelate decarboxylase [Silicibacter sp. TrichCH4B]
 gi|259348945|gb|EEW60699.1| diaminopimelate decarboxylase [Silicibacter sp. TrichCH4B]
          Length = 421

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 212/421 (50%), Positives = 295/421 (70%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+LHAE+V + ++A  V TPFY YST  + +++  F  A +G D +VCYA+K
Sbjct: 1   MDHFLYRDGALHAEDVPVAEIAATVGTPFYVYSTATLLRHFRLFDEALEGTDHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SNQA++KTLA  G+G+D+VSEGE RRA AA VP ++IVFSGVGKT DEI  AL  GI 
Sbjct: 61  AASNQAILKTLAAAGAGMDVVSEGEYRRAKAAGVPGDKIVFSGVGKTADEIRCALSGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E++ +N  A+ LG  API  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMEVINAVALELGTTAPITVRVNPDVDAKTHAKIATGKSENKFGIPIARARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A++LPG+++ G+D+HIGSQ+ ++  F  A++ + +LTQ LR +GH+I+ +D+GGGL
Sbjct: 181 VYAHAASLPGLEVIGIDVHIGSQLTELAPFRLAYQKVAELTQALRDDGHDIRRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP   +Y  +I +  G+L C+I +EPGR +  + G++V+KVI +K+   +
Sbjct: 241 GIPYTRSNEAPPLPVEYGQMIKEELGHLGCEIEIEPGRLVAGNAGVMVSKVIYVKEGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP +Y+AYH+I  +V P         DIVGP+CE+GD  A  R++  
Sbjct: 301 DFLILDGAMNDLIRPAMYEAYHDIIPVVEPTPGLEPKPYDIVGPVCESGDTFAKQRQMPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV +  YNSR LIPE++V+G QF +IR R TF E+I  D+IP W
Sbjct: 361 LGAGDLVAFRSAGAYGAVMASEYNSRPLIPEVLVHGDQFAVIRQRPTFDEMINRDTIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|319409426|emb|CBI83072.1| Diaminopimelate decarboxylase [Bartonella schoenbuchensis R1]
          Length = 424

 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 210/422 (49%), Positives = 299/422 (70%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +  L+AE +SL  LA  V TPFYCYS  A+  ++  + NAF  + +++ YA+K
Sbjct: 1   MRFFPYHQDMLYAEGLSLSTLADKVGTPFYCYSANALVTHFQDYQNAFHDIASLIAYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQA+++ LAH G+G D+VSEGELRRALA  +PA RIV++GVGKT+ EID AL   I 
Sbjct: 61  ANSNQAILRLLAHNGAGADVVSEGELRRALAVGIPAHRIVYAGVGKTVREIDFALAHDIC 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L+ RAV+L K A I+ R+ PD++A TH+KI+TGK E+KFGIP+   + 
Sbjct: 121 CFNVESEQELEQLSARAVALSKNARISLRLTPDVDAKTHQKITTGKSENKFGIPLALAYD 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A+ LPG+++ GV MHIGSQI  ++ F +AF +  D  + LR++G+ I H+D+GGGL
Sbjct: 181 AYKKAAQLPGLQVCGVAMHIGSQICDLKPFEEAFIIAADFVRHLRNDGYAITHVDIGGGL 240

Query: 241 GIAYHSDH-RPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G++Y  +    PS  DYA+L+ ++   L   +ILEPGR +V + G+L+T V+  K+   +
Sbjct: 241 GVSYGRESCLVPSPFDYAALVKKHIAPLGITVILEPGRSIVGNAGVLITSVVYFKRGKGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMNDFMRPTLYDA+H++  +     + + I+ADIVGP+CETGD++AL+R + +
Sbjct: 301 NFVIVDAAMNDFMRPTLYDAWHDVIPVKKTPLNGMMINADIVGPVCETGDYLALDRCLPV 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDLL I   GAYGAV + TYNSRLL PE++V  +++ ++RPR+ + +LI  D IP W
Sbjct: 361 LEAGDLLAITGAGAYGAVMANTYNSRLLAPEVLVQDTRYAVVRPRLDYAQLIGFDHIPDW 420

Query: 420 LQ 421
           ++
Sbjct: 421 VE 422


>gi|149202882|ref|ZP_01879853.1| diaminopimelate decarboxylase [Roseovarius sp. TM1035]
 gi|149143428|gb|EDM31464.1| diaminopimelate decarboxylase [Roseovarius sp. TM1035]
          Length = 421

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 214/421 (50%), Positives = 291/421 (69%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G LHAE+V L ++A  V TPFYCYST  + +++  F  A  GMD +VCYA+K
Sbjct: 1   MDHFLYHNGVLHAEDVPLSEIAEAVGTPFYCYSTATLSRHFRLFDEALAGMDHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SNQA++KTLA LG+G+D+VS GE  RA AA VP ERIVFSGVGKT DE+ +AL  GI 
Sbjct: 61  AASNQAILKTLAGLGAGMDVVSGGEYARARAAGVPGERIVFSGVGKTRDEMRMALIGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E+  LN  A+ LG +API  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMAVLNAVALELGLRAPITIRVNPDVDAKTHAKIATGKSENKFGIPIARARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+++ G+D+HIGSQ+ ++  F  A++ + +LTQ LR++GH+I+ +D+GGGL
Sbjct: 181 VYAQAAALPGLEVIGIDVHIGSQLTELAPFRLAYEKVAELTQVLRADGHDIRRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP  ++Y +LI +  G+L C+I +EPGR +  + GILV++VI +K    +
Sbjct: 241 GIPYTRSNEAPPLPTEYGALIREVLGHLGCEIEIEPGRLIAGNAGILVSQVIYVKSGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP +YDA+H+I  +   A        D+VGP+CE+GD  A  R +  
Sbjct: 301 DFLILDAAMNDLIRPAMYDAHHDIVPLHEAAPGVEQRPYDVVGPVCESGDTFAKGRMLPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV S  YN+R L+PE++V+G  F +IR R TF E+I  D+IP W
Sbjct: 361 LAEGDLVAFRSAGAYGAVMSSEYNTRPLVPEVLVHGRDFAVIRGRPTFDEMINRDTIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|254461301|ref|ZP_05074717.1| diaminopimelate decarboxylase [Rhodobacterales bacterium HTCC2083]
 gi|206677890|gb|EDZ42377.1| diaminopimelate decarboxylase [Rhodobacteraceae bacterium HTCC2083]
          Length = 433

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 212/421 (50%), Positives = 296/421 (70%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+LHAE+V L ++A  V TPFY YST  +E+++  F +A +G + +VCYA+K
Sbjct: 13  MDHFLYRDGALHAEDVPLSEIAASVGTPFYVYSTATLERHFKLFDDALEGTEHLVCYAMK 72

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SNQA++KTLA LG+G+D+VS GE  RA AA VP ERIVFSG+GKT  E+  AL  GI 
Sbjct: 73  AASNQAILKTLAALGAGMDVVSGGEYARAKAAGVPGERIVFSGIGKTRAEVHQALTGGIR 132

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E++ +++ A +L   API  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 133 QFNVESEPEMQVISEIATALDVIAPITIRVNPDVDAKTHAKIATGKSENKFGIPISRARE 192

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A++LPG+K+ G+D+HIGSQ+  +  F  A+  + +LT+QLR++GH I  +D+GGGL
Sbjct: 193 VYALAASLPGLKVIGIDVHIGSQLIDLAPFEAAYNKVAELTEQLRADGHEISRLDLGGGL 252

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PPS +DY +LI +  G+L C+I +EPGR +  + G+LV++VI +K   D+
Sbjct: 253 GIPYARSNEAPPSPTDYGALIKKCVGHLGCEIEIEPGRLIAGNAGLLVSEVIYVKSGEDR 312

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+I+D AMND +RP +YDA+H+I  +V      L    DIVGP+CE+GD  A  R++  
Sbjct: 313 EFLIIDGAMNDLIRPAMYDAHHDIVPVVESEVGVLPTPYDIVGPVCESGDTFAKGRQMPP 372

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + G+L+     GAYGAV +  YN+R LIPE++V G QF +IRPR TF E+I  D+IP W
Sbjct: 373 LKAGNLVAFRSAGAYGAVMASEYNTRPLIPEVLVKGDQFAVIRPRPTFDEMINRDTIPEW 432

Query: 420 L 420
           L
Sbjct: 433 L 433


>gi|149913117|ref|ZP_01901651.1| diaminopimelate decarboxylase [Roseobacter sp. AzwK-3b]
 gi|149813523|gb|EDM73349.1| diaminopimelate decarboxylase [Roseobacter sp. AzwK-3b]
          Length = 421

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 212/421 (50%), Positives = 291/421 (69%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G L+AE+V + ++A  V TPFYCYST  + +++  F  A  G + ++CYA+K
Sbjct: 1   MDHFLYRNGELYAEDVPVAEIAAQVGTPFYCYSTATLTRHFRLFDEALAGTEHLICYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SN A++KTLA LG+G+D+VS GE  RA AA VP ERIVFSGVGKT DE+ +AL+ GI 
Sbjct: 61  AASNLAILKTLAELGAGMDVVSGGEYARAKAAGVPGERIVFSGVGKTRDEMRMALEGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E+  LN+ A+SLG +API  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMAALNEVALSLGLRAPITVRVNPDVDAKTHAKIATGKSENKFGIPIARARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ +PG+++ G+D+HIGSQ+ ++E F  A++ + DLT+ LR++GH+I+ +D+GGGL
Sbjct: 181 IYAEAAAMPGLEVVGIDVHIGSQLTELEPFRLAYEKVADLTEALRADGHDIRRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP   DY  LI    G+L C+I +EPGR +V + GILV++VI +K    +
Sbjct: 241 GIPYTRSNEAPPLPVDYGQLIKDTVGHLGCEIEIEPGRLVVGNAGILVSEVIYLKAGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP +YDAYH+I  +  P         DIVGP+CE+GD  A  R +  
Sbjct: 301 DFLILDAAMNDLIRPAMYDAYHDIVPVREPQPGAEQAAYDIVGPVCESGDTFAKARMMPA 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV +  YN+R L+PE++V+  QF +IR R TF E+I  D+IP W
Sbjct: 361 LAQGDLVAFRSAGAYGAVMASEYNTRPLVPEVLVHEHQFAVIRARPTFDEIINRDTIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|83953467|ref|ZP_00962189.1| diaminopimelate decarboxylase [Sulfitobacter sp. NAS-14.1]
 gi|83842435|gb|EAP81603.1| diaminopimelate decarboxylase [Sulfitobacter sp. NAS-14.1]
          Length = 421

 Score =  445 bits (1144), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 208/421 (49%), Positives = 295/421 (70%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+L AE+V++ ++A  V TPFY YST  + +++  F +A DGMD +VCYA+K
Sbjct: 1   MDHFLYRDGALFAEDVAISEIAAAVGTPFYVYSTATLLRHFKAFDDALDGMDHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTLA  G+G+D+VS GE  RA AA VP ++IVFSGVGKT+ EI LAL+ GI 
Sbjct: 61  ANSNQAVLKTLAQAGAGMDVVSAGEYLRAKAAGVPGDKIVFSGVGKTVSEIRLALEGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E++ L+  A S+GK API  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMEVLDAVARSMGKVAPITIRVNPDVDAKTHAKIATGKSENKFGIPIARARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ +PG+++ G+D+HIGSQ+  +  F  A++ + +LT+QLR++GH I+ +D+GGGL
Sbjct: 181 VYRMAAAMPGLEVVGIDVHIGSQLTDLTPFELAYQKVAELTEQLRADGHTIRRLDLGGGL 240

Query: 241 GIAYH-SDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP  +DY +++ +  G+L C+I +EPGR +  + G++V++VI +K    +
Sbjct: 241 GIPYERSNAAPPLPTDYGAMVQKTLGHLGCEIEIEPGRLIAGNAGLMVSEVIYVKSGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+I+D AMND +RP +Y+A+H+I  +V           DIVGP+CE+GD  A  R +  
Sbjct: 301 DFLIIDGAMNDLIRPAMYEAHHDIIPVVEAEAGAEQQPYDIVGPVCESGDTFAKQRMMPK 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV +  YNSR LIPE++V+G QF +IR R TF E+I  D+IP W
Sbjct: 361 LVAGDLVAFRSAGAYGAVMASEYNSRALIPEVLVHGDQFAVIRRRPTFDEMINRDTIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|159045599|ref|YP_001534393.1| diaminopimelate decarboxylase [Dinoroseobacter shibae DFL 12]
 gi|157913359|gb|ABV94792.1| diaminopimelate decarboxylase [Dinoroseobacter shibae DFL 12]
          Length = 431

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 210/425 (49%), Positives = 294/425 (69%), Gaps = 1/425 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE+V +  +A  V TPFY YST  + +++  F  A      +VC+A+K
Sbjct: 1   MDHFTYIKGQLHAEDVPVSAIADAVGTPFYVYSTATLTRHFKLFDEALSWGPHLVCFAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSNQA++K LA LG+G+D+VS GE  RA AA VP +RIVFSGVGKT DE+ +AL  GI 
Sbjct: 61  SNSNQAILKLLADLGAGMDVVSGGEYARARAAGVPGDRIVFSGVGKTADEMRMALTGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E++ L+  A  LG +API  RVNPD++A TH+KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMQRLSAVAQGLGMQAPITIRVNPDVDAKTHEKIATGKSENKFGIPISRARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+K+ G+D+HIGSQ+ ++E F  A+  + +LT+ LR++GH I  +D+GGGL
Sbjct: 181 VYAQAARLPGIKVIGIDVHIGSQLTELEPFELAYAKVAELTRHLRADGHEITRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  ++  PP  +DY +LI +  G+L C+I +EPGR +  + G+LV++VI +K+  D+
Sbjct: 241 GIPYARTNEAPPLPTDYGALIQRTVGDLGCEIEIEPGRLISGNAGLLVSEVIYVKQGEDR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP++Y AYH+I  +   A        DIVGP+CE+GD  A +R++  
Sbjct: 301 QFLILDAAMNDLIRPSMYGAYHDIVPVREAAPGTPTTPYDIVGPVCESGDTFAKSREMVP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV +  YN+R LIPE++V+G QF +IR R +F E+I  D+IPAW
Sbjct: 361 LTEGDLVAFRSAGAYGAVMASEYNTRPLIPEVLVHGDQFAVIRQRPSFDEIINRDTIPAW 420

Query: 420 LQKTP 424
           L  TP
Sbjct: 421 LVDTP 425


>gi|294678687|ref|YP_003579302.1| diaminopimelate decarboxylase [Rhodobacter capsulatus SB 1003]
 gi|294477507|gb|ADE86895.1| diaminopimelate decarboxylase [Rhodobacter capsulatus SB 1003]
          Length = 422

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 211/422 (50%), Positives = 292/422 (69%), Gaps = 2/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G LHAE+V+L ++A  V TPFY YS   + +++  F  A  G D +VC+A+K
Sbjct: 1   MDHFLYRNGVLHAEDVALTEIAAAVGTPFYVYSAATLTRHFQLFDAALAGTDHLVCFAIK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN AV+K L  LG+G+D+VS GE RRA AA VP +RIVFSGVGKT DEI LAL  GI 
Sbjct: 61  SNSNLAVLKLLGDLGAGMDVVSGGEYRRAKAAGVPGDRIVFSGVGKTRDEIRLALTGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE EL+ +++ A +LG  APIA RVNPD++A TH+KI+TGK E+KFGIPI +  +
Sbjct: 121 QFNVESEPELRAISEIATALGVTAPIALRVNPDVDAKTHEKIATGKSENKFGIPIAKARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+++ GVD+HIGSQ+  +  F  AF  +R+LT  LR +GH I+ +D+GGGL
Sbjct: 181 VYAEAAKLPGIEVIGVDVHIGSQLTDLAPFEAAFTKVRELTLALREDGHKIRRLDLGGGL 240

Query: 241 GIAYH--SDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           GI YH  S+  PP  +DY ++I +  G+L C+I +EPGR +  + G++VT VI +K+   
Sbjct: 241 GIPYHQRSNEAPPLPTDYGAMITRVLGDLGCEIEIEPGRLISGNAGLMVTSVIYLKEGEG 300

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           + F+I+D AMND +RP++Y A+H+I  ++ PA        D+VGP+CETGD     R++ 
Sbjct: 301 RNFLIVDAAMNDLVRPSMYGAHHDIVPVIEPAPGLAPQPFDVVGPVCETGDTFTKGRELP 360

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
               GDL+     GAYGAV +  YNSR LIPE++V+G  F +IR R +F+E++  DSIP 
Sbjct: 361 PMAEGDLVAFRSAGAYGAVMASEYNSRPLIPEVLVSGDHFAVIRQRPSFEEMLARDSIPE 420

Query: 419 WL 420
           WL
Sbjct: 421 WL 422


>gi|254487951|ref|ZP_05101156.1| diaminopimelate decarboxylase [Roseobacter sp. GAI101]
 gi|214044820|gb|EEB85458.1| diaminopimelate decarboxylase [Roseobacter sp. GAI101]
          Length = 421

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 208/421 (49%), Positives = 292/421 (69%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+L AE+V++ ++A  V TPFY YST  + +++  F +A +GMD +VCYA+K
Sbjct: 1   MDHFLYRDGALFAEDVAISEIAATVGTPFYVYSTATLLRHFKAFDDALEGMDHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV++TLA  G+G+D+VS GE  RA AA VP ++IVFSGVGKT  EI LAL+ GI 
Sbjct: 61  ANSNQAVLRTLAQAGAGMDVVSAGEYLRAKAAGVPGDKIVFSGVGKTAAEIRLALEGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E++ L+  A SLGK API  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMEVLDTVARSLGKVAPITIRVNPDVDAKTHAKIATGKSENKFGIPIARARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A  + G+++ G+D+HIGSQ+  +  F +A+  + +LT+ LR++GHNI+ +D+GGGL
Sbjct: 181 VYRMAGAMAGLEVIGIDVHIGSQLTDLAPFEQAYDKVAELTEVLRADGHNIRRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP   DY +++ +  G+L C++ +EPGR +  + G+++++VI +K    +
Sbjct: 241 GIPYERSNEAPPLPRDYGAMVQRKLGHLGCEVEIEPGRLIAGNAGLMISEVIYVKSGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP +Y+A+H+I  +V PA        DIVGP+CE+GD  A  R +  
Sbjct: 301 DFLILDGAMNDLIRPAMYEAHHDIIPVVEPAPGAEQQPYDIVGPVCESGDTFAKQRMMPA 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV S  YNSR LIPE++V   QF +IRPR TF E+I  D+IP W
Sbjct: 361 LAAGDLVAFRSAGAYGAVMSSEYNSRALIPEVLVKDDQFAVIRPRPTFDEMINRDTIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|99078471|ref|YP_611729.1| diaminopimelate decarboxylase [Ruegeria sp. TM1040]
 gi|99035609|gb|ABF62467.1| diaminopimelate decarboxylase [Ruegeria sp. TM1040]
          Length = 421

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 212/421 (50%), Positives = 295/421 (70%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+L+AE+V + ++A  V TPFY YST  + +++  F  A +G D +VCYA+K
Sbjct: 1   MDHFLYRDGALYAEDVPVAEIAATVGTPFYVYSTATLLRHFRLFDEALEGTDHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SNQA++KTLA  G+G+D+VSEGE RRA AA VP ++IVFSGVGKT +EI  AL  GI 
Sbjct: 61  AASNQAILKTLAAAGAGMDVVSEGEYRRAKAAGVPGDKIVFSGVGKTAEEIRTALTGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E+  +N  A+ LG  API  RVNPD++A TH KI+TGK E+KFGIPI +  +
Sbjct: 121 QFNVESEPEMDVINAVALELGVTAPITVRVNPDVDAKTHAKIATGKSENKFGIPIAKARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A++LPG+++ G+D+HIGSQ+  +E F  A++ + +LTQ LR++GH+I+ +D+GGGL
Sbjct: 181 VYAHAASLPGLEVIGIDVHIGSQLTDLEPFRLAYQKVAELTQALRADGHDIRRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP   +Y  +I +  G+L C+I +EPGR +  + G++V+KVI IK+   +
Sbjct: 241 GIPYTRSNEAPPLPVEYGQMIKEELGHLGCEIEIEPGRLVAGNAGLMVSKVIYIKEGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP +Y+A+H+I  +V P         DIVGP+CE+GD  A  R +  
Sbjct: 301 DFLILDGAMNDLIRPAMYEAHHDIIPVVEPTPGLEPQPYDIVGPVCESGDTFAKQRLMPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV S  YNSR LIPE++V+G QF +IR R TF E+I  D+IP W
Sbjct: 361 LAAGDLVAFRSAGAYGAVMSSEYNSRPLIPEVLVHGDQFAVIRQRPTFDEMINRDTIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|83944426|ref|ZP_00956880.1| diaminopimelate decarboxylase [Sulfitobacter sp. EE-36]
 gi|83844749|gb|EAP82632.1| diaminopimelate decarboxylase [Sulfitobacter sp. EE-36]
          Length = 421

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 207/421 (49%), Positives = 294/421 (69%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+L AE+V++ ++A  V TPFY YST  + +++  F +A DGMD +VCYA+K
Sbjct: 1   MDHFLYRDGALLAEDVAISEIAAAVGTPFYVYSTATLLRHFKAFDDALDGMDHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTLA  G+G+D+VS GE  RA AA VP ++IVFSGVGKT+ EI LAL+ GI 
Sbjct: 61  ANSNQAVLKTLAQAGAGMDVVSAGEYLRAKAAGVPGDKIVFSGVGKTVSEIRLALEGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E++ L+  A S+ K API  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMEVLDAVARSMDKVAPITIRVNPDVDAKTHAKIATGKSENKFGIPIARARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ +PG+++ G+D+HIGSQ+  +  F  A++ + +LT+QLR++GH I+ +D+GGGL
Sbjct: 181 VYRMAAAMPGLEVVGIDVHIGSQLTDLTPFELAYQKVAELTEQLRADGHTIRRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP  +DY +++ +  G+L C+I +EPGR +  + G++V++VI +K    +
Sbjct: 241 GIPYERSNAAPPLPTDYGAMVQKTLGHLGCEIEIEPGRLIAGNAGLMVSEVIYVKSGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+I+D AMND +RP +Y+A+H+I  +V           DIVGP+CE+GD  A  R +  
Sbjct: 301 DFLIIDGAMNDLIRPAMYEAHHDIIPVVEAEAGAEQQPYDIVGPVCESGDTFAKQRMMPK 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV +  YNSR LIPE++V+G QF +IR R TF E+I  D+IP W
Sbjct: 361 LAAGDLVAFRSAGAYGAVMASEYNSRALIPEVLVHGDQFAVIRRRPTFDEMINRDTIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|126734685|ref|ZP_01750431.1| diaminopimelate decarboxylase [Roseobacter sp. CCS2]
 gi|126715240|gb|EBA12105.1| diaminopimelate decarboxylase [Roseobacter sp. CCS2]
          Length = 422

 Score =  442 bits (1136), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 206/421 (48%), Positives = 294/421 (69%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y + +L+AE+V + ++A  V TPFY YST  +++++  F  A D  D +VC+A+K
Sbjct: 1   MDHFLYRDSALYAEDVPVAEIAAAVGTPFYVYSTATLKRHFTLFDEALDWGDHLVCFAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SNQAVIK L + G+G+D+VS GE  RA AA VP +RIVFSGVGKT DE+ LA++ GI 
Sbjct: 61  SLSNQAVIKLLGNAGAGMDVVSGGEYLRAKAAGVPGDRIVFSGVGKTADEMRLAIEGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E+  L++ A SL    PI  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMIVLDRVAQSLDAVVPITIRVNPDVDAKTHAKIATGKSENKFGIPISRARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A  +PG+K+ G+D+HIGSQ+ ++  F  A+  + +LT+QLR++GH I+ +D+GGGL
Sbjct: 181 VYAMAGAMPGLKVVGIDVHIGSQLTELAPFEAAYNKVAELTEQLRADGHEIKRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP  +DY +LI +  G+L C+I +EPGR +  + G++V+KVI +K   D+
Sbjct: 241 GIPYARSNEAPPLPTDYGALIQRTVGHLGCEIEIEPGRLISGNAGLMVSKVIYVKSGEDR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP +Y+A+H+I  +V PA   +    DIVGP+CE+GD  A  R++  
Sbjct: 301 EFLILDGAMNDLIRPAMYEAWHDIVPVVEPAPGAVPAKYDIVGPVCESGDTFAKGREMPA 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            +  DL+     GAYGAV S  YNSR +IPE++V+G QF +IRPR T++E+I  D++P W
Sbjct: 361 VKADDLVAFRSAGAYGAVMSSEYNSRPMIPEVLVDGDQFAVIRPRPTYEEMIARDTLPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|154252052|ref|YP_001412876.1| diaminopimelate decarboxylase [Parvibaculum lavamentivorans DS-1]
 gi|154156002|gb|ABS63219.1| diaminopimelate decarboxylase [Parvibaculum lavamentivorans DS-1]
          Length = 422

 Score =  441 bits (1135), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 212/422 (50%), Positives = 296/422 (70%), Gaps = 1/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y +G LHAE+V++  +A  + TPFYCYS+  +E++Y  F+ AF G    VCY++K
Sbjct: 1   MHHFEYRDGVLHAEDVAISDIAAAIGTPFYCYSSATLERHYEVFAGAFKGQPARVCYSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AVI TLA LG+G D+VSEGELRRALAA +PAE+IVFSGVGKT  E+  AL++GI 
Sbjct: 61  ANSNLAVIATLARLGAGADVVSEGELRRALAAGIPAEKIVFSGVGKTEAEMAFALETGID 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE EL+ L + A + G  A +A RVNPD++A TH+KI+TGK E+KFGI   +  +
Sbjct: 121 QFNVESEPELELLAELAAARGLTAQVAIRVNPDVDAKTHEKIATGKAENKFGISWKRAPA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A  L GVK  G+D+HIGSQ+  +E F  AF+ +  + + LR+ GH I HID+GGGL
Sbjct: 181 VYARARELKGVKACGIDVHIGSQLTALEPFAAAFERVAGMVEALRAEGHEITHIDLGGGL 240

Query: 241 GIAYHSDHR-PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+  PP   +YA+++ +  G+L C++  EPGR +  + GILV++VI  K+  D+
Sbjct: 241 GIPYRGDNDVPPHPDEYAAMVKRTIGHLGCELTFEPGRLIAGNAGILVSRVIYEKQGDDR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+I+D AMND +RPTLYDA+H+I  +  PA     +  D+VGP+CETGDF A  R++  
Sbjct: 301 AFLIVDAAMNDLIRPTLYDAFHDIRPVTEPAEGAARVSYDVVGPVCETGDFFAKARELPR 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + GDL+ I   GAY AVQ+ TYN+R L+PE+MV G+ F  +R R ++  +++ D IP+W
Sbjct: 361 LKSGDLVAIMSAGAYSAVQASTYNTRPLVPEVMVKGATFQEVRARPSYDAMLKQDIIPSW 420

Query: 420 LQ 421
           L+
Sbjct: 421 LE 422


>gi|23015819|ref|ZP_00055585.1| COG0019: Diaminopimelate decarboxylase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 424

 Score =  441 bits (1135), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 208/423 (49%), Positives = 287/423 (67%), Gaps = 3/423 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFD--GMDTMVCYA 58
           M+ F Y  G+L AE+V++ ++A  V TPFYCYST  +E++Y  F+ A    G+D  +C+A
Sbjct: 1   MNHFHYSNGTLFAEDVAIARIAREVGTPFYCYSTATLERHYTVFAEALKSAGLDATICFA 60

Query: 59  LKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSG 118
            KAN N AVI+T A LG+G D+VSEGELR+ALAA VPA RIVFSGVGKT  E++ A+  G
Sbjct: 61  AKANPNMAVIRTFAQLGAGADVVSEGELRQALAAGVPAARIVFSGVGKTRHELEFAVAKG 120

Query: 119 IYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQI 178
           I+  NVESE EL+ L++ A + G   PIA RVNPD++A TH KI+TGKKE+KFGI   + 
Sbjct: 121 IFQINVESEPELEMLSEVAAARGLVMPIAIRVNPDVDAGTHAKITTGKKENKFGIEWTRA 180

Query: 179 HSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGG 238
             +YA A  LPGV+   +  HIGSQ+ +++ F +AF  +RDL   LR++G +I+ +D+GG
Sbjct: 181 REVYARAKALPGVEPVSIACHIGSQLTELDPFREAFLRVRDLVAMLRADGIDIRRLDLGG 240

Query: 239 GLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           GLG+ Y  D  PP    YA +I    G+L C+ I EPGR LV + GILV+ +I +K+ + 
Sbjct: 241 GLGVPY-DDETPPEPKAYAEVIKASLGDLGCRFIFEPGRLLVGNAGILVSSIIRVKEGST 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           +TF+I+D AMND  RP+LYDAYH I  +  P         D+VGP+CETGD  A  R++ 
Sbjct: 300 RTFLIVDAAMNDLARPSLYDAYHSIFPVAEPKAGAPLAEVDVVGPVCETGDTFARQRRLP 359

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
             R GDLL +   GAYGA  S TYN+R LIPE++V G+ + +IR R +++++  L+S+P 
Sbjct: 360 PMRAGDLLALGTAGAYGAAMSSTYNTRPLIPEVLVKGADYAVIRARPSYEDMRSLESLPG 419

Query: 419 WLQ 421
           WL 
Sbjct: 420 WLS 422


>gi|288962188|ref|YP_003452483.1| diaminopimelate decarboxylase [Azospirillum sp. B510]
 gi|288914454|dbj|BAI75939.1| diaminopimelate decarboxylase [Azospirillum sp. B510]
          Length = 419

 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 213/420 (50%), Positives = 291/420 (69%), Gaps = 1/420 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           MS F Y  G LHAE+VSLE +A  V TPFY YST A+E +Y  ++ AF G D  VCYALK
Sbjct: 1   MSVFAYRNGVLHAESVSLEDVAREVGTPFYLYSTAALETHYNAYAGAFAGQDAGVCYALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AVI+TLA+LG+G D+VS GE++RALA  +PA RIVFSGVGKT +++ +AL++GI+
Sbjct: 61  ANSNLAVIRTLANLGAGGDVVSVGEMKRALAGGIPAGRIVFSGVGKTREDLRIALEAGIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
             NVES  EL+ L++ A S+  +APIA RVNPD++A TH KI+TGKKE+KFGI       
Sbjct: 121 QINVESVPELEALSEVASSMRVEAPIALRVNPDVDAKTHAKIATGKKENKFGIDYDHARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ +PGVK   + +HIGSQ+  +  F  A++ +  L  QLR +G +I  +D+GGGL
Sbjct: 181 IYRRAAAMPGVKPVAIAVHIGSQLTDLAPFRAAYERVAALLHQLREDGLDINRLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y ++  PP  +DYA+++    GNL C I LEPGR LV + GILV++VI +K+   + 
Sbjct: 241 GITYKNEA-PPDLADYAAMVRSITGNLGCSITLEPGRSLVGNAGILVSRVIYVKQGLHRR 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP+LYDAYH I  +  PA D +    D+VGP+CE+GD  A+ R +   
Sbjct: 300 FAIVDAAMNDLIRPSLYDAYHGIVPVAEPAADAVQEPYDVVGPVCESGDTFAVQRPLPPL 359

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
              +L+     GAYGAV + TYNSR L+PE++VNG +F +IRPR T +E++  + +P WL
Sbjct: 360 ADDELVAFLSAGAYGAVMASTYNSRPLVPEVLVNGDRFAVIRPRPTVEEMLAAERVPDWL 419


>gi|146278482|ref|YP_001168641.1| diaminopimelate decarboxylase [Rhodobacter sphaeroides ATCC 17025]
 gi|145556723|gb|ABP71336.1| diaminopimelate decarboxylase [Rhodobacter sphaeroides ATCC 17025]
          Length = 421

 Score =  439 bits (1128), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 212/421 (50%), Positives = 288/421 (68%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  GSLHAE V L  +A  V TPFYCYS   +E++Y  F+ A   +  MVC+A+K
Sbjct: 1   MDHFLYRNGSLHAEEVPLADIAATVGTPFYCYSAATLERHYRLFTEALTPLPHMVCFAIK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN AV+K L  LG+G+D+VS GE  RA AA VP ERIVFSGVGKT +E+ LAL+ GI 
Sbjct: 61  SLSNLAVLKLLGDLGAGMDVVSGGEYLRARAAGVPGERIVFSGVGKTREEMRLALEGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E++ L++ A S+  +APIA RVNPD++A TH+KI+TGKKE+KFGIPI +   
Sbjct: 121 QFNVESEPEMRALSEVAASMDLRAPIAVRVNPDVDARTHEKIATGKKENKFGIPIARASE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+++ G+D+HIGSQ+  +E F +A+  + DLT +LR+ GH I+ +D+GGGL
Sbjct: 181 VYAEAAALPGLEVVGIDVHIGSQLTDLEPFEQAYLKVADLTGRLRAEGHEIRRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP  +DY +LI +  G+L C+I +EPGR +  + G+LV++VI +K    +
Sbjct: 241 GIPYTRSNEAPPLPTDYGALIKRTVGHLGCEIEIEPGRLISGNSGVLVSRVIYVKNGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP++Y A+H+I  +   A        D+VGPICETGD  A  R +  
Sbjct: 301 DFLILDAAMNDLVRPSMYGAHHDIVPVAEAAPGTEGQPYDVVGPICETGDTFAKARPLPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV +  YNSR L+PE++V G  F +IR R TF E++  DSIP W
Sbjct: 361 MSEGDLVAFRSAGAYGAVMASEYNSRPLVPEVLVRGDHFAVIRARPTFDEMLRRDSIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|254454697|ref|ZP_05068134.1| diaminopimelate decarboxylase [Octadecabacter antarcticus 238]
 gi|198269103|gb|EDY93373.1| diaminopimelate decarboxylase [Octadecabacter antarcticus 238]
          Length = 421

 Score =  438 bits (1126), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 210/421 (49%), Positives = 292/421 (69%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G L AE+V++ ++A  V TPFY YST  + +++  F +A  GMD +VC+A+K
Sbjct: 1   MDHFLYRDGQLMAEDVNIAEIAAQVGTPFYVYSTATLLRHFKLFDDALSGMDHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN AV+K L   G+G+D+VS GE  RA AA V  ++IVFSG+GKT +E+ LAL+ GI 
Sbjct: 61  SLSNVAVLKLLGDAGAGMDVVSGGEYLRAKAAGVSGDKIVFSGIGKTREEMRLALEGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E++ L+Q A+SL   API  RVNPD++A TH KISTGKKEDKFGIPI +   
Sbjct: 121 QFNVESEPEMEALSQVALSLNTVAPITVRVNPDVDAKTHAKISTGKKEDKFGIPISRARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+K+ G+D+HIGSQ+ ++E F  A++ + +LT+QLRS+GH+I  +D+GGGL
Sbjct: 181 VYAMAAKLPGLKVIGIDVHIGSQLTELEPFRLAYRKVAELTEQLRSDGHDITRLDLGGGL 240

Query: 241 GIAYHSDHR-PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+  PP   +Y +LI +  G+L C+I +EPGR +  + G+LV KVI +K   D+
Sbjct: 241 GIPYARDNNAPPLPREYGALIKEEVGHLGCEIEIEPGRLISGNAGLLVAKVIYVKSGEDR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+I+D AMND +RP +YDA+H+I  ++ PA        D+VGPICE+GD  A  R +  
Sbjct: 301 EFLIVDAAMNDLVRPAMYDAWHDIVPVIEPAAGVDQTPYDVVGPICESGDTFAKGRMLPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
             P  L+     GAY AV S  YNSR LIPE++VNG QF +IR R TF+++I  D+IP W
Sbjct: 361 LDPEALVGFRSAGAYSAVMSSEYNSRPLIPEVLVNGDQFAVIRRRPTFEDMINRDTIPEW 420

Query: 420 L 420
           +
Sbjct: 421 M 421


>gi|221640187|ref|YP_002526449.1| diaminopimelate decarboxylase [Rhodobacter sphaeroides KD131]
 gi|221160968|gb|ACM01948.1| Diaminopimelate decarboxylase [Rhodobacter sphaeroides KD131]
          Length = 435

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 209/421 (49%), Positives = 290/421 (68%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  GSLHAE V L  +A  V TPFYCYS   +E++Y  F+ A   +  +VC+A+K
Sbjct: 15  MDHFLYRNGSLHAEEVPLSDIAATVGTPFYCYSAATLERHYRLFTEALTPLPHLVCFAIK 74

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN AV+K L  LG+G+D+VS GE  RA AA VP +RIVFSGVGKT +E+ +AL+ GI 
Sbjct: 75  SLSNLAVLKLLGDLGAGMDVVSAGEYLRARAAGVPGDRIVFSGVGKTREEMRIALEGGIR 134

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E++ L++ A S+G +APIA RVNPD++A TH+KI+TGKKE+KFGIPI +   
Sbjct: 135 QFNVESEPEMRALSEVASSMGLRAPIAVRVNPDVDARTHEKIATGKKENKFGIPIERASE 194

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+++ GVD+HIGSQ+ ++E F +A+  + +LT +LR+ GH I+ +D+GGGL
Sbjct: 195 VYAEAAALPGLEVMGVDVHIGSQLTELEPFEQAYLKVAELTGRLRAEGHEIRRLDLGGGL 254

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP  +DY +LI +  G+L C+I +EPGR +  + G+LV++VI +K    +
Sbjct: 255 GIPYTRSNEAPPLPTDYGALIKRTVGHLGCEIEIEPGRLISGNSGVLVSRVIYVKNGEGR 314

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP++Y A+H+I  +   A        D+VGP+CETGD  A  R +  
Sbjct: 315 DFLILDAAMNDLVRPSMYGAHHDIVPLAEAAPGTESQPYDVVGPVCETGDTFAKARALPP 374

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV +  YNSR L+PE++V G  F +IR R TF E++  DSIP W
Sbjct: 375 MAEGDLVAFRSAGAYGAVMASEYNSRPLVPEVLVRGDHFAVIRARPTFDEMLGRDSIPEW 434

Query: 420 L 420
           L
Sbjct: 435 L 435


>gi|254464493|ref|ZP_05077904.1| diaminopimelate decarboxylase [Rhodobacterales bacterium Y4I]
 gi|206685401|gb|EDZ45883.1| diaminopimelate decarboxylase [Rhodobacterales bacterium Y4I]
          Length = 421

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 207/421 (49%), Positives = 290/421 (68%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+L AE+V L ++A  V TPFY YST  + +++  F  A +G D +VC+A+K
Sbjct: 1   MDHFLYRDGALFAEDVPLSEIAAAVGTPFYVYSTATLLRHFRLFDEALEGTDHLVCFAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SNQA++KTLA  G+G+D+VS+GE  RA AA VP +RIVFSGVGKT +EI +AL  GI 
Sbjct: 61  AASNQAILKTLAQAGAGMDVVSQGEYLRARAAGVPGDRIVFSGVGKTAEEIRVALTGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E++ ++  A  LG KAPI  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMEVISAVAEELGAKAPITIRVNPDVDAKTHAKIATGKSENKFGIPIARARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+++ G+D+HIGSQ+  +E F  A++ + +LT+ LR++GH+I+ +D+GGGL
Sbjct: 181 VYARAAALPGLEVVGIDVHIGSQLTDLEPFRLAYQKVAELTETLRADGHDIRRLDLGGGL 240

Query: 241 GIAYH-SDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP   +Y +++ +  G+L C+I +EPGR +  + G LV+KVI +K    +
Sbjct: 241 GIPYERSNSAPPLPVEYGAMVKETLGHLGCEIEIEPGRLIAGNAGQLVSKVIYVKSGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVILD AMND +RP +Y+A+H+I  +  P         DIVGP+CETGD  A  R +  
Sbjct: 301 DFVILDAAMNDLIRPAMYEAHHDIIPVQEPEAGTESRPYDIVGPVCETGDTFAKQRDLPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV +  YNSR LIPE++V+G QF +IR R  ++E+I  D+IP W
Sbjct: 361 LAAGDLVSFRSAGAYGAVMASEYNSRPLIPEVLVHGDQFAVIRRRPDYEEMINRDTIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|77464302|ref|YP_353806.1| diaminopimelate decarboxylase [Rhodobacter sphaeroides 2.4.1]
 gi|332559193|ref|ZP_08413515.1| diaminopimelate decarboxylase [Rhodobacter sphaeroides WS8N]
 gi|77388720|gb|ABA79905.1| diaminopimelate decarboxylase [Rhodobacter sphaeroides 2.4.1]
 gi|332276905|gb|EGJ22220.1| diaminopimelate decarboxylase [Rhodobacter sphaeroides WS8N]
          Length = 421

 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/421 (49%), Positives = 290/421 (68%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  GSLHAE V L  +A  V TPFYCYS   +E++Y  F+ A   +  +VC+A+K
Sbjct: 1   MDHFLYRNGSLHAEEVPLSDIAATVGTPFYCYSAATLERHYRLFTEALTPLPHLVCFAIK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN AV+K L  LG+G+D+VS GE  RA AA VP +RIVFSGVGKT +E+ +AL+ GI 
Sbjct: 61  SLSNLAVLKLLGDLGAGMDVVSAGEYLRARAAGVPGDRIVFSGVGKTREEMRIALEGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E++ L++ A S+G +APIA RVNPD++A TH+KI+TGKKE+KFGIPI +   
Sbjct: 121 QFNVESEPEMRALSEVASSMGLRAPIAVRVNPDVDARTHEKIATGKKENKFGIPIERASE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+++ G+D+HIGSQ+ ++E F +A+  + +LT +LR+ GH I+ +D+GGGL
Sbjct: 181 VYAEAAALPGLEVMGIDVHIGSQLTELEPFEQAYLKVAELTGRLRAEGHEIRRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP  +DY +LI +  G+L C+I +EPGR +  + G+LV++VI +K    +
Sbjct: 241 GIPYTRSNEAPPLPTDYGALIKRTVGHLGCEIEIEPGRLISGNSGVLVSRVIYVKNGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP++Y A+H+I  +   A        D+VGP+CETGD  A  R +  
Sbjct: 301 DFLILDAAMNDLVRPSMYGAHHDIVPLAEAAPGTESQPYDVVGPVCETGDTFAKARALPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV +  YNSR L+PE++V G  F +IR R TF E++  DSIP W
Sbjct: 361 MAEGDLVAFRSAGAYGAVMASEYNSRPLVPEVLVRGDHFAVIRARPTFDEMLGRDSIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|83313590|ref|YP_423854.1| diaminopimelate decarboxylase [Magnetospirillum magneticum AMB-1]
 gi|82948431|dbj|BAE53295.1| Diaminopimelate decarboxylase [Magnetospirillum magneticum AMB-1]
          Length = 424

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 205/422 (48%), Positives = 285/422 (67%), Gaps = 3/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFD--GMDTMVCYA 58
           M+ F Y  G L AE+V++ ++A  V TPFYCYST  ++++Y  F+ A    G+D  +C+A
Sbjct: 1   MNHFHYQNGELFAEDVAIARIAREVGTPFYCYSTATLQRHYTVFAEALKAAGLDATICFA 60

Query: 59  LKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSG 118
            KAN N AVI+T A LG+G D+VSEGELR+ALAA VPA RIVFSGVGKT  E++ A+  G
Sbjct: 61  AKANPNMAVIRTFAQLGAGADVVSEGELRQALAAGVPAARIVFSGVGKTRHELEFAVAKG 120

Query: 119 IYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQI 178
           I+  NVESE EL+ L++ A + G+  PIA RVNPD++A TH KI+TGKKE+KFGI   + 
Sbjct: 121 IFQINVESEPELEMLSEIAAARGQVMPIAIRVNPDVDAGTHAKITTGKKENKFGIEWTRA 180

Query: 179 HSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGG 238
             +YA A  LPGV+   +  HIGSQ+ ++  F +AF  +RDL   LR++G +I+ +D+GG
Sbjct: 181 REVYARAKALPGVEPVAIACHIGSQLTELTPFREAFLRVRDLVAMLRADGIDIRRLDLGG 240

Query: 239 GLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           GLG+ Y  D  PP  + YA +I    G+L C+ + EPGR LV + GILV+++I +K+ + 
Sbjct: 241 GLGVPY-DDETPPEPAAYAEVIKATLGDLGCRFVFEPGRLLVGNAGILVSRIIRVKEGST 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           +TF+I+D AMND  RP+LYDAYH I  +  P         D+VGP+CETGD  A  R++ 
Sbjct: 300 RTFLIVDAAMNDLARPSLYDAYHSIFPVAEPKAGAALAEVDVVGPVCETGDTFAKQRRLP 359

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
             R  DLL     GAYGA  S TYN+R LIPE++V G  + +IR R +++++  L+S+P 
Sbjct: 360 PMRTDDLLAFGTAGAYGAAMSSTYNTRPLIPEVLVKGGDYAVIRVRPSYEDMRSLESLPG 419

Query: 419 WL 420
           WL
Sbjct: 420 WL 421


>gi|126463144|ref|YP_001044258.1| diaminopimelate decarboxylase [Rhodobacter sphaeroides ATCC 17029]
 gi|126104808|gb|ABN77486.1| diaminopimelate decarboxylase [Rhodobacter sphaeroides ATCC 17029]
          Length = 421

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/421 (49%), Positives = 290/421 (68%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  GSLHAE V L  +A  V TPFYCYS   +E++Y  F+ A   +  +VC+A+K
Sbjct: 1   MDHFLYRNGSLHAEEVPLSDIAATVGTPFYCYSAATLERHYRLFTEALTPLPHLVCFAIK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN AV+K L  LG+G+D+VS GE  RA AA VP +RIVFSGVGKT +E+ +AL+ GI 
Sbjct: 61  SLSNLAVLKLLGDLGAGMDVVSAGEYLRARAAGVPGDRIVFSGVGKTREEMRIALEGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E++ L++ A S+G +APIA RVNPD++A TH+KI+TGKKE+KFGIPI +   
Sbjct: 121 QFNVESEPEMRALSEVASSMGLRAPIAVRVNPDVDARTHEKIATGKKENKFGIPIERASE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+++ G+D+HIGSQ+ ++E F +A+  + +LT +LR+ GH I+ +D+GGGL
Sbjct: 181 VYAEAAALPGLEVMGIDVHIGSQLTELEPFEQAYLKVAELTGRLRAEGHEIRRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP  +DY +LI +  G+L C+I +EPGR +  + G+LV++VI +K    +
Sbjct: 241 GIPYTRSNEAPPLPTDYGALIKRTVGHLGCEIEIEPGRLISGNSGVLVSRVIYVKNGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP++Y A+H+I  +   A        D+VGP+CETGD  A  R +  
Sbjct: 301 DFLILDAAMNDLVRPSMYGAHHDIVPLAEAAPGTDSQPYDVVGPVCETGDTFAKARALPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV +  YNSR L+PE++V G  F +IR R TF E++  DSIP W
Sbjct: 361 MAEGDLVAFRSAGAYGAVMASEYNSRPLVPEVLVRGDHFAVIRARPTFDEMLGRDSIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|254438389|ref|ZP_05051883.1| diaminopimelate decarboxylase [Octadecabacter antarcticus 307]
 gi|198253835|gb|EDY78149.1| diaminopimelate decarboxylase [Octadecabacter antarcticus 307]
          Length = 421

 Score =  435 bits (1118), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 210/421 (49%), Positives = 292/421 (69%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G L AE+V++ ++A  V TPFY YST  + +++  F +A  GMD ++C+A+K
Sbjct: 1   MDHFLYRDGQLMAEDVTIAEIAAQVGTPFYVYSTATLLRHFQLFDDALAGMDHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN AV+K L   G+G+D+VS GE  RA AA V  +RIVFSG+GKT +E+ LAL  GI 
Sbjct: 61  SLSNVAVLKLLGDAGAGMDVVSGGEYLRAKAAGVSGDRIVFSGIGKTREEMRLALVGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E++ L++ A+SLGK API  RVNPD++A TH KISTGKKEDKFGIPI +   
Sbjct: 121 QFNVESEPEMEVLSEVAMSLGKIAPITVRVNPDVDAKTHAKISTGKKEDKFGIPISRARD 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+KI G+D+HIGSQ+ ++E F  A++ + +LT+QLRS+GH+I  +D+GGGL
Sbjct: 181 VYAMAAKLPGLKIIGIDVHIGSQLTELEPFRLAYRKVAELTEQLRSDGHDISRLDLGGGL 240

Query: 241 GIAYHSDHR-PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+  PP   +Y +LI +  G+L C+I +EPGR +  + G+LV KVI +K   D+
Sbjct: 241 GIPYARDNNAPPLPIEYGALIKEEVGHLGCEIEIEPGRLISGNAGLLVAKVIYVKSGEDR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+I+D AMND +RP +YDA+H+I  ++  A        D+VGPICE+GD  A  R +  
Sbjct: 301 EFLIVDAAMNDLIRPAMYDAWHDIVPVIESAAGVEQTPYDVVGPICESGDTFAKGRMLPT 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            +   L+     GAY AV S  YNSR LIPE++VNG QF +IR R TF+++I  D+IP W
Sbjct: 361 LQSEALVGFRSAGAYSAVMSSEYNSRPLIPEVLVNGDQFAVIRRRPTFEDMINRDTIPEW 420

Query: 420 L 420
           +
Sbjct: 421 M 421


>gi|84684125|ref|ZP_01012027.1| Orn/DAP/Arg decarboxylase, family 2 [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84667878|gb|EAQ14346.1| Orn/DAP/Arg decarboxylase, family 2 [Rhodobacterales bacterium
           HTCC2654]
          Length = 421

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 209/421 (49%), Positives = 283/421 (67%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE+VS+  +A  V TPFY YS   + ++Y  F  A  GMD ++CYA+K
Sbjct: 1   MDHFIYKDGVLHAEDVSITDIARSVGTPFYVYSAATLRRHYQVFDEALAGMDHLICYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+K +  LG+G D+VS GE RRALAA +P +RIVFSGVGKT DE+ LAL++GI 
Sbjct: 61  ANSNLAVVKLMGDLGAGADVVSGGEYRRALAAGIPGDRIVFSGVGKTRDEMRLALENGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE EL  LN+ A+S+   AP+  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPELLALNEVAMSMDTVAPVTIRVNPDVDAKTHAKIATGKSENKFGIPIARARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA    LPGVK  G+D+HIGSQ+  +  F  A++ + DLT  LR +GH I  +D+GGGL
Sbjct: 181 VYAEIRGLPGVKAVGIDVHIGSQLTDLAPFRAAYEKVADLTHGLREDGHEIIRLDLGGGL 240

Query: 241 GIAYH-SDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP   +Y  +I +  G+L C+I +EPGR +  + G++V+ VI +K    +
Sbjct: 241 GIPYETSNQAPPLPLEYGQVIRETVGDLGCEIEIEPGRLIAGNAGLMVSSVIYLKHGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP++YDA+H+I  ++  A        DIVGP+CETGD  A  R +  
Sbjct: 301 DFLILDSAMNDLVRPSMYDAHHDIVPVIEAAPGVEQAPHDIVGPVCETGDTFAKQRNLPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV +  YNSR LIPE++V+G  F +IR R T++E++  D+IP W
Sbjct: 361 LGAGDLVAFRSAGAYGAVMASEYNSRPLIPEVLVDGDHFAVIRARPTYEEMLARDTIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|89052972|ref|YP_508423.1| diaminopimelate decarboxylase [Jannaschia sp. CCS1]
 gi|88862521|gb|ABD53398.1| diaminopimelate decarboxylase [Jannaschia sp. CCS1]
          Length = 421

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 205/421 (48%), Positives = 285/421 (67%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G+LHAE+V +  +A  V TPFY YST  + +++  F  A  GMD ++C+A+K
Sbjct: 1   MDHFLYKNGALHAEDVPVADIAASVGTPFYVYSTATLTRHFQLFEEALGGMDHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSNQAV+  +A LG+G+D+VS GE  RA AA VP ++IVFSG+GKT DE+ LAL  GI 
Sbjct: 61  SNSNQAVLSHMAMLGAGMDVVSGGEYLRAKAAGVPGDKIVFSGIGKTEDEMRLALNGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E+  L++ A +LG   PI  RVNPD++A TH KI+TG+KEDKFGIPI +   
Sbjct: 121 QFNVESEPEMHRLSRVATALGVTVPITVRVNPDVDAKTHAKIATGRKEDKFGIPIARARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A++LPG+++ G+D+HIGSQ+  +E F  A+  + +LT+QLR +GH I  +D+GGGL
Sbjct: 181 VYALAASLPGLQVIGIDVHIGSQLTDLEPFEIAYAKVAELTEQLREDGHTITRLDLGGGL 240

Query: 241 GIAYH-SDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP   +Y  +I +  G+L C+I +EPGR +  + G+LV   I +K   D+
Sbjct: 241 GIPYERSNSAPPLPIEYGEVIKRTVGHLGCEIEIEPGRLISGNAGLLVASTIYVKHGEDR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP +Y AYH+I  +V PA        DIVGP+CE+GD  A  R +  
Sbjct: 301 DFLILDAAMNDLIRPAMYGAYHDIIPVVEPAPGAEQSPYDIVGPVCESGDTFAKQRDLPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            +  DL+     GAYGAV S  YN+R LIPE++VNG QF +IR R +F ++I  D++P W
Sbjct: 361 VKEADLIAFRSAGAYGAVMSSEYNTRPLIPEVLVNGDQFAVIRARPSFDDMINRDTLPQW 420

Query: 420 L 420
           +
Sbjct: 421 M 421


>gi|84500205|ref|ZP_00998471.1| diaminopimelate decarboxylase [Oceanicola batsensis HTCC2597]
 gi|84392139|gb|EAQ04407.1| diaminopimelate decarboxylase [Oceanicola batsensis HTCC2597]
          Length = 421

 Score =  431 bits (1109), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 206/421 (48%), Positives = 289/421 (68%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+L+AE+V + ++A  V TPFY YST  + +++  F +A  G+  +VCYA+K
Sbjct: 1   MDHFLYRDGALYAEDVPVAEIAAEVGTPFYLYSTATLTRHFQLFDDALSGLPHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SNQA+++TLA LG+G+D+VS GE  RA AA VP ERIVFSGVGKT  E+  AL  GI 
Sbjct: 61  AASNQAILRTLADLGAGMDVVSGGEYARARAAGVPGERIVFSGVGKTRVEMREALAGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FN+ESE EL+ LN+ A+S+G  AP+  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNIESEPELEALNEVALSMGVVAPVTVRVNPDVDARTHAKIATGKSENKFGIPISRARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA  + LPG++  G+D+HIGSQ+  +E + +AF+ + DLT  LR++GH+I+ +D+GGGL
Sbjct: 181 VYARIAALPGLEAIGIDVHIGSQLTDLEPYRQAFEKVGDLTDALRADGHDIRRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y   +  PP   DY  LI +  G+  C+I +EPGR +  + GI+V++VI +K    +
Sbjct: 241 GIPYTRGNEPPPLPMDYGKLIAETLGDKGCEIEIEPGRLVAGNAGIMVSRVIYVKSGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP +Y+A+H+I  +V       +   DIVGP+CE+GD  A  R +  
Sbjct: 301 DFLILDGAMNDLIRPAMYEAHHDIVPVVEAEAGIEYRPYDIVGPVCESGDTFARQRMMPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV S  YN+R LIPE++VNG QF +IRPR +F E+I  D++P W
Sbjct: 361 LEAGDLVAFRSAGAYGAVMSSEYNTRPLIPEVLVNGHQFAVIRPRPSFDEIINRDTLPPW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|310815091|ref|YP_003963055.1| diaminopimelate decarboxylase [Ketogulonicigenium vulgare Y25]
 gi|308753826|gb|ADO41755.1| diaminopimelate decarboxylase [Ketogulonicigenium vulgare Y25]
          Length = 419

 Score =  431 bits (1109), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 205/423 (48%), Positives = 294/423 (69%), Gaps = 7/423 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G L AE+VS+  +A  V TP Y YST  +++++  F +A  GM  +VC+A+K
Sbjct: 1   MDHFNYRDGVLFAEDVSVADIARAVGTPVYIYSTATLKRHFQLFDDALAGMPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+KTL  LG+G+D+VS GE  RA AA VP ERIVFSG+GKT +EI   L  GI 
Sbjct: 61  ANSNVAVLKTLGDLGAGMDVVSVGEYLRAKAAGVPGERIVFSGIGKTREEIRTTLLGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE EL+ ++  A  LG  AP+A RVNPD++A+TH KI+TGK E+KFGIPI +  +
Sbjct: 121 QFNVESEPELQAISDIASELGLIAPVAVRVNPDVDAHTHAKIATGKSENKFGIPISRAQA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A++LPG+++ G+D+HIGSQ+  +  F  A++ + +LT+ LR+ GH I  +D+GGGL
Sbjct: 181 VYAFAASLPGIQVVGIDVHIGSQLTDLAPFRAAYQKVAELTEVLRAEGHTISRLDLGGGL 240

Query: 241 GIAYHSDHR-PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+  PP  S+Y +++ +  G+L  +I +EPGR +  + G+LV++VI +K+  D+
Sbjct: 241 GIPYRRDNSAPPLPSEYGAMVRETLGHLDVEIEIEPGRLIAGNAGLLVSRVIYVKEGEDR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHA--DIVGPICETGDFIALNRKI 357
            F+I+D AMND +RP +Y+A+H+I     P  + L      D+VGP+CETGD  A  R +
Sbjct: 301 RFLIVDAAMNDLIRPAMYEAHHDI----IPVDESLAPSTVYDVVGPVCETGDTFARGRAM 356

Query: 358 ALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIP 417
           A    G+L+     GAYGAV +  YNSR L+PE++VNG QF +IRPR +++E+I  D+IP
Sbjct: 357 APLNAGELVAFRSAGAYGAVMASEYNSRPLVPEVLVNGDQFAVIRPRPSYEEMIARDTIP 416

Query: 418 AWL 420
           AWL
Sbjct: 417 AWL 419


>gi|170750439|ref|YP_001756699.1| diaminopimelate decarboxylase [Methylobacterium radiotolerans JCM
           2831]
 gi|170656961|gb|ACB26016.1| diaminopimelate decarboxylase [Methylobacterium radiotolerans JCM
           2831]
          Length = 422

 Score =  431 bits (1109), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 219/421 (52%), Positives = 298/421 (70%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE V L  LA  V TPFYCYST  +E++Y  F+ AF   D +VC+A+K
Sbjct: 1   MHHFHYRDGRLHAEEVDLTGLAAEVGTPFYCYSTATLERHYRVFAEAFAADDALVCFAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV++TLA  G+G+DIVS GEL+RALAA V   +IVFSGVGK+  E++ AL +GI+
Sbjct: 61  ANSNQAVLRTLAARGAGMDIVSGGELQRALAAGVDPGKIVFSGVGKSRAEMEAALTAGIF 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL  L++ AV LG +AP++ RVNPD++A TH KISTGK E+KFGIPI +  +
Sbjct: 121 CFNVESEPELAVLSEVAVGLGLRAPVSVRVNPDVDAGTHAKISTGKYENKFGIPITRAPA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+ + GVDMHIGSQI  +  F  A +LL  L ++L + GH ++HID GGGL
Sbjct: 181 VYAAAAALPGIAVHGVDMHIGSQITDLAPFADAARLLAGLARELLAAGHPLRHIDFGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASL-IHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+ PP      +  +  +F  L  + + E GR +V + GIL+T+V+ +K S  +
Sbjct: 241 GIPYRDDNAPPPDPAALAATLRPHFAPLGLRPVFEIGRMIVGNAGILLTRVLYVKHSEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TFVI+D AMND +RPTLY+AYH +  ++ P  +   + AD+VGP+CE+GD++ALNR++  
Sbjct: 301 TFVIVDAAMNDLIRPTLYEAYHGLRPVIEPGPETSRLVADVVGPVCESGDYLALNREMPE 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            RPGDL+ +   GAYGAVQS TYN+R L+PE++V G +  ++RPR+    LI LD +P W
Sbjct: 361 VRPGDLIAVMSAGAYGAVQSCTYNTRPLVPEVLVRGDRAAVVRPRLDVDALIALDRVPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|56695249|ref|YP_165597.1| diaminopimelate decarboxylase [Ruegeria pomeroyi DSS-3]
 gi|56676986|gb|AAV93652.1| diaminopimelate decarboxylase [Ruegeria pomeroyi DSS-3]
          Length = 421

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 210/421 (49%), Positives = 292/421 (69%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+L AE+V L ++A  V +PFY YST  + +++  F  A DG D ++CYA+K
Sbjct: 1   MDHFLYRDGALCAEDVPLAEIAATVGSPFYVYSTATLLRHFQLFDEALDGTDHLICYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SNQA+++TLA  G+G+D+VS GE  RA AA VP  RIVFSGVGKT +EI +AL  GI 
Sbjct: 61  AASNQAILRTLAQAGAGMDVVSVGEYLRARAAGVPGVRIVFSGVGKTAEEIRVALVGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E++ +N  A+ LGK API  RVNPD++A TH KI+TGK E+KFGIPI +  +
Sbjct: 121 QFNVESEPEMEVINAIALELGKVAPITIRVNPDVDAKTHAKIATGKSENKFGIPIARASA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+++ G+D+HIGSQ+  +  F  A++ + +LT++LR+ GH+I+ +D+GGGL
Sbjct: 181 VYAQAAALPGLEVVGIDVHIGSQLTDLAPFETAYRKVAELTERLRAEGHDIRRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP   +Y +LI +  G+L C+I +EPGR +  + G++V+KVI +K    +
Sbjct: 241 GIPYTRSNEAPPLPMEYGALIKRTLGHLGCEIEIEPGRLIAGNAGLMVSKVIYVKSGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP +YDA+H+I  +V P         DIVGP+CE+GD  A  R +  
Sbjct: 301 DFLILDAAMNDLIRPAMYDAHHDIVPVVEPEPGVEPQPYDIVGPVCESGDTFAKARMMPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV S  YNSR LIPE++V+G QF +IRPR +F E+I  D+IP W
Sbjct: 361 LAAGDLVAFRSAGAYGAVMSSEYNSRPLIPEVLVHGDQFAVIRPRPSFDEMINRDTIPPW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|260428872|ref|ZP_05782849.1| diaminopimelate decarboxylase [Citreicella sp. SE45]
 gi|260419495|gb|EEX12748.1| diaminopimelate decarboxylase [Citreicella sp. SE45]
          Length = 421

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 207/421 (49%), Positives = 287/421 (68%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G L+AE+V + ++A  V TP Y YST  + +++  F  A D    +VCYA+K
Sbjct: 1   MDHFLYRNGQLYAEDVPVSEIAAAVGTPVYIYSTATLLRHFRLFDEALDWGPHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SNQA++KTLA  G+G+D+VS GE  RALAA VP ERIVFSGVGKT DEI  AL+ GI 
Sbjct: 61  AASNQAILKTLAAAGAGMDVVSGGEYARALAAGVPGERIVFSGVGKTRDEIRTALEGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FN+ESE E++ +++ A +LG  AP+  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNIESEPEMRAISEVASALGVVAPVTVRVNPDVDARTHAKIATGKSENKFGIPIAKARQ 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+K+ G+D+HIGSQ+ +++ F  A++ + +LT+ LR++GH I  +D+GGGL
Sbjct: 181 VYAEAAALPGLKVVGIDVHIGSQLTELDPFALAYRKVAELTEALRADGHEISRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP   DY  LI +  G+L C+I +EPGR +  + GILV++VI +K+   +
Sbjct: 241 GIPYTRSNEAPPLPVDYGRLIERELGHLGCEIEIEPGRLIAGNAGILVSEVIYVKEGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP +YDA+H+I  +V P         DIVGP+CETGD  A  R +  
Sbjct: 301 NFLILDAAMNDLIRPAMYDAHHDIIPVVEPEPGCEQEPYDIVGPVCETGDTFAKARLMPE 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            R G L+     GAYGAV +  YN+R LIPE++V   QF +IR R +F+++I  DS+P W
Sbjct: 361 LRAGGLVAFRSAGAYGAVMASEYNTRALIPEVLVKDDQFAVIRQRPSFEDIINRDSLPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|126740531|ref|ZP_01756218.1| diaminopimelate decarboxylase [Roseobacter sp. SK209-2-6]
 gi|126718332|gb|EBA15047.1| diaminopimelate decarboxylase [Roseobacter sp. SK209-2-6]
          Length = 421

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 204/421 (48%), Positives = 290/421 (68%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+L+AE+V + ++A  V TPFY YST  + +++  F  A +G + +VCYA+K
Sbjct: 1   MDHFLYRDGALYAEDVPVAEIAAAVGTPFYVYSTATLLRHFRLFDEALEGTEHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SNQA++KTLA  G+G+D+VS+GE  RA AA VP +RIVFSGVGKT++E+ +AL  GI 
Sbjct: 61  AASNQAILKTLAQAGAGMDVVSQGEYLRAKAAGVPGDRIVFSGVGKTMEEVRVALSGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E+  +N  A+ LG  API  R+NPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMAVINAVALELGVIAPITIRINPDVDAKTHAKIATGKSENKFGIPISRAKE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A++LPG+++ G+D HIGSQ+  +E F  A++ + +LT+ LR+ GH+I+ +D+GGGL
Sbjct: 181 VYAHAASLPGLEVVGIDCHIGSQLTDLEPFRLAYEKVAELTEVLRAEGHDIRRLDLGGGL 240

Query: 241 GIAYH-SDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP   +Y  LI    G+L C+I +EPGR +  + G++V+KVI +K    +
Sbjct: 241 GIPYERSNEAPPLPVEYGQLIKDTLGHLGCEIEIEPGRLIAGNAGLMVSKVIYVKSGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+I+D AMND +RP +Y+A+H+I  +  PA        DIVGP+CETGD  A  R +  
Sbjct: 301 DFLIVDGAMNDLIRPAMYEAHHDIVAVDEPAPGVEQQPYDIVGPVCETGDTFAKERMMPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV +  YNSR LIPE++V+G QF +IR R  + E+I  D+IP W
Sbjct: 361 LAAGDLIAFRSAGAYGAVMASEYNSRPLIPEVLVHGDQFAVIRRRPDYDEMINRDTIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|84515838|ref|ZP_01003199.1| diaminopimelate decarboxylase [Loktanella vestfoldensis SKA53]
 gi|84510280|gb|EAQ06736.1| diaminopimelate decarboxylase [Loktanella vestfoldensis SKA53]
          Length = 422

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 209/421 (49%), Positives = 293/421 (69%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G+L+AE+V++  +A  V TPFY YST  + +++  F  A    D +VC+A+K
Sbjct: 1   MDHFLYRNGALYAEDVAIADIAAAVGTPFYVYSTATLTRHFQLFDEALGFADHLVCFAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN AV++ LA  G+G+D+VS GE  RA AA VP +RIVFSGVGKT DE+ +ALQ GI 
Sbjct: 61  SLSNIAVLRVLAQAGAGMDVVSGGEYLRAKAAGVPGDRIVFSGVGKTADEMRMALQGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E+  L+  A SLGK API  R+NPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMVALDAVARSLGKIAPITLRINPDVDAKTHAKIATGKSENKFGIPISRARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+TL G+K+ G+D+HIGSQ+ ++  F  A+  + +LT+ LR++GH I  +D+GGGL
Sbjct: 181 VYALAATLKGLKVVGIDVHIGSQLTELAPFEAAYAKVAELTEVLRADGHQITRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP  SDY ++I +  G+L C+I +EPGR +  + G++V++VI +K   D+
Sbjct: 241 GIPYERSNAAPPLPSDYGAMIERTLGHLGCEIEIEPGRLISGNAGLMVSQVIYVKSGEDR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP +YDA+H+I  +V PA        DIVGP+CE+GD  A  R++A 
Sbjct: 301 DFLILDGAMNDLIRPAMYDAWHDIIPVVEPAPGTEPARYDIVGPVCESGDTFAKAREVAP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            +PGDL+     GAYGAV +  YNSR LIPE++V+G QF +IR R +++E+I  DS+P W
Sbjct: 361 MQPGDLVAFRSAGAYGAVMASEYNSRPLIPEVLVHGDQFAVIRKRPSYEEMIARDSLPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|114770083|ref|ZP_01447621.1| diaminopimelate decarboxylase [alpha proteobacterium HTCC2255]
 gi|114548920|gb|EAU51803.1| diaminopimelate decarboxylase [alpha proteobacterium HTCC2255]
          Length = 421

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 203/421 (48%), Positives = 291/421 (69%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE+V++ ++A  V TPFY YS   + +++  F  A +GM  ++CYA+K
Sbjct: 1   MDHFLYHKGILHAEDVAITEIAAAVGTPFYVYSQATLMRHFRVFDEALNGMKHLICYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN A++K L +LG+G+D+VS GE  RA AA +  ++IVFSGVGKT +E+ LA+++GI 
Sbjct: 61  ANSNIAILKILGNLGAGMDVVSGGEYLRAKAAGISGDKIVFSGVGKTREEMALAIKNGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE+ELK LN+ A+SLG  API  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEAELKVLNEVALSLGAIAPITLRVNPDVDAKTHAKIATGKSENKFGIPISKAQE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y+ A+++  + + G+D+HIGSQ+  +E F  A+K + +LT+ LR +GHNI+ +D+GGGL
Sbjct: 181 VYSIAASMEAIDVVGIDVHIGSQLTDLEPFRLAYKKVAELTKMLRQDGHNIRRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y +S+  PP+  DYA +IH+  G+L C+I +EPGR L  + G++V+ VI  K    +
Sbjct: 241 GIPYENSNQIPPTPEDYAKVIHETVGDLDCEIEIEPGRLLAGNAGLMVSSVIYNKSGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+I+D AMND +RP +Y+AYHEI  ++   G       DIVGP+CETGD  A  R +  
Sbjct: 301 DFMIVDAAMNDLIRPAMYEAYHEIIPVIETTGSPEIRDYDIVGPVCETGDTFANKRALTP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              G+++     GAYGAV +  YN+R LIPE++V G QF IIR R + + +I+ D IP W
Sbjct: 361 VADGEMVAFRSAGAYGAVMASEYNTRPLIPEVLVYGDQFSIIRNRPSIEAIIKRDIIPDW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|254472266|ref|ZP_05085666.1| diaminopimelate decarboxylase [Pseudovibrio sp. JE062]
 gi|211958549|gb|EEA93749.1| diaminopimelate decarboxylase [Pseudovibrio sp. JE062]
          Length = 423

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 211/422 (50%), Positives = 293/422 (69%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F++ +G LHAE+V+L ++A  V TPFYCYS    E+++  F  AFDG+D + CYA+K
Sbjct: 1   MHYFEFKDGVLHAEDVALTEIAAEVGTPFYCYSRATFERHFKVFDGAFDGIDHLTCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN A++  LA LG+G D+VSEGELRRAL A +PA +IVFSGVGKT  E+  AL +GI 
Sbjct: 61  ANSNIAILTVLAKLGAGADVVSEGELRRALKAGIPANKIVFSGVGKTRQEMRFALNAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE ELK L++ A  +GK API+ R+NPD++A TH KISTG   +KFGI   +  +
Sbjct: 121 CFNVESEPELKRLSEVASEMGKTAPISLRINPDVDAKTHAKISTGLAANKFGIAWDRARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LPG+K++G+DMHIGSQI ++  F  A + L  L   L+ +G  I+H+DVGGGL
Sbjct: 181 VYNEAAQLPGLKVTGMDMHIGSQITELGPFDDALERLGVLIGMLKEDGIEIEHLDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y      P  ++YA ++ ++   L   +I EPGR +  + GILVT+ I  K+   K 
Sbjct: 241 GIPYGGGIEAPLPTEYAKIVRKHIERLGVTLITEPGRLIAGNAGILVTETIYRKEGEPKN 300

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FVI+D AMND +RPTLY+A+H+I  +     +   + AD+VGP+CETGD+IA +R++   
Sbjct: 301 FVIVDAAMNDLIRPTLYEAHHDIGAVSEERQNGEQMLADVVGPVCETGDYIARDRELPKF 360

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
             GDLL +   GAYGA QSGTYN+RLL+PE++V+G +F IIR R ++ EL+  D +P W+
Sbjct: 361 EEGDLLAVYSCGAYGATQSGTYNTRLLVPEVLVDGDKFAIIRQRPSYDELLNQDVVPNWV 420

Query: 421 QK 422
           +K
Sbjct: 421 EK 422


>gi|254475385|ref|ZP_05088771.1| diaminopimelate decarboxylase [Ruegeria sp. R11]
 gi|214029628|gb|EEB70463.1| diaminopimelate decarboxylase [Ruegeria sp. R11]
          Length = 421

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 207/421 (49%), Positives = 289/421 (68%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+L AE+V + ++A  V TPFY YST  + +++  F +A  GMD +VCYA+K
Sbjct: 1   MDHFLYRDGALFAEDVPVAEIAAAVGTPFYVYSTATLLRHFQLFDDALAGMDHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SNQA++KTLA  G+G+D+VS+GE  RA AA VP ++IVFSGVGKT +EI  AL  GI 
Sbjct: 61  AASNQAILKTLAQAGAGMDVVSQGEYLRAKAAGVPGDKIVFSGVGKTAEEIRTALSGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E++ +N  A+ LG  API  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPEMEVINAVALDLGVVAPITVRVNPDVDAKTHAKIATGKSENKFGIPIAKARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A+TL G+ + G+D+HIGSQ+ ++E F  A++ + +LT+ LR++GH+I+ +D+GGGL
Sbjct: 181 VYAHAATLKGLDVIGIDVHIGSQLTELEPFRLAYQKVAELTETLRADGHDIRRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP   +Y  LI    G+L  +I +EPGR +  + G++V+KVI +K+   +
Sbjct: 241 GIPYTRSNEAPPLPVEYGQLIKDTLGHLNVEIEIEPGRLIAGNAGLMVSKVIYVKEGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP +Y+A+H+I  +V P         DIVGP+CETGD  A  R +  
Sbjct: 301 DFLILDGAMNDLIRPAMYEAHHDIVPVVEPEPGLEPRPYDIVGPVCETGDTFAKARLMPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
               DL+     GAYGAV +  YNSR LIPE++V+G QF +IR R  F E+I  D+IP W
Sbjct: 361 LSANDLVAFRSAGAYGAVMASEYNSRPLIPEVLVHGDQFAVIRRRPDFDEMINRDTIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|126726029|ref|ZP_01741871.1| diaminopimelate decarboxylase [Rhodobacterales bacterium HTCC2150]
 gi|126705233|gb|EBA04324.1| diaminopimelate decarboxylase [Rhodobacterales bacterium HTCC2150]
          Length = 421

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 202/422 (47%), Positives = 284/422 (67%), Gaps = 3/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+LHAE+V L  +A  V TPFY YS     +++     A      ++CYA+K
Sbjct: 1   MDHFMYRDGALHAEDVPLADIATAVGTPFYAYSAATFARHFQVLDEALSWGPHLICYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQA++K L  +G+G+D+VS GE  RA AA VP ERIVFSGVGKT DEI++ L+ GI 
Sbjct: 61  ANSNQAILKMLGDMGAGMDVVSGGEYARARAAGVPGERIVFSGVGKTRDEIEMTLKGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E+  L++ A  LG  API  RVNPD++A TH+KI+TGKKE+KFGIPI +   
Sbjct: 121 QFNVESEPEMVVLSEIATKLGLIAPITIRVNPDVDAKTHEKIATGKKENKFGIPISRARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+KI G+D+HIGSQ+  +  + +AF+L+ +LT+ LR +GH I  +D+GGGL
Sbjct: 181 VYAMAAGLPGLKIVGIDVHIGSQLTDLTPYREAFELVAELTKTLREDGHEISRLDLGGGL 240

Query: 241 GIAYHSDH-RPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+  PP  ++Y  ++ +  G+L C+I +EPGR +  + G+LV++VI +K   D+
Sbjct: 241 GIPYARDNDAPPVPAEYGQIVRETVGDLGCEIEIEPGRLVAGNAGVLVSEVIYVKSGEDR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNP-AGDRLHIHADIVGPICETGDFIALNRKIA 358
            F+ILD AMND +RP +Y A+H+I  +     G  +  + DIVGP+CE+GD  A  R + 
Sbjct: 301 EFLILDAAMNDLIRPAMYSAHHDIVPLKEAEVGVEMQPY-DIVGPVCESGDTFAKQRPLP 359

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
                DL+     GAYGAV +  YN+R ++PE++V G QF +IRPR T +E+I  D +P 
Sbjct: 360 PLEATDLVAFRSAGAYGAVMASEYNTRPMVPEVLVMGDQFAVIRPRPTLEEIINRDIVPE 419

Query: 419 WL 420
           WL
Sbjct: 420 WL 421


>gi|114764059|ref|ZP_01443298.1| diaminopimelate decarboxylase [Pelagibaca bermudensis HTCC2601]
 gi|114543417|gb|EAU46432.1| diaminopimelate decarboxylase [Roseovarius sp. HTCC2601]
          Length = 421

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 202/421 (47%), Positives = 284/421 (67%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G L AE+V + ++A  V TP Y YST  + +++  F  A      +VCYA+K
Sbjct: 1   MDHFLYRDGQLCAEDVPVAEIAAAVGTPVYVYSTATLLRHFRLFDEALAWGPHLVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SNQA++KTLA  G+G+D+VS GE  RA AA VP +RIVFSGVGKT  EI  AL+ GI 
Sbjct: 61  AASNQAILKTLAEAGAGMDVVSGGEYARARAAGVPGDRIVFSGVGKTRAEIRTALEGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FN+ESE E++ +++ A  LG  AP+  RVNPD++A TH KI+TGK E+KFGIPI +   
Sbjct: 121 QFNIESEPEMRAISEVASELGVVAPVTVRVNPDVDAKTHAKIATGKSENKFGIPIAKARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+K+ G+D+HIGSQ+ ++E F  A++ + +LT+ LR +GH I  +D+GGGL
Sbjct: 181 VYAEAAALPGLKVVGIDVHIGSQLTELEPFAMAYRKVAELTEALRGDGHEITRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP   +Y ++I +  G+L C+I +EPGR +  + GILV++VI +K+   +
Sbjct: 241 GIPYTRSNEAPPLPVEYGAMIERELGHLGCEIEIEPGRLIAGNAGILVSEVIYLKEGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP +Y+A+H+I  ++ P         DIVGP+CE+GD  A  R +  
Sbjct: 301 NFLILDAAMNDLIRPAMYEAHHDIVPVIEPEAGLEQSPFDIVGPVCESGDTFAKGRMMPA 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV S  YN+R LIPE++V G QF +IR R +F+E+I  DS+P W
Sbjct: 361 LGAGDLVAFRSAGAYGAVMSSEYNTRALIPEVLVKGDQFAVIRRRPSFEEIINRDSLPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|119384752|ref|YP_915808.1| diaminopimelate decarboxylase [Paracoccus denitrificans PD1222]
 gi|119374519|gb|ABL70112.1| diaminopimelate decarboxylase [Paracoccus denitrificans PD1222]
          Length = 421

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 207/424 (48%), Positives = 288/424 (67%), Gaps = 7/424 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE V L ++A  V TP Y YS   + +++  F  A    D +VC+A+K
Sbjct: 1   MDHFNYVDGWLHAEEVPLARIAAEVGTPVYVYSAATLTRHFKLFQQALAWTDHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+K L  LG+G+DIVS GE  RA AA VP ERIVFSGVGK   E+ +AL+ GI 
Sbjct: 61  ANSNIAVLKLLGDLGAGMDIVSGGEYARARAAGVPGERIVFSGVGKLEPEMRMALEGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE EL+ L++ A S+G +APIA RVNPD++A TH+KI+TGK E+KFGIPI +   
Sbjct: 121 QFNVESEPELELLSRVASSMGVEAPIAVRVNPDVDARTHEKIATGKSENKFGIPIARARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A+ LPG+K+ G+DMHIGSQ+  +E + +A+  + +LT+ LR++GH I  +D+GGGL
Sbjct: 181 VYAHAARLPGIKVVGIDMHIGSQLTDLEPYRQAYAKMAELTRALRADGHRITRLDMGGGL 240

Query: 241 GIAYHSDHR-PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  D+  PP   +Y  +I    G+L C+I +EPGR +  + GIL++ VI +K+   +
Sbjct: 241 GIPYRRDNNAPPLPIEYGQVIRDAVGDLGCEIEIEPGRNIAGNAGILLSSVIYLKQGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPA-GDRLHIHADIVGPICETGDFIALNRKIA 358
            F+ILD AMND +RP +Y A+H+I  +   A G  +  H D+VGP+CETGD     + + 
Sbjct: 301 DFLILDAAMNDLIRPAMYSAHHDIVPVREAAPGAEVAPH-DVVGPVCETGD--TFQKAVE 357

Query: 359 LPR--PGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           LP   PGDL+ +   GAYGAV +  YNSR L+PE++V+  QF +IR R T +E++  D+I
Sbjct: 358 LPALGPGDLVALRSAGAYGAVMASEYNSRPLVPEVLVSADQFAVIRARPTLEEMLGRDTI 417

Query: 417 PAWL 420
           P WL
Sbjct: 418 PEWL 421


>gi|89069733|ref|ZP_01157069.1| Orn/DAP/Arg decarboxylase, family 2 [Oceanicola granulosus
           HTCC2516]
 gi|89044679|gb|EAR50790.1| Orn/DAP/Arg decarboxylase, family 2 [Oceanicola granulosus
           HTCC2516]
          Length = 421

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 199/421 (47%), Positives = 289/421 (68%), Gaps = 1/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G L AE+V+L+ +A  V TP Y YS   + ++Y  F+ A +G+D ++C+++K
Sbjct: 1   MDHFLYRDGRLMAEDVALDDIAAAVGTPVYVYSAKTLLRHYGLFAQALEGLDHLICFSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN A++  LA  G+G+D+VS GE  RA AA VP ERIVFSGVGKT +E+ LAL+ GI 
Sbjct: 61  SLSNLAILSLLAREGAGMDVVSGGEYARARAAGVPGERIVFSGVGKTREEMRLALEGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FN+ESE E++ L++ A  +G  AP+  RVNPD++A TH KISTGK E+KFGIPI +   
Sbjct: 121 QFNLESEPEMRALSEVASGMGVVAPVTVRVNPDVDARTHAKISTGKSENKFGIPIRKARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LPG+++ G+D+HIGSQ+ ++  F +A++ + DLT  LR++GH+I+ +D+GGGL
Sbjct: 181 VYAEAAALPGLEVVGIDVHIGSQLIELGPFEQAYRKVADLTATLRADGHDIRRLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  S+  PP   DY +LI +  G+L  ++ +EPGR +  + G+L+++VI +K+   +
Sbjct: 241 GIPYTRSNEVPPLPLDYGALIKRTVGDLGVEVQIEPGRLIAGNSGVLLSRVIYVKEGEGR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+ILD AMND +RP +YDA+H+I  +  PA        D+VGPICE+GD  A  R +  
Sbjct: 301 DFLILDGAMNDLVRPAMYDAWHDIVPVAEPAAGGATRDFDVVGPICESGDTFARARPLPE 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGAV +  YNSR L+PE++V+G  F +IR R T++ELI  DSIP W
Sbjct: 361 LAAGDLVAFRSAGAYGAVMASEYNSRPLVPEVLVSGDHFAVIRQRPTYEELIARDSIPEW 420

Query: 420 L 420
           L
Sbjct: 421 L 421


>gi|126730019|ref|ZP_01745831.1| diaminopimelate decarboxylase [Sagittula stellata E-37]
 gi|126709399|gb|EBA08453.1| diaminopimelate decarboxylase [Sagittula stellata E-37]
          Length = 426

 Score =  421 bits (1082), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 201/418 (48%), Positives = 279/418 (66%), Gaps = 1/418 (0%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
           F Y +G L AE+VS+ ++A  V+TPFY YS   + +++  F  A      MVCYA+KA S
Sbjct: 9   FLYRDGQLFAEDVSVAEIARAVETPFYLYSHATLVRHFRLFDEALAWGPHMVCYAVKAAS 68

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFN 123
           NQA++  LA  G+G+D+VS GE  RA AA VP  RIVFSGVGKT  EI  AL  GI  FN
Sbjct: 69  NQAILTALAAEGAGMDVVSGGEYARAKAAGVPGARIVFSGVGKTRSEIRAALDGGIRQFN 128

Query: 124 VESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA 183
           VESE E++ +++ A S+G  APIA RVNPD++A TH KI+TGK E+KFGIPI +   +YA
Sbjct: 129 VESEPEMQVISEVATSMGVVAPIAVRVNPDVDAKTHAKIATGKSENKFGIPIARAREVYA 188

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIA 243
            A+ LPG+K+ G+D+HIGSQ+ Q+E F  A++ + +LT+ LR+ GH I+ +D+GGGLGI 
Sbjct: 189 EAAALPGLKVVGIDVHIGSQLTQLEPFEMAYRKVAELTEVLRAEGHAIERLDLGGGLGIP 248

Query: 244 Y-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
           Y  S+  PP  +DY +++ +  G+L  ++ +EPGR +  + GILV++VI +K    + F+
Sbjct: 249 YARSNEAPPLPTDYGAMVQRTVGHLGVEVEIEPGRLIAGNAGILVSRVIYVKNGEGRDFL 308

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           ILD AMND +RP +YDAYH+I  +         +  D+VGP+CETGD  A  R +     
Sbjct: 309 ILDAAMNDLIRPAMYDAYHDIVPVAEAEPGIEQVAYDVVGPVCETGDTFAKGRVMPPLAA 368

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
           GDL+     GAYGAV S  YN+R L+PEIM    QF +IR R +F ++I  D++P WL
Sbjct: 369 GDLVAFRSAGAYGAVMSSEYNTRPLVPEIMAKNDQFAVIRARPSFDDMINRDTVPEWL 426


>gi|94497890|ref|ZP_01304455.1| diaminopimelate decarboxylase [Sphingomonas sp. SKA58]
 gi|94422618|gb|EAT07654.1| diaminopimelate decarboxylase [Sphingomonas sp. SKA58]
          Length = 421

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 199/422 (47%), Positives = 285/422 (67%), Gaps = 5/422 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGM-DTMVCYAL 59
           M  F Y +G++  E V +E +A  V TP Y YST A+E++   F      + D ++ +A+
Sbjct: 1   MDHFSYVDGAMQVEQVPMEAIAQAVGTPVYVYSTAALERHVGVFREGLAQLSDPLIAFAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KAN N AV+ TLA LG G D+VS GEL RA+AA +PA RIVFSGVGKT +E+ +AL  GI
Sbjct: 61  KANPNAAVLATLARLGLGADVVSAGELLRAVAAGIPASRIVFSGVGKTAEEMRIALDHGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
           Y FN+ESE E + L+Q A ++GK+AP+AFR+NPD++A TH KISTGK E+KFGIP  +  
Sbjct: 121 YQFNLESEPEAEMLSQVAAAMGKRAPVAFRINPDVDAGTHAKISTGKSENKFGIPYDRAL 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
             YA A  LPG+ + GV +HIGSQ+  +     AF  +  L + LR+ GH+I+  D+GGG
Sbjct: 181 DSYAAARDLPGLDVQGVAVHIGSQLTDLAPLEAAFVKVGALIEVLRAAGHDIRTADLGGG 240

Query: 240 LGIAYH-SDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  +   PPS +DY +++ +   +   +++ EPGR +V + G+L+++VI +K+ A 
Sbjct: 241 LGVPYDPAQPLPPSPADYGAMVCRVTQSWPVRLMFEPGRVIVGNAGVLLSRVIRVKQGAQ 300

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
             FVI+D AMND MRP+LYDA+H+I   V P+GDR    A++VGP+CETGD  A++R + 
Sbjct: 301 APFVIVDAAMNDLMRPSLYDAWHDIR-TVKPSGDR--ATANVVGPVCETGDTFAMHRDMD 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
           + R G+L+     GAYGA  +GTYNSR L PE++V+G ++ ++R R   + LI+ D IP 
Sbjct: 358 VVRAGELVAFMTAGAYGATMAGTYNSRPLTPEVLVSGDKWAVVRERPPLRALIDGDIIPD 417

Query: 419 WL 420
           WL
Sbjct: 418 WL 419


>gi|294012853|ref|YP_003546313.1| diaminopimelate decarboxylase [Sphingobium japonicum UT26S]
 gi|292676183|dbj|BAI97701.1| diaminopimelate decarboxylase [Sphingobium japonicum UT26S]
          Length = 426

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/422 (46%), Positives = 287/422 (68%), Gaps = 5/422 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGM-DTMVCYAL 59
           M  F Y +G++ AE V +  +A  V TP Y YST  + ++   F      + D ++ +A+
Sbjct: 1   MDHFTYVDGAMLAEQVPMADIAAQVGTPVYIYSTATLTRHVAVFREGLSQIHDPLIAFAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KAN N AV+ TLA LG G D+VS GEL RA+AA +PAERIVFSGVGKT DE+ +AL+ GI
Sbjct: 61  KANPNAAVLATLAKLGLGADVVSAGELLRAIAAGIPAERIVFSGVGKTADEMRIALEQGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
           Y FN+ESE E + L++ A+S+G+KAP+A+R+NPD++A TH KISTGK E+KFGIP  +  
Sbjct: 121 YQFNLESEPEAEMLSEVALSMGRKAPVAYRINPDVDAGTHAKISTGKSENKFGIPYDRAL 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           + YA A  LPG+ + GV +HIGSQ+  +     AF  +  L ++LR+ GH+I+  D+GGG
Sbjct: 181 ASYAAARDLPGLDVQGVAVHIGSQLTDLTPLEAAFIKVGALIERLRAEGHDIRTADLGGG 240

Query: 240 LGIAYH-SDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  S   PPS +DY +++ +       +++ EPGR +V + G+L+++V+ +K+ A 
Sbjct: 241 LGVPYDPSQPLPPSPADYGAMVTRITQGWNVRLMFEPGRLIVGNAGVLLSQVVRVKQGAQ 300

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
             FVI+D AMND +RP+LYDA+H+I   V+P G+R    A++VGP+CETGD  A++R + 
Sbjct: 301 APFVIVDAAMNDLLRPSLYDAWHDIR-AVHPKGER--AAANVVGPVCETGDTFAMHRDMD 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
           +   GDL+     GAYGA  + TYNSR L PE++V+G ++ ++R R   + LIE DSIPA
Sbjct: 358 VVGAGDLVAFMTAGAYGATMASTYNSRALTPEVLVSGDKWAVVRARPPIEALIEGDSIPA 417

Query: 419 WL 420
           W+
Sbjct: 418 WI 419


>gi|255263324|ref|ZP_05342666.1| diaminopimelate decarboxylase [Thalassiobium sp. R2A62]
 gi|255105659|gb|EET48333.1| diaminopimelate decarboxylase [Thalassiobium sp. R2A62]
          Length = 422

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/422 (46%), Positives = 279/422 (66%), Gaps = 2/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+L AE+V +  +A  V TPFY YS   + +++  F +A  G+D +VC+A+K
Sbjct: 1   MDHFLYRDGALFAEDVPVADIAASVGTPFYLYSAATLLRHFQLFDDALAGVDHLVCFAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SNQA++K L   G+G+D+VS GE  RA AA +   +IVFSG+GKT  E+++AL  GI 
Sbjct: 61  SASNQAILKLLGDAGAGMDVVSGGEYARARAAGISGNKIVFSGIGKTRAEMEMALTGGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE E+  L+  A  LG  API  RVNPD++A TH+KI+TG+K DKFGIPI +   
Sbjct: 121 QFNVESEPEMLALSAVATDLGVVAPITVRVNPDVDAKTHEKIATGRKGDKFGIPISRARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LP +K+ G+D+HIGSQ+  +  F  A++ + DLT+ LR++GH I  +D+GGGL
Sbjct: 181 IYAVAAKLPSLKVIGIDVHIGSQLTDLAPFKTAYEKVADLTEHLRADGHEISRLDLGGGL 240

Query: 241 GIAYH--SDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           GI Y    + RPP  + Y  +I    G+L C+I +EPGR +  + GILV+++I IK   D
Sbjct: 241 GIPYAIGDNDRPPLPAQYGEMIIDTLGHLGCEIEIEPGRLISGNAGILVSQIIYIKSGED 300

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           + F+ILD AMND +RP +Y A+H+I  ++ P         DIVGP+CE+GD  A  R + 
Sbjct: 301 REFMILDGAMNDLIRPAMYGAHHDIIPVIEPPAGVDKTPYDIVGPVCESGDTFAKARDMP 360

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
               GDL+     GAYGAV S  YN+R LIPE++V G QF +IRPR T+ ++I  D++P 
Sbjct: 361 PMNAGDLVAFRSAGAYGAVMSSEYNTRPLIPEVLVMGDQFAVIRPRPTYDDIINRDTVPE 420

Query: 419 WL 420
           WL
Sbjct: 421 WL 422


>gi|209967337|ref|YP_002300252.1| diaminopimelate decarboxylase [Rhodospirillum centenum SW]
 gi|209960803|gb|ACJ01440.1| diaminopimelate decarboxylase [Rhodospirillum centenum SW]
          Length = 436

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 202/422 (47%), Positives = 281/422 (66%), Gaps = 5/422 (1%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFD-----GMDTMVCYA 58
           F Y +G LH E+V L  +A    TP Y YST  +  N+  +++AFD     G D  VCYA
Sbjct: 9   FAYRDGELHVEDVPLSAIAAEAGTPAYVYSTAELRANWRAYADAFDLDGPGGRDVAVCYA 68

Query: 59  LKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSG 118
           LKANSN AVI+TL  LG+G D+VS GE++RAL A +PA+RIVFSGVGKT DE+  AL++G
Sbjct: 69  LKANSNLAVIRTLTALGAGADVVSVGEMQRALVAGIPADRIVFSGVGKTRDELAAALKAG 128

Query: 119 IYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQI 178
           I+  NVES  EL  L+  A  LG  AP+A RVNPD++A TH KI+TG+KEDKFGI   Q 
Sbjct: 129 IHQINVESLPELDLLSAVASGLGLVAPVALRVNPDVDAQTHGKIATGRKEDKFGIDWSQA 188

Query: 179 HSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGG 238
            + +A A+ LPG++  GV +HIGSQ+ +   F  AF  + +L   LR++G  I+ ID+GG
Sbjct: 189 GAAFARAAALPGLRPLGVAIHIGSQLLKTSPFALAFAKVAELVTDLRAHGIGIERIDLGG 248

Query: 239 GLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           G+G+ Y  +   P    YA ++ +  G+L C I LEPGR LVA  G+L+++V+ +K+   
Sbjct: 249 GVGVPYREEDIGPDHRAYAQVVRETVGHLGCHITLEPGRSLVASAGVLLSRVVHVKEGLH 308

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           + F++LD AMND +RP+LYDA+H I  +  PA        D+VGP+CE+GD  A  R++ 
Sbjct: 309 RRFLVLDAAMNDLIRPSLYDAWHTILPVRQPARGAPLSAMDVVGPVCESGDTFAKGRRLP 368

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
             + GDL+ I   GAYGAV + TYNSR L+PE++V G +  ++R R T +EL+ ++S+PA
Sbjct: 369 PMQAGDLVAILTAGAYGAVMASTYNSRPLVPEVLVAGGERAVVRRRPTLEELLAMESVPA 428

Query: 419 WL 420
           WL
Sbjct: 429 WL 430


>gi|307295072|ref|ZP_07574914.1| diaminopimelate decarboxylase [Sphingobium chlorophenolicum L-1]
 gi|306879546|gb|EFN10764.1| diaminopimelate decarboxylase [Sphingobium chlorophenolicum L-1]
          Length = 421

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 192/423 (45%), Positives = 284/423 (67%), Gaps = 5/423 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGM-DTMVCYAL 59
           M  F Y +G++  E V + ++A  V TP Y YST  + ++   F      + D ++ +A+
Sbjct: 1   MDHFTYVDGAMLVEQVPMAEIAAKVGTPVYIYSTATLTRHVGVFREGLSQLADPLIAFAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KAN N AV+ TL  LG G D+VS GEL RA+AA +PA RIVFSGVGKT DE+ +AL+ GI
Sbjct: 61  KANPNAAVLATLGRLGLGADVVSAGELLRAIAAGIPANRIVFSGVGKTADEMRIALEQGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
           Y FN+ESE E + L++ A+S+G++AP+A+R+NPD++A TH KISTGK E+KFGIP  +  
Sbjct: 121 YQFNLESEPEAEMLSEVALSMGRRAPVAYRINPDVDAGTHAKISTGKSENKFGIPYDRAL 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           + YA A  LPG+ + GV +HIGSQ+  ++    AF  +  L ++LR  GH+I+  D+GGG
Sbjct: 181 ASYAAARDLPGLDVQGVAVHIGSQLTDLKPLEAAFVKVGALIEKLREAGHDIRTADLGGG 240

Query: 240 LGIAYH-SDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  S   PPS +DY +++ +       +++ EPGR +V + G+L+++V+ +K+ A 
Sbjct: 241 LGVPYDPSQPLPPSPADYGAMVTRITQGWNVRLLFEPGRLIVGNAGVLLSQVVRVKQGAQ 300

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
             FVI+D AMND +RP+LYDA+H+I   V P GDR    A++VGP+CETGD  A++R + 
Sbjct: 301 APFVIVDAAMNDLLRPSLYDAWHDIR-AVQPKGDR--AAANVVGPVCETGDTFAMHRDMD 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
           +   GDL+     GAYGA  + TYNSR L PE++V+G ++ ++R R   + LI+ D+IP 
Sbjct: 358 VVGAGDLVAFMTAGAYGATMASTYNSRALTPEVLVSGDKWAVVRARPPIETLIQGDNIPD 417

Query: 419 WLQ 421
           W+Q
Sbjct: 418 WVQ 420


>gi|83591736|ref|YP_425488.1| diaminopimelate decarboxylase [Rhodospirillum rubrum ATCC 11170]
 gi|83574650|gb|ABC21201.1| diaminopimelate decarboxylase [Rhodospirillum rubrum ATCC 11170]
          Length = 425

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 197/423 (46%), Positives = 282/423 (66%), Gaps = 1/423 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G LHAE+V+L  +A  V TPFY YS   +E+++  FS+AF G    +C+A K
Sbjct: 1   MDYFSYRNGQLHAEDVALAAIAEAVGTPFYVYSAATLERHFRVFSDAFAGQPITLCFATK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
            N N+AV+  LA LG+G D+VS+GE+  ALAA VPA RIVFSGV KT  E+  AL++GI+
Sbjct: 61  TNGNKAVLALLAGLGAGADVVSQGEMEHALAAGVPAGRIVFSGVAKTKAEMAAALEAGIF 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
             NVESE EL+ L++ A +LGK AP+A R+NPD+ A TH KI+TG+KE+KFGI      +
Sbjct: 121 QINVESEPELEALSEVAQALGKTAPVALRINPDVAAATHDKIATGRKENKFGIDWTVAPA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++A A+ LPG+ + GV +HIGSQI  ++ F +AF+ LR+L   LR++G  ++ +D+GGGL
Sbjct: 181 IFAKAAGLPGIAVKGVAVHIGSQILDLDPFRRAFERLRELVLALRADGIALERVDLGGGL 240

Query: 241 GIAYHSDH-RPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI YH D    P  ++YA+L  + FG+L   ++ EPGR +  + G+LV++V+  K+   +
Sbjct: 241 GIPYHRDDPASPPPAEYAALARRIFGDLGVHLVAEPGRLIAGNAGMLVSRVVYRKQGETR 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           TF+ILD   ND +RP +YDA+H+I  +   A + +    D+VGPICE+GD  A  R +  
Sbjct: 301 TFLILDAGFNDLIRPAMYDAFHDILPVTAAAENAVLTPVDVVGPICESGDIFARQRPLPP 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL+     GAYGA  S TYN R L+PE+MV+G +F ++R R +  E+  L+S+P W
Sbjct: 361 IAAGDLVAFATAGAYGASMSSTYNGRPLVPEVMVSGDRFAVVRRRPSVAEMTALESVPPW 420

Query: 420 LQK 422
           L K
Sbjct: 421 LAK 423


>gi|218671272|ref|ZP_03520942.1| diaminopimelate decarboxylase protein [Rhizobium etli GR56]
          Length = 309

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 184/309 (59%), Positives = 243/309 (78%), Gaps = 1/309 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F++ +G LHAENV + ++A  V TPFY YST  +E++Y  FS AF  MD+MVCYA+K
Sbjct: 1   MNHFEHRDGILHAENVPVPEIAKAVGTPFYVYSTATLERHYRVFSEAFADMDSMVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTL  LG+G+D+VSEGELRRALAA +PA RI+FSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLKTLGRLGAGIDVVSEGELRRALAADIPASRIMFSGVGKTPSEMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ LNQRAVS GKKAP++FR+NPD++A TH KISTGKKE+KFGI   +  +
Sbjct: 121 CFNVESEPELEILNQRAVSAGKKAPVSFRINPDVDAKTHSKISTGKKENKFGISWERARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A+ LPG++++G+DMHIGSQI +++ F  AFKLLRDL   LR++GH I H+D+GGGL
Sbjct: 181 IYAHAAKLPGIEVTGIDMHIGSQITELQPFDDAFKLLRDLVATLRADGHTIDHVDIGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y  D+ PP   D YA+++     +L CK+I EPGR +V + GILVT+V+ +K   +K
Sbjct: 241 GVPYKDDNNPPPLPDAYAAIVKNQLRDLDCKVITEPGRLIVGNAGILVTEVLYVKDGGEK 300

Query: 300 TFVILDVAM 308
           TFVI+D AM
Sbjct: 301 TFVIVDGAM 309


>gi|197104100|ref|YP_002129477.1| diaminopimelate decarboxylase [Phenylobacterium zucineum HLK1]
 gi|196477520|gb|ACG77048.1| diaminopimelate decarboxylase [Phenylobacterium zucineum HLK1]
          Length = 422

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 190/424 (44%), Positives = 271/424 (63%), Gaps = 6/424 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDG---MDTMVCY 57
           M+ F+   G L  E+V L ++A  V TP Y YS+  +E++Y    +A       D ++ +
Sbjct: 1   MNHFELRGGELFCEDVPLARIAQAVGTPVYVYSSATLERHYTVLRDALVAHGVKDPLIAF 60

Query: 58  ALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQS 117
           A+KANSN AV++TLA LG+G D+VSEGE+RRALAA VP ERIVFSGVGKT  E+  ALQ+
Sbjct: 61  AVKANSNVAVLRTLARLGAGADVVSEGEVRRALAAGVPPERIVFSGVGKTEAEVAFALQA 120

Query: 118 GIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQ 177
           G+   NVESE EL  +++ A  LG +A IA RVNPD+ A  H+KISTGK E+KFG+   +
Sbjct: 121 GVAEINVESEPELDLVDRVAQRLGVRAQIAIRVNPDVQAGGHEKISTGKSENKFGVSFSE 180

Query: 178 IHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVG 237
              LYA AS L GV+  GV  HIGSQI  +    +AF  +R L ++L+  G  ++ +D+G
Sbjct: 181 AERLYAKASNLAGVRPVGVACHIGSQITDLAPMAEAFAKMRGLVERLQREGLRVERLDLG 240

Query: 238 GGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISI-KKS 296
           GGLG+ Y +   PPS  DYA++I +  G L   +  EPGR + A+ G+L+  V  + ++ 
Sbjct: 241 GGLGVPYFNQPEPPSPDDYAAMIAETVGGLDVGLAFEPGRMIAANAGVLIAGVTHVHERP 300

Query: 297 ADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRK 356
             + F++LD AMND +RP +YDAYH+I  +    G+      D+VGP+CETGD    +R 
Sbjct: 301 EGRRFLVLDAAMNDLIRPAMYDAYHDIRAVRPREGEARPY--DVVGPVCETGDTFTRDRA 358

Query: 357 IALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +    PGDL+     GAYGA  +  YNSRLL+PE++V G++F ++RPR T+ +++  +  
Sbjct: 359 LPPLEPGDLVAFMTAGAYGAAMASEYNSRLLVPEVLVKGAEFAVVRPRPTYDDMLARERP 418

Query: 417 PAWL 420
             WL
Sbjct: 419 APWL 422


>gi|91776793|ref|YP_546549.1| diaminopimelate decarboxylase [Methylobacillus flagellatus KT]
 gi|91710780|gb|ABE50708.1| diaminopimelate decarboxylase [Methylobacillus flagellatus KT]
          Length = 445

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 199/414 (48%), Positives = 267/414 (64%), Gaps = 4/414 (0%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
           F+   G LHAENV L ++A    TP Y YS  A+E  Y  F+  FDG D +VC+A+K+N 
Sbjct: 33  FQLKNGILHAENVPLTRIADEFGTPTYVYSRAALESAYTRFAAGFDGQDHLVCFAVKSNP 92

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFN 123
           + AV+   A LG+G DIVS GEL R LAA     ++VFSGVGKT  E++ AL +GI+CFN
Sbjct: 93  SLAVLNLFARLGAGFDIVSGGELARVLAAGGDPAKVVFSGVGKTETEMETALNAGIFCFN 152

Query: 124 VESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA 183
           VES SEL  LN  A  LGK AP++ RVNP+++A TH  ISTG K +KFG+      +LY 
Sbjct: 153 VESASELDRLNDVAGRLGKTAPVSLRVNPNVDAKTHPYISTGLKNNKFGVAYEDAFNLYQ 212

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIA 243
           +A++LP + + GVD HIGSQ+ ++  F  AF  +  L  QL + G  + HID+GGG+GI 
Sbjct: 213 HAASLPNIAVHGVDCHIGSQLTELSPFMDAFDRVLALVDQLEAEGIRVAHIDLGGGIGIC 272

Query: 244 YHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVI 303
           Y +D  PP  + YA+ + Q  G+ + K++ EPGR LV + G L+TKV  +K +  K F I
Sbjct: 273 Y-ADETPPDFAAYAAAMLQKLGDRKVKLVFEPGRALVGNAGALITKVEYLKHTEAKNFAI 331

Query: 304 LDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHA-DIVGPICETGDFIALNRKIALPRP 362
           +D AMND MRP LYDAYHEI  +V PA D       +IVGP+CE+GDF+  +RK+AL + 
Sbjct: 332 VDAAMNDLMRPALYDAYHEIAAVV-PATDPSSAQVYEIVGPVCESGDFLGHDRKLAL-QQ 389

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           GDLL +   GAYG   S  YN+R    E+MV+G + H+IR R T  +L  L+ I
Sbjct: 390 GDLLAVLSAGAYGMSMSSNYNTRPRAAEVMVDGDKTHLIRERETVAQLFALEKI 443


>gi|308271344|emb|CBX27952.1| Diaminopimelate decarboxylase [uncultured Desulfobacterium sp.]
          Length = 427

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/420 (46%), Positives = 274/420 (65%), Gaps = 3/420 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y +  L+ ENV +  +   + TP Y YS   +++++  F++AF G++ +VC++ K
Sbjct: 11  MNHFIYRDKELYCENVPVRNIVQKIGTPLYIYSHATLKRHFKAFNDAFKGVNKLVCFSAK 70

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           AN+N A++   + LG GLDIVS GEL R L A   + +IV+SGVGK IDEID AL+ GI 
Sbjct: 71  ANTNLAILSLFSKLGGGLDIVSGGELYRGLKAGYASNKIVYSGVGKRIDEIDYALKMGIL 130

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL+ ++QRA  L KKAP+A RVNPD++  TH  ISTG K++KFGI I     
Sbjct: 131 MFNVESMEELEIVDQRAGLLKKKAPVAIRVNPDVDPKTHPYISTGMKKNKFGINIEAAME 190

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A+ L  +K+ G+D HIGSQI Q   F  A  +L+ + + L +   NI+++D+GGGL
Sbjct: 191 AYKVAAKLKNIKVIGLDCHIGSQITQTGPFKDALYILKTMIKDLAACKINIKYLDLGGGL 250

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y+ D  PP   +YA+ I +  G+ + K+I EPGR +V + GILVTKV+  K +  K 
Sbjct: 251 GITYN-DEEPPDPVEYANAIKEVIGDTKVKLIFEPGRVIVGNAGILVTKVLYRKSTGVKE 309

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F+I+D  MND +RPTLY+A+H I  +V+   D   I ADIVGPICE+GDF+AL+R I   
Sbjct: 310 FIIVDAGMNDLVRPTLYEAFHAIKPVVD--SDNEEIKADIVGPICESGDFLALDRNIQKV 367

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
             GDLL +  +GAYG V S  Y SRL + E+MVNG +F + R R  +++L   + IP +L
Sbjct: 368 EQGDLLAVMSSGAYGFVMSSNYCSRLKLAEVMVNGDKFQVARKRQKYEDLTRGEIIPDFL 427


>gi|218517060|ref|ZP_03513900.1| diaminopimelate decarboxylase protein [Rhizobium etli 8C-3]
          Length = 294

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 176/294 (59%), Positives = 232/294 (78%), Gaps = 1/294 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y +G LHAENV + ++A  V TPFY YST  +E++Y  FS AF  MD+MVCYA+K
Sbjct: 1   MNHFEYRDGILHAENVPVPEIAKAVGTPFYVYSTATLERHYRVFSEAFADMDSMVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQAV+KTL  LG+G+D+VSEGELRRALAA +PA RI+FSGVGKT  E+D AL++GIY
Sbjct: 61  ANSNQAVLKTLGRLGAGIDVVSEGELRRALAADIPASRIMFSGVGKTPSEMDFALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ LNQRAVS GKKAP++FR+NPD++A TH KISTGKKE+KFGI   +  +
Sbjct: 121 CFNVESEPELEILNQRAVSAGKKAPVSFRINPDVDAKTHSKISTGKKENKFGISWERARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A+ LPG++++G+DMHIGSQI +++ F  AFKLLRDL   LR++GH I H+D+GGGL
Sbjct: 181 IYAHAAKLPGIEVTGIDMHIGSQITELQPFDDAFKLLRDLVATLRADGHTIDHVDIGGGL 240

Query: 241 GIAYHSDHRPPSSSD-YASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISI 293
           G+ Y  D+ PP   D YA+++     +L CK+I EPGR +V + GILVT+V+ +
Sbjct: 241 GVPYKDDNNPPPLPDAYAAIVKNQLRDLNCKVITEPGRLIVGNAGILVTEVLYV 294


>gi|114799974|ref|YP_762135.1| diaminopimelate decarboxylase [Hyphomonas neptunium ATCC 15444]
 gi|114740148|gb|ABI78273.1| diaminopimelate decarboxylase [Hyphomonas neptunium ATCC 15444]
          Length = 424

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/420 (46%), Positives = 267/420 (63%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G L  E V L ++A  V TP Y YST  +E++    + AF     ++ Y++K
Sbjct: 1   MHHFNYAGGRLQCEGVDLGRVADEVGTPVYVYSTATLERHARVIAEAFSSQKVLIAYSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           AN N AV+ TLA  G G D+VS GE++RA+ A +PA RIVFSGVGKT  E+ LAL++GI+
Sbjct: 61  ANGNLAVLATLAAEGCGADVVSGGEMQRAMKAGIPAARIVFSGVGKTAAEMKLALEAGIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL+ L++ A  LG KAPIA RVNPD+ A  H  ISTGK  DKFG+P  +  +
Sbjct: 121 QFNVESAGELRLLSRVASGLGLKAPIALRVNPDVAAGGHPNISTGKSGDKFGVPWGEAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LYA A  LPG+++ GVD+HIGSQI ++     AF+ +  L  +LR  GH+I+ IDVGGGL
Sbjct: 181 LYAEAGKLPGIQVVGVDVHIGSQIGELGPMRAAFEKVVALALRLRGQGHDIRRIDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y     P   S YA++I +       ++ILEPGR +  + G+L+T  +  K++ D+T
Sbjct: 241 GIPYRETDAPAPPSAYAAMIAEVTAGHGFEVILEPGRVIAGNAGVLLTTALYEKEAPDRT 300

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F+I+D  MND +RP LY A+H+I  +  PA D      D+VGPICE+ D  A  R +   
Sbjct: 301 FLIIDAGMNDLIRPALYGAHHDIRPLDEPAQDAAEKVYDVVGPICESTDKFATARTLPKV 360

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
            PGD L     GAYGAV S  YN+R L+PE++V+G ++ I+R R  F+E+  L+ +P W+
Sbjct: 361 TPGDRLAFMSAGAYGAVLSSAYNARPLVPEVLVSGDRYSIVRRRPDFEEMTMLEEVPDWI 420


>gi|304309745|ref|YP_003809343.1| Diaminopimelate decarboxylase (DAP decarboxylase) [gamma
           proteobacterium HdN1]
 gi|301795478|emb|CBL43676.1| Diaminopimelate decarboxylase (DAP decarboxylase) [gamma
           proteobacterium HdN1]
          Length = 422

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 202/421 (47%), Positives = 273/421 (64%), Gaps = 9/421 (2%)

Query: 2   SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKA 61
           SAF Y    LHAE V+L +LA  V TP Y YS +AIE+ +L F  AF     +VC+A+KA
Sbjct: 3   SAFHYQNHELHAEQVNLTQLAEQVGTPAYVYSRSAIEQQWLAFDRAFGAHPHLVCFAVKA 62

Query: 62  NSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYC 121
           NSN AV+  LA LG+G DIVSEGEL R L A    +++VFSGVGK   E+  AL  G+ C
Sbjct: 63  NSNIAVLNLLARLGAGFDIVSEGELERVLRAGGDPKKVVFSGVGKQPAEMARALTVGVRC 122

Query: 122 FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSL 181
           FNVESESEL TLNQ A +LG KAP++ RVNPD++A TH  ISTG KE+KFGI I +   +
Sbjct: 123 FNVESESELHTLNQVAATLGVKAPVSLRVNPDVDAQTHPYISTGLKENKFGIDIDRALQV 182

Query: 182 YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG 241
           Y  AS LP + I GVD HIGSQ+ Q+  F  A   +  L   L++ G  ++H+D+GGGLG
Sbjct: 183 YRDASELPHINIVGVDCHIGSQLTQLAPFLDALDRVLVLVDALKAEGIALRHLDLGGGLG 242

Query: 242 IAYHSDHRPPSSSDYASLI------HQYFGNLQCKIILEPGRFLVADVGILVTKVISIKK 295
           + Y ++ +PPS SDY   +      H  FG    +IILEPGR +VA+ G+L+T+++ +K+
Sbjct: 243 VCYRNE-QPPSPSDYVQALLTRLGQHPEFGKQGIEIILEPGRAIVANAGVLLTRIMGLKE 301

Query: 296 SADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNR 355
           +  + F I+D AMND +RP LY A+ EI   V    D      DIVGP+CETGDF+   R
Sbjct: 302 TPARKFAIIDGAMNDLIRPALYGAWQEI-VAVKERQDSPEATYDIVGPVCETGDFLGKER 360

Query: 356 KIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
            + + + GDLL ++  GAYG V S  YN+R    E++V+  QFHI+R R ++   ++L+S
Sbjct: 361 ALRI-QQGDLLAVKSAGAYGFVMSSNYNTRNRAAEVIVDKEQFHIVRARESYDYQLQLES 419

Query: 416 I 416
           +
Sbjct: 420 L 420


>gi|313202258|ref|YP_004040916.1| diaminopimelate decarboxylase [Methylovorus sp. MP688]
 gi|312441574|gb|ADQ85680.1| diaminopimelate decarboxylase [Methylovorus sp. MP688]
          Length = 415

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 195/416 (46%), Positives = 270/416 (64%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+AF+   G LHAE V L +LA    TP Y YS  A+E  Y  F   F G+D +VC+A+K
Sbjct: 1   MNAFQLKNGQLHAEQVPLNQLAEEFSTPCYVYSRQALETAYRDFQQGFAGVDHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           AN +  V+   A LG+G DIVS GEL R LAA   A ++VFSGVGKT DE+  AL +GI+
Sbjct: 61  ANPSLGVLSVFAKLGAGFDIVSGGELARVLAAGGDASKVVFSGVGKTADEMRAALTAGIF 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN+ A S+GK AP++ RVNP+++A TH  ISTG K +KFG+   Q  +
Sbjct: 121 CFNVESAAELERLNEVAGSMGKIAPVSLRVNPNVDAKTHPYISTGLKNNKFGVAYEQSLA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LY  A+ +P + + GVD HIGSQ+ ++  F  AF  +  L  QL + G  I+HID GGG+
Sbjct: 181 LYQQAAAMPNIDVHGVDCHIGSQLTELSPFLDAFDRVLALVDQLEAAGIAIRHIDAGGGI 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y+ +  PP  + YA+ + +  G+ + K++ EPGR LV + G L+T+V  +K +  K 
Sbjct: 241 GICYN-EETPPDFAAYAAAMLKKLGDRKVKLVFEPGRALVGNAGALLTRVEYLKHTEAKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND MRP LYDAYH+I   V+P      I+ +IVGP+CE+GDF+  +R++ L 
Sbjct: 300 FAIVDAAMNDLMRPALYDAYHQIAE-VSPDATPKEIY-EIVGPVCESGDFLGHDRELGL- 356

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           + GDLL I   GAYG   S  YN+R    E+MV+G+ + +IR R T  EL  L+++
Sbjct: 357 KQGDLLAILSAGAYGMSMSSNYNTRPRAAEVMVDGASYQLIRKRETIAELFALENV 412


>gi|299769073|ref|YP_003731099.1| diaminopimelate decarboxylase [Acinetobacter sp. DR1]
 gi|298699161|gb|ADI89726.1| diaminopimelate decarboxylase [Acinetobacter sp. DR1]
          Length = 416

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 195/414 (47%), Positives = 270/414 (65%), Gaps = 3/414 (0%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           +F    G LHAE  S+E+LA    TP Y YS  A EK+YL    AFD +D  +C+A+K+N
Sbjct: 2   SFTRINGVLHAEQCSMEQLAQQFGTPLYVYSKAAFEKHYLDMDRAFDFIDHQICFAVKSN 61

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+  LA LG+G DIVS GEL R L A   A ++VFSG+GKT  +I+ +L  GI CF
Sbjct: 62  SNLAVLNVLAKLGAGFDIVSGGELARVLKAGGDASKVVFSGLGKTEADIETSLNVGIACF 121

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES +EL  L + A  LGKKAPI+ RVNPD++A TH  ISTG KE+KFGIP   ++  Y
Sbjct: 122 NVESYAELDRLQKVAARLGKKAPISLRVNPDVDAKTHPYISTGLKENKFGIPSDTVYETY 181

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
            YA++LP ++I G+D HIGSQ+ + + F  A   +  + ++L+  G N++HID+GGGLG+
Sbjct: 182 QYAASLPNLEIIGIDCHIGSQLTETKPFVDALDRVMLMIEELKKLGINLKHIDIGGGLGV 241

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y  D  PPS  +YA+ +      L  K+ +EPGR + A+ G+L+TKV  +K ++ + F 
Sbjct: 242 CYK-DETPPSVEEYANSMKPALEKLGLKVYMEPGRSISANAGVLLTKVDLLKPTSHRNFA 300

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND +RP LY+A+ +I  +V P+ D      D+VG ICETGDFI  +R +AL + 
Sbjct: 301 IIDAAMNDLIRPALYEAWMDIQPVV-PSSDTEEKTWDLVGAICETGDFIGKDRSLAL-KE 358

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            DLL +   GAYG V S  YN+R    E+MV+G + H+IR R T + L E +S+
Sbjct: 359 NDLLAVLGAGAYGFVMSSNYNTRGRAAEVMVSGDKAHLIRERETVESLWEKESL 412


>gi|262278116|ref|ZP_06055901.1| diaminopimelate decarboxylase [Acinetobacter calcoaceticus RUH2202]
 gi|262258467|gb|EEY77200.1| diaminopimelate decarboxylase [Acinetobacter calcoaceticus RUH2202]
          Length = 416

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 196/410 (47%), Positives = 267/410 (65%), Gaps = 3/410 (0%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           +F    G LHAE  SLE+LA    TP Y YS TA EK+YL    AFD +D  +C+A+K+N
Sbjct: 2   SFTRINGVLHAEQCSLEQLAQQFGTPLYVYSKTAFEKHYLDMDRAFDFIDHQICFAVKSN 61

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+  LA LG+G DIVS GEL R L A   A ++VFSG+GKT  +I+ +L  GI CF
Sbjct: 62  SNLAVLNVLAKLGAGFDIVSGGELARVLKAGGDASKVVFSGLGKTEADIETSLNVGIACF 121

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES +EL  L + A  LGKKAPI+ RVNPD++A TH  ISTG KE+KFGIP   ++  Y
Sbjct: 122 NVESYAELDRLQKVAARLGKKAPISLRVNPDVDAKTHPYISTGLKENKFGIPSDTVYETY 181

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
            YA++LP ++I G+D HIGSQ+ + + F  A   +  +  +L+  G N++HID+GGGLG+
Sbjct: 182 QYAASLPNLEIIGIDCHIGSQLTETKPFVDALDRVMVMIDELKKLGINLKHIDIGGGLGV 241

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y  D  PPS  +YA+ +      L  K+ +EPGR + A+ G+L+TKV  +K ++ + F 
Sbjct: 242 CY-KDETPPSVEEYANSMKPALEKLGLKVYMEPGRSISANAGVLLTKVDLLKPTSHRNFA 300

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND +RP LY+A+ +I  +V P+ D      D+VG ICETGDFI  +R +AL + 
Sbjct: 301 IIDAAMNDLIRPALYEAWMDIQPVV-PSTDTEEKTWDLVGAICETGDFIGKDRSLAL-KE 358

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
            DLL +   GAYG V S  YN+R    E+MV+G + H+IR R T + L E
Sbjct: 359 NDLLAVLGAGAYGFVMSSNYNTRGRAAEVMVSGDKAHLIRERETVESLWE 408


>gi|291288389|ref|YP_003505205.1| diaminopimelate decarboxylase [Denitrovibrio acetiphilus DSM 12809]
 gi|290885549|gb|ADD69249.1| diaminopimelate decarboxylase [Denitrovibrio acetiphilus DSM 12809]
          Length = 419

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/421 (45%), Positives = 270/421 (64%), Gaps = 4/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           MS+F+Y   +LH ENVSL+++A  V TPFY YS   + K +  F NAF+GMD +VCYA+K
Sbjct: 1   MSSFQYKNETLHCENVSLKQIAEEVGTPFYVYSANGLRKRFREFDNAFEGMDRIVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A  N  V+  L   GSG DIVS GEL RAL A +   +IVF+GVGKT +EI   + S I 
Sbjct: 61  ACGNIGVLALLGSEGSGADIVSGGELHRALKAGMDKNKIVFAGVGKTEEEIKFGISSDIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FN ES  E+  +N+ A  +   A IA RVNPD++A TH  ISTG K++KFGIP+ +   
Sbjct: 121 MFNAESRQEIDLINKCAGEMNATARIAIRVNPDVDAKTHPYISTGLKKNKFGIPVDKAKE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y YAS+LP ++  G+  HIGSQ+ +I  F  A  +L  L + LR NG NI+++D+GGGL
Sbjct: 181 DYIYASSLPNIEAVGIHCHIGSQLTEISPFRDAAAILVKLIKDLRKNGVNIKYLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI YH +H  PS  +YA  I +   +    ++ EPGR +  + G LVTKV+  K++ +K+
Sbjct: 241 GITYHDEH-APSHKEYAEAIKEVIRDEDFTLVFEPGRNISGNAGALVTKVLYTKETEEKS 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND  RP+LY+AYHE+  +   + +++    DIVGPICE+ DF+A +R +   
Sbjct: 300 FKIVDAAMNDLARPSLYNAYHEVQAV--DSTEKM-FTGDIVGPICESSDFLAKDRNMPNV 356

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
           + G L  +  TGAYG   +  YNSR  +PEI+V+G  +HI+R R T+ +L   + IP +L
Sbjct: 357 KRGGLYAVMDTGAYGMTMASNYNSRPRVPEILVDGENYHIVRRRETYDDLTGPEGIPKYL 416

Query: 421 Q 421
           +
Sbjct: 417 R 417


>gi|254000301|ref|YP_003052364.1| diaminopimelate decarboxylase [Methylovorus sp. SIP3-4]
 gi|253986980|gb|ACT51837.1| diaminopimelate decarboxylase [Methylovorus sp. SIP3-4]
          Length = 415

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 194/416 (46%), Positives = 270/416 (64%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+AF+   G LHAE V L +LA    TP Y YS  A+E  Y  F   F G+D +VC+A+K
Sbjct: 1   MNAFQLKNGQLHAEQVPLNQLAEEFSTPCYVYSRQALETAYRDFQQGFAGVDHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           AN +  V+   A LG+G DIVS GEL R LAA   A ++VFSGVGKT DE+  AL +GI+
Sbjct: 61  ANPSLGVLSVFAKLGAGFDIVSGGELARVLAAGGDASKVVFSGVGKTADEMRAALTAGIF 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN+ A S+GK AP++ RVNP+++A TH  ISTG K +KFG+   Q  +
Sbjct: 121 CFNVESAAELERLNEVAGSMGKIAPVSLRVNPNVDAKTHPYISTGLKNNKFGVAYEQSLA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LY  A+ +P + + GVD HIGSQ+ ++  F  AF  +  L  QL + G  I+HID GGG+
Sbjct: 181 LYQQAAAMPNIDVHGVDCHIGSQLTELSPFLDAFDRVLALVDQLEAAGIAIRHIDAGGGI 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y+ +  PP  + YA+ + +  G+ + K++ EPGR LV + G L+T+V  +K +  K 
Sbjct: 241 GICYN-EETPPDFAAYAAAMLKKLGDRKVKLVFEPGRALVGNAGALLTRVEYLKHTEAKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND MRP LYDAYH+I   V+P      I+ +IVGP+CE+GDF+  +R++ L 
Sbjct: 300 FAIVDAAMNDLMRPALYDAYHQIAE-VSPDATPKEIY-EIVGPVCESGDFLGHDRELGL- 356

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           + GDLL I   GAYG   S  YN+R    E+MV+G+ + +IR R +  EL  L+++
Sbjct: 357 KQGDLLAILSAGAYGMSMSSNYNTRPRAAEVMVDGASYQLIRKRESISELFALENV 412


>gi|297570155|ref|YP_003691499.1| diaminopimelate decarboxylase [Desulfurivibrio alkaliphilus AHT2]
 gi|296926070|gb|ADH86880.1| diaminopimelate decarboxylase [Desulfurivibrio alkaliphilus AHT2]
          Length = 430

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 189/433 (43%), Positives = 277/433 (63%), Gaps = 13/433 (3%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y +G L AE V +  +A  V TPFY YST  +E+++    ++F  +  + C+A+K
Sbjct: 1   MDHFQYRDGVLGAEEVPVPAIAEAVGTPFYLYSTATLERHFKALDDSFADLAHLTCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SN A+++  A LG G DIVS GEL RALAA +   +IV+SGVGKT  EI  A+++GI 
Sbjct: 61  ACSNIAILRLFARLGGGADIVSGGELYRALAAGIDPGKIVYSGVGKTRAEIRQAIEAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FN+ESE EL+ + Q A  L   A I+FRVNPD++  TH  ISTG  ++KFGIPI +  +
Sbjct: 121 MFNLESEQELEVVAQCATELQTTARISFRVNPDVDPQTHAYISTGLAKNKFGIPIAEAPA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A  L GV+I GV  HIGSQ+ ++  F      L+    +L ++G  ++++D+GGGL
Sbjct: 181 VYRRARELAGVEIVGVSCHIGSQLTKVSPFVDTIDKLKKFLARLAADGIAVKYLDIGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKK----- 295
           GI Y+ +  PP  + Y + + Q  G L C +ILEPGR +V + GI+VT+V+  K      
Sbjct: 241 GIKYNQEE-PPEPAAYGAAVRQALGELDCTLILEPGRVIVGNAGIMVTRVLYTKSGPKSS 299

Query: 296 -----SADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDF 350
                +  K F+++D  MND  RP+LYDAYH I  +V   GD     AD+VGPICETGDF
Sbjct: 300 PENSHNGQKKFIVVDAGMNDLFRPSLYDAYHAIVPVVQ--GDGATQTADVVGPICETGDF 357

Query: 351 IALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
           +A ++++   RPG+LL ++  GAYG   +  YNSR  + E++VNG++FH+IR R ++++L
Sbjct: 358 LARDQEVPAARPGELLAVKSAGAYGFTMASNYNSRPRVAEVLVNGTEFHVIRRRESYEDL 417

Query: 411 IELDSIPAWLQKT 423
           I  + IPA+L ++
Sbjct: 418 IRGEEIPAFLNRS 430


>gi|94265420|ref|ZP_01289172.1| Diaminopimelate decarboxylase [delta proteobacterium MLMS-1]
 gi|94266455|ref|ZP_01290148.1| Diaminopimelate decarboxylase [delta proteobacterium MLMS-1]
 gi|93452933|gb|EAT03438.1| Diaminopimelate decarboxylase [delta proteobacterium MLMS-1]
 gi|93454077|gb|EAT04412.1| Diaminopimelate decarboxylase [delta proteobacterium MLMS-1]
          Length = 416

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/417 (46%), Positives = 267/417 (64%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y +G LHAE V++ ++A  V TPFY YS   + +++  F  AF G+D + C+A+K
Sbjct: 1   MHHFEYKDGVLHAEEVAVPEIAAAVGTPFYLYSAATLRRHFTAFDGAFAGLDHLSCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A+SN A+++  A LG G DIVS GEL RAL A +  ERIV+SGVGKT  EI  AL +GI 
Sbjct: 61  ASSNIAILRLFARLGGGADIVSGGELFRALKAGIAPERIVYSGVGKTRAEIRQALVAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FN+ES  EL  + Q A  LG+ A ++FRVNPD++  TH  ISTG  E+KFGI I +  +
Sbjct: 121 MFNLESAQELTAIQQCAAELGQTARVSFRVNPDVDPQTHAYISTGLAENKFGIAIEEALA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A  +  V+I G+  HIGSQ+ Q+  F      L+    +L   G NI+++D+GGGL
Sbjct: 181 VYKEARQMANVEIVGLSCHIGSQLTQVSPFVDTVDKLKKFMAELNGAGINIRYLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  ++ PP  ++Y   + Q  G+L C +ILEPGR +V + GILVT+V+   KS  K 
Sbjct: 241 GINYQGEN-PPEPAEYGMALRQALGDLPCTLILEPGRVIVGNAGILVTRVL-FTKSGRKN 298

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FV++D  MND  RP+LYDAYH I  +      ++   AD+VGPICETGDF+A  R+IA  
Sbjct: 299 FVVVDAGMNDLARPSLYDAYHAIQPVTRREDGQM--VADVVGPICETGDFLARGREIARA 356

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIP 417
            P DLL +   GAYG   +  YNSR  +PE++V+  QF  IR R T+++L+  ++IP
Sbjct: 357 VPDDLLAVMSAGAYGFTMASNYNSRPRVPEVLVSEDQFVEIRRRETYEDLVRGETIP 413


>gi|332534419|ref|ZP_08410259.1| diaminopimelate decarboxylase [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332036153|gb|EGI72628.1| diaminopimelate decarboxylase [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 417

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 202/418 (48%), Positives = 272/418 (65%), Gaps = 5/418 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L AE+VS+  +A    TP Y YS    E++YL F+NA     ++VCYA+K
Sbjct: 1   MDYFNYKNNQLFAEDVSVASIAQQYGTPCYVYSRATFERHYLAFANATKNHKSLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS+GEL R + A   A ++VFSGV KT DEI  AL+ GI 
Sbjct: 61  ANSNIAVLNILARLGSGFDIVSKGELARVIKAGGDASKVVFSGVAKTSDEIAYALKLGIK 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SEL+ +++ A  L  +API+ RVNPDI+A TH  ISTG KE+KFGI I    S
Sbjct: 121 CFNVESASELERISEVACELNLEAPISIRVNPDIDAKTHPYISTGLKENKFGIDIQTAVS 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LPG+K+ GVD HIGSQ+ Q+  F +A   L  L  +L++NG  + H+D+GGGL
Sbjct: 181 VYQQAAALPGLKVIGVDCHIGSQLTQVRPFLEALDKLMALIDELKTNGIELTHLDIGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y ++ +PP  S+YA+ + +   N +  ++I EPGR + A+ GILVT+V  IK++ DK
Sbjct: 241 GVPYDNE-QPPHPSEYAAQVTERLANYKHLELIFEPGRAIAANAGILVTQVEFIKQNQDK 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHA-DIVGPICETGDFIALNRKIA 358
            F I+D  MND +RP LY A+ +I   V+   D    H  DIVGP+CETGDF+  +R++A
Sbjct: 300 FFAIVDAGMNDMLRPALYQAWQKI-IPVSVRDDETPTHNFDIVGPVCETGDFLGKDRELA 358

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L + GDLL     GAYG   S  YNSR  + EIMV+G Q H+IR R T + L + + +
Sbjct: 359 L-KQGDLLAQRSAGAYGFTMSSNYNSRPRVAEIMVDGQQHHLIRERETIESLYQGEKV 415


>gi|254360888|ref|ZP_04977034.1| diaminopimelate decarboxylase [Mannheimia haemolytica PHL213]
 gi|261493013|ref|ZP_05989555.1| diaminopimelate decarboxylase [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|153092367|gb|EDN73430.1| diaminopimelate decarboxylase [Mannheimia haemolytica PHL213]
 gi|261311357|gb|EEY12518.1| diaminopimelate decarboxylase [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 416

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 197/417 (47%), Positives = 276/417 (66%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L AE V++  +     TP Y YS + +E+++  F+NAF     +VC+A+K
Sbjct: 1   MNHFEYKNNQLFAEEVAIADIIEQYGTPAYVYSRSTLERHWHAFNNAFGSHPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN A++  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+  EI  AL+ GI 
Sbjct: 61  SNSNIALLNVMARLGSGFDIVSQGELERVLAAGGEASKVVFSGVAKSHSEIKRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ES SEL  +NQ A  LGK API+ RVNPD++A+TH  ISTG KE+KFG+ + Q   
Sbjct: 121 CFNIESVSELHRINQVAGELGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVTQARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A TLP VKI+G+D HIGSQ+ +++ F  A   L  L +QLR +G  + H+D+GGGL
Sbjct: 181 VYRLAKTLPNVKITGMDCHIGSQLTELQPFLDATDRLIILMEQLREDGIELHHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y+ +  PP  ++YA +L+ +  G    +II+EPGR + A+ GILVTKV  +K++ D+
Sbjct: 241 GVPYNGE-EPPHPTEYAKALLEKLKGYENLEIIIEPGRAITANAGILVTKVEYLKQNEDR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY+AY +I   V+   +R     D+VGPICET DF+   R++A+
Sbjct: 300 NFAIVDTGMNDMIRPALYEAYMQITE-VDKTLNRDKAVYDVVGPICETSDFLGKQRELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GDL+ I   GAYGA  S TYNSR    EIMV+G+Q H+I+ R TF +L  L+ +
Sbjct: 359 SE-GDLIAIRSAGAYGAAMSSTYNSRPQAAEIMVDGNQAHLIKARATFADLWRLEKL 414


>gi|330962353|gb|EGH62613.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 415

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 197/416 (47%), Positives = 264/416 (63%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  +A    TP Y YS   IE  Y  +++A DGM  +VC+A+K
Sbjct: 1   MDAFNYRDGELFAEGVALSGIAERFGTPTYVYSRAHIEAQYRAYADALDGMAHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   AE+IVFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGKAEKIVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L + A  L  +API+ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNVESTDELERLQEVAAELNVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIAAAED 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS LP +++ GVD HIGSQ+  +E F  A   L DL  +L   G ++ HID+GGGL
Sbjct: 181 VYIRASQLPNLEVIGVDCHIGSQLTTLEPFIDALDRLLDLVDRLGDCGIHLHHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP ++DY   + +        ++ EPGRF+VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEEPPLAADYIKAVRERLAGRDLGLLFEPGRFIVANAGVLLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ ++   V P       + DIVGPICETGDF+A +R++AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVT-AVRPRDSEARAY-DIVGPICETGDFLAKDRELALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+GSQ   +R R T  EL   +S+
Sbjct: 358 E-GDLLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGSQAFEVRRRETVAELFAGESL 412


>gi|315497547|ref|YP_004086351.1| diaminopimelate decarboxylase [Asticcacaulis excentricus CB 48]
 gi|315415559|gb|ADU12200.1| diaminopimelate decarboxylase [Asticcacaulis excentricus CB 48]
          Length = 438

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/432 (42%), Positives = 268/432 (62%), Gaps = 12/432 (2%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTM------ 54
           M+ F   +G +HAE VS+ +LA  V TP Y YS+   E+++  FS A    D +      
Sbjct: 1   MNHFDIRDGEMHAEGVSIRELAERVGTPLYVYSSATFERHFQVFSQALWAQDALQSPKNE 60

Query: 55  ---VCYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEI 111
              + YA KANSN AV++TLA  G+G D VSEGE+R+AL A +P ERIVFSGVGKT +E+
Sbjct: 61  APLIAYATKANSNLAVLQTLAEQGAGADTVSEGEIRKALTAGIPPERIVFSGVGKTDEEM 120

Query: 112 DLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKF 171
             AL++GIY  NVES+ EL+ L+  A SLG  API  R+NP + A  H KI+TG  +DKF
Sbjct: 121 AFALKTGIYQLNVESKPELERLSHVAASLGLVAPIVIRINPGVGAGGHAKITTGGAKDKF 180

Query: 172 GIPIHQIHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNI 231
           G+   +  +LY  A+  P +   G+  HIGSQI  +     AF  +R   Q+LR+ G ++
Sbjct: 181 GVSAREAIALYGQAAADPNIAPMGIACHIGSQITDLAPMQAAFSKMRGWVQELRAGGLSV 240

Query: 232 QHIDVGGGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVI 291
           + +D+GGGLG+ Y +   PPS  D+A ++    GNL  +   EPGR + A+ GILV++VI
Sbjct: 241 ERLDLGGGLGVPYFNMSEPPSPEDFAQMVALTVGNLGVRYTFEPGRLIAANAGILVSRVI 300

Query: 292 SIKKSAD--KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGD 349
            I +  D  + F+++D AMND +RP +YDAYH+I  +V    +    + D+VGP+CETGD
Sbjct: 301 HIHEREDSGQKFLVVDAAMNDLIRPAMYDAYHDIRPVVAVQTNETATY-DVVGPVCETGD 359

Query: 350 FIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
                R +   + GDL+     GAYGAV    YNSR L PE++V  + + ++RPR +++E
Sbjct: 360 TFTRGRDLPALKAGDLVAFMSAGAYGAVMGSEYNSRPLAPEVLVRDTDWAVVRPRPSYEE 419

Query: 410 LIELDSIPAWLQ 421
           ++  + +P WL+
Sbjct: 420 MMNREVLPEWLR 431


>gi|302189433|ref|ZP_07266106.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. syringae
           642]
          Length = 415

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 199/416 (47%), Positives = 261/416 (62%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  +A    TP Y YS   IE  Y  +++A  GM  MVC+A+K
Sbjct: 1   MDAFNYRDGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYRAYADALSGMPHMVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   AERIVFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGKAERIVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L + A  L  +API+ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNVESTDELERLQEVAAELNVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIAAAED 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS LP +++ GVD HIGSQ+  +E F  A   L DL  +L   G ++ HID+GGGL
Sbjct: 181 VYIRASQLPNLEVIGVDCHIGSQLTTLEPFIDALDRLLDLVDRLGDCGIHLHHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP ++DY   + +        ++ EPGRF+VA+ G L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEEPPLAADYIKAVRERLAGRDLGLLFEPGRFIVANAGTLLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ E+   V P       + DIVGPICETGDF+A  R++AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMEVT-AVRPRDSEPRAY-DIVGPICETGDFLAKGRELALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+GSQ   +R R T  EL   +S+
Sbjct: 358 E-GDLLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGSQAFEVRRRETVAELFAGESL 412


>gi|82701675|ref|YP_411241.1| diaminopimelate decarboxylase [Nitrosospira multiformis ATCC 25196]
 gi|82409740|gb|ABB73849.1| diaminopimelate decarboxylase [Nitrosospira multiformis ATCC 25196]
          Length = 418

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 195/417 (46%), Positives = 270/417 (64%), Gaps = 9/417 (2%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           +F Y  G L AE+V LE++A    TP Y YS  A+   Y  F +AF G D +VCYA+KAN
Sbjct: 6   SFSYRNGHLWAESVQLERIALEFGTPCYAYSRAALTTAYCEFDDAFAGRDHLVCYAVKAN 65

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN  ++  LA LGSG DIVS GEL+R L A    ++IVFSGVGK   E+  AL++GI CF
Sbjct: 66  SNLGILNLLARLGSGFDIVSGGELQRVLKAGGDPQKIVFSGVGKQPAEMKAALEAGILCF 125

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVESE+EL  LN+ A  +GK AP++ RVNPD++A TH  ISTG KE+KFGIP  +  +LY
Sbjct: 126 NVESEAELHGLNRVAGEMGKVAPVSLRVNPDVDAKTHPYISTGLKENKFGIPFDEAEALY 185

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
           A A  L  V+++G+D HIGSQ+ ++  F +  K +  L  +L + G  I+H+D+GGGLGI
Sbjct: 186 ASAQALGNVRVAGLDCHIGSQLTELAPFIETCKKMLGLLDRLEAQGLEIEHLDLGGGLGI 245

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y  ++ PPS+ +Y   +    GN + KI++EPGR LV + G+L+T V  +K +  + F 
Sbjct: 246 RYAGEN-PPSAREYVEALRSVVGNRRQKILIEPGRSLVGNAGVLLTTVEYLKPTPHRDFA 304

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHA---DIVGPICETGDFIALNRKIAL 359
           I+D AMND MRP LY AYHEI  +V     R  + A    +VGP+CETGDF+  +R +AL
Sbjct: 305 IVDAAMNDLMRPALYKAYHEILPVVA----RNEMDAKTYQVVGPVCETGDFLGHDRHLAL 360

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            + GDLL +   GAYG   S  YN+R    E+M++G + H+IR R + ++L+  + I
Sbjct: 361 AQ-GDLLAVMSAGAYGMSMSSNYNARPRAAEVMIDGDRIHLIRERESVEQLMAGEKI 416


>gi|153873428|ref|ZP_02002015.1| diaminopimelate decarboxylase [Beggiatoa sp. PS]
 gi|152070106|gb|EDN67985.1| diaminopimelate decarboxylase [Beggiatoa sp. PS]
          Length = 414

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 196/416 (47%), Positives = 267/416 (64%), Gaps = 3/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G L+AE+V+L  +A    TP Y YS   +E+++  F NA      ++CYA+K
Sbjct: 1   MDYFNYRDGILYAEDVNLLTVAKAYGTPCYVYSRATLERHWHAFDNALKNHRHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LGSG DIVS GEL R L A     +IVFSGVGKT+ E+  AL+ GI 
Sbjct: 61  ANSNLTVLSVLARLGSGFDIVSGGELERVLRAGGDPNKIVFSGVGKTVIEMRRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE+EL  LNQ A  +GK AP++ RVNPD++A TH  ISTG KE+KFGI I+    
Sbjct: 121 CFNVESEAELLRLNQVAGDMGKMAPVSLRVNPDVDAKTHPYISTGLKENKFGIDINSAID 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A  LP ++I G+D HIGSQ+ Q  SF  A + +  L   LR    ++QHID+GGGL
Sbjct: 181 VYKKAKALPHLQIIGIDCHIGSQLTQTTSFVDALQRVIVLVNTLRDKNIHLQHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ YH++  PP   +Y   + Q  G+   +IILEPGR + A+ G+L+TKV  +K +ADK 
Sbjct: 241 GVRYHTE-TPPEPENYVQALTQVLGDTPYEIILEPGRAIAANAGVLLTKVEYLKHTADKH 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ +I   V P  +    + DIVGPICETGDF+  NR +AL 
Sbjct: 300 FAIVDAAMNDLLRPALYTAWQDI-LPVQPRKNETEQNYDIVGPICETGDFLGKNRALAL- 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              D+L +  +GAYG   S  YN+R  + E+MV+G Q  ++R R T  +++ L+++
Sbjct: 358 HESDVLAVRTSGAYGFTMSSNYNTRPRVAELMVDGEQVAVVRRRETIDDILALENL 413


>gi|261495167|ref|ZP_05991630.1| diaminopimelate decarboxylase [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261309143|gb|EEY10383.1| diaminopimelate decarboxylase [Mannheimia haemolytica serotype A2
           str. OVINE]
          Length = 416

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 197/417 (47%), Positives = 275/417 (65%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L AE V++  +     TP Y YS + +E++   F+NAF     +VC+A+K
Sbjct: 1   MNHFEYKNNQLFAEEVAIADIIEQYGTPAYVYSRSTLERHLHAFNNAFGSHPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN A++  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+  EI  AL+ GI 
Sbjct: 61  SNSNIALLNVMARLGSGFDIVSQGELERVLAAGGEASKVVFSGVAKSHSEIKRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ES SEL  +NQ A  LGK API+ RVNPD++A+TH  ISTG KE+KFG+ + Q   
Sbjct: 121 CFNIESVSELHRINQVAGELGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVTQARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A TLP VKI+G+D HIGSQ+ +++ F  A   L  L +QLR +G  + H+D+GGGL
Sbjct: 181 VYRLAKTLPNVKITGMDCHIGSQLTELQPFLDATDRLIILMEQLREDGIELHHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y+ +  PP  ++YA +L+ +  G    +II+EPGR + A+ GILVTKV  +K++ D+
Sbjct: 241 GVPYNGE-EPPHPTEYAKALLEKLKGYENLEIIIEPGRAITANAGILVTKVEYLKQNEDR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY+AY +I   V+   +R     D+VGPICET DF+   R++A+
Sbjct: 300 NFAIVDTGMNDMIRPALYEAYMQITE-VDKTLNRDKAVYDVVGPICETSDFLGKQRELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GDL+ I   GAYGA  S TYNSR    EIMV+G+Q H+I+ R TF +L  L+ +
Sbjct: 359 SE-GDLIAIRSAGAYGAAMSSTYNSRPQAAEIMVDGNQAHLIKARATFADLWRLEKL 414


>gi|293609896|ref|ZP_06692198.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828348|gb|EFF86711.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 416

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 192/410 (46%), Positives = 266/410 (64%), Gaps = 3/410 (0%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           +F    G LHAE  S+E+LA    TP Y YS  A EK+YL    AFD +D  +C+A+K+N
Sbjct: 2   SFTRINGVLHAEQCSMEQLAQQFGTPLYVYSKAAFEKHYLDMDRAFDFIDHQICFAVKSN 61

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+  LA LG+G DIVS GEL R L A   A ++VFSG+GKT  +I+ +L  GI CF
Sbjct: 62  SNIAVLNVLAKLGAGFDIVSGGELARVLKAGGDASKVVFSGLGKTEADIETSLNVGIACF 121

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES +EL  L + A  +GKKAPI+ RVNPD++A TH  ISTG KE+KFGIP   ++  Y
Sbjct: 122 NVESYAELDRLQKVAARIGKKAPISLRVNPDVDAKTHPYISTGLKENKFGIPSDTVYETY 181

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
            YA++LP ++I G+D HIGSQ+ + + F  A   +  + ++L+  G  ++HID+GGGLG+
Sbjct: 182 QYAASLPNLEIIGIDCHIGSQLTETKPFVDALDRVMLMIEELKKLGITLKHIDIGGGLGV 241

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y  D  PPS  +YA+ +      L  K+ +EPGR + A+ G+L+TKV  +K ++ + F 
Sbjct: 242 CYK-DETPPSVEEYANSMKPALEKLGLKVYMEPGRSISANAGVLLTKVDLLKPTSHRNFA 300

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND +RP LY+A+ +I  +V P+ D      D+VG ICETGDFI  +R +AL + 
Sbjct: 301 IIDAAMNDLIRPALYEAWMDIQPVV-PSSDTEEKTWDLVGAICETGDFIGKDRSLAL-KE 358

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
            DLL +   GAYG V S  YN+R    E+MV+G + H+IR R T + L E
Sbjct: 359 NDLLAVLGAGAYGFVMSSNYNTRGRAAEVMVSGDKAHLIRERETVESLWE 408


>gi|213970728|ref|ZP_03398853.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. tomato T1]
 gi|301382616|ref|ZP_07231034.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302061756|ref|ZP_07253297.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. tomato K40]
 gi|302133635|ref|ZP_07259625.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213924562|gb|EEB58132.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. tomato T1]
 gi|331017916|gb|EGH97972.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 415

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 198/416 (47%), Positives = 261/416 (62%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  +A    TP Y YS   IE  Y  F++A  GM  MVC+A+K
Sbjct: 1   MDAFNYRDGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYRAFADALSGMPHMVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   AERIVFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGKAERIVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L + A  L  +API+ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNVESTDELERLQEVAAELNVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIAAAED 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS LP +++ GVD HIGSQ+  +E F  A   L DL  +L   G ++ HID+GGGL
Sbjct: 181 VYIRASQLPNLEVIGVDCHIGSQLTTLEPFIDALDRLLDLVDRLGDCGIHLHHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP + DY   + +        ++ EPGRF+VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEEPPLAGDYIKAVRERLAGRDLGLLFEPGRFIVANAGVLLTQVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ ++   V P       + DIVGPICETGDF+A  R++AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVT-AVRPRDSEPRAY-DIVGPICETGDFLAKGRELALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+G+Q   +R R T  EL   +S+
Sbjct: 358 E-GDLLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGTQAFEVRRRETVAELFAGESL 412


>gi|330964219|gb|EGH64479.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 415

 Score =  378 bits (971), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 198/416 (47%), Positives = 261/416 (62%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  +A    TP Y YS   IE  Y  F++A  GM  MVC+A+K
Sbjct: 1   MDAFNYRDGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYRAFADALSGMPHMVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   AERIVFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGKAERIVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L + A  L  +API+ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNVESTDELERLQEVAAELDVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIAAAED 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS LP +++ GVD HIGSQ+  +E F  A   L DL  +L   G ++ HID+GGGL
Sbjct: 181 VYIRASQLPNLEVIGVDCHIGSQLTTLEPFIDALDRLLDLVDRLGDCGIHLHHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP + DY   + +        ++ EPGRF+VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEEPPLAGDYIKAVRERLAGRDLGLLFEPGRFIVANAGVLLTQVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ ++   V P       + DIVGPICETGDF+A  R++AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVT-AVRPRDSEPRAY-DIVGPICETGDFLAKGRELALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+G+Q   +R R T  EL   +S+
Sbjct: 358 E-GDLLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGTQAFEVRRRETVAELFAGESL 412


>gi|330878499|gb|EGH12648.1| diaminopimelate decarboxylase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 415

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 198/416 (47%), Positives = 261/416 (62%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  +A    TP Y YS   IE  Y  F++A  GM  MVC+A+K
Sbjct: 1   MDAFNYRDGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYRAFADALSGMPHMVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   AERIVFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGKAERIVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L + A  L  +API+ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNVESTDELERLQEVAAELNVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIAAAED 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS LP +++ GVD HIGSQ+  +E F  A   L DL  +L   G ++ HID+GGGL
Sbjct: 181 VYIRASQLPNLEVIGVDCHIGSQLTTLEPFIDALDRLLDLVDRLGDCGIHLHHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP + DY   + +        ++ EPGRF+VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEVPPLAGDYIKAVRERLAGRDLGLLFEPGRFIVANAGVLLTQVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ ++   V P       + DIVGPICETGDF+A  R++AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVT-AVRPRDSEPRAY-DIVGPICETGDFLAKGRELALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+G+Q   +R R T  EL   +S+
Sbjct: 358 E-GDLLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGTQAFEVRRRETVAELFTGESL 412


>gi|325123129|gb|ADY82652.1| diaminopimelate decarboxylase [Acinetobacter calcoaceticus PHEA-2]
          Length = 415

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 194/410 (47%), Positives = 266/410 (64%), Gaps = 4/410 (0%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           +F    G LHAE  S+E+LA    TP Y YS  A EKNYL    AFD +D  +C+A+K+N
Sbjct: 2   SFTRINGVLHAEQCSMEQLAQQFGTPLYVYSKAAFEKNYLDMDRAFDFIDHQICFAVKSN 61

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+  LA LG G DIVS GEL R L A   A ++VFSG+GKT  +I+++L  GI CF
Sbjct: 62  SNIAVLNVLAKLG-GFDIVSGGELARVLKAGGDASKVVFSGLGKTEADIEISLNVGIACF 120

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES +EL  L + A  LGKKAPI+ RVNPD++A TH  ISTG KE+KFGIP   ++  Y
Sbjct: 121 NVESYAELDRLQKVAARLGKKAPISLRVNPDVDAKTHPYISTGLKENKFGIPSDTVYETY 180

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
            YA++LP ++I G+D HIGSQ+ + + F  A   +  + ++L+  G  ++HID+GGGLG+
Sbjct: 181 QYAASLPNLEIIGIDCHIGSQLTETKPFVDALDRVMLMIEELKKLGITLKHIDIGGGLGV 240

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y  D  PPS  +YA+ +      L  K+ +EPGR + A+ G+L+TKV  +K ++ + F 
Sbjct: 241 CYK-DETPPSVEEYANSMKPALEKLGLKVYMEPGRSISANAGVLLTKVDLLKPTSHRNFA 299

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND +RP LY+A+ +I  +V P+ D      D+VG ICETGDFI  +R +AL + 
Sbjct: 300 IIDAAMNDLIRPALYEAWMDIQPVV-PSSDTEEKTWDLVGAICETGDFIGKDRSLAL-KE 357

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
            DLL +   GAYG V S  YN+R    E+MV+G + H+IR R T + L E
Sbjct: 358 NDLLAVLGAGAYGFVMSSNYNTRGRAAEVMVSGDKAHLIRERETVESLWE 407


>gi|148555770|ref|YP_001263352.1| diaminopimelate decarboxylase [Sphingomonas wittichii RW1]
 gi|148500960|gb|ABQ69214.1| diaminopimelate decarboxylase [Sphingomonas wittichii RW1]
          Length = 423

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 189/426 (44%), Positives = 270/426 (63%), Gaps = 9/426 (2%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDT-----MV 55
           M  F   +G LHAE+V+L  +A  V TP Y YST  IE++   F  A   +++     ++
Sbjct: 1   MDHFNLKDGVLHAEDVALPAIAEAVGTPVYVYSTATIERHVAVFKAALAAVESGPEGPLI 60

Query: 56  CYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLAL 115
            +A+KAN N+AV+ TLA  G G D+VS GEL RA AA +PA++IVFSGVGKT  E+ L L
Sbjct: 61  AFAVKANPNRAVLATLARAGLGADVVSGGELLRARAAGIPADKIVFSGVGKTEAEMRLGL 120

Query: 116 QSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPI 175
           + GI+ FN+ESE E + L++ A + G++AP+AFR+NP++ A TH KISTG  EDKFG+  
Sbjct: 121 EQGIFQFNIESEPEAEMLSEVAAATGRRAPVAFRINPNVIAGTHAKISTGGSEDKFGVAY 180

Query: 176 HQIHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHID 235
            +  + YA A+ LPG+ + GV +HIGSQ+  +     AF+ +  L  +LR+ GH I   D
Sbjct: 181 DRAIAAYARAAELPGLDVRGVAVHIGSQLTDLGPSRAAFEKIGALIAELRAAGHRIVTAD 240

Query: 236 VGGGLGIAYH-SDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIK 294
           +GGGLG+ Y  +   PP    Y +++ +       +++ EPGR +V + G+L+++VI +K
Sbjct: 241 LGGGLGVPYDPAKPVPPLPDAYGAMVREVTAGWNTRLVFEPGRVIVGNAGVLLSRVIRVK 300

Query: 295 KSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALN 354
                 FVI+D AMND MRP+LYDA+H+I   V P G  +   A+IVGPICE+GD  A  
Sbjct: 301 PGVTDPFVIVDAAMNDLMRPSLYDAWHDIRA-VTPNGAAM--TANIVGPICESGDSFAKK 357

Query: 355 RKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELD 414
           R +    PGDL+     GAYGA  + TYNSR L PE++VNG Q+ ++R R   + LI  D
Sbjct: 358 RAMDAVGPGDLVTFMTAGAYGATMANTYNSRALTPEVLVNGDQWAVVRERQPIEALIAAD 417

Query: 415 SIPAWL 420
            +P W+
Sbjct: 418 KLPPWV 423


>gi|260556500|ref|ZP_05828718.1| diaminopimelate decarboxylase [Acinetobacter baumannii ATCC 19606]
 gi|260409759|gb|EEX03059.1| diaminopimelate decarboxylase [Acinetobacter baumannii ATCC 19606]
          Length = 416

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 194/410 (47%), Positives = 265/410 (64%), Gaps = 3/410 (0%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           +F    G LHAE  SLE+LA    TP Y YS  A EK+YL    AFD +D  +C+A+K+N
Sbjct: 2   SFTRINGVLHAEQCSLEQLAQQFGTPLYVYSKAAFEKHYLDMDRAFDFIDHQICFAVKSN 61

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+  LA LG+G DIVS GEL R L A   A +IVFSG+GKT  +I+ +L  GI CF
Sbjct: 62  SNIAVLNVLAKLGAGFDIVSGGELARVLKAGGDASKIVFSGLGKTEADIETSLNVGIACF 121

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES +EL  + + A  LGKKAPI+ RVNPD++A TH  ISTG KE+KFGIP   ++  Y
Sbjct: 122 NVESYAELDRIQKVAARLGKKAPISLRVNPDVDAKTHPYISTGLKENKFGIPSDAVYETY 181

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
            YA++LP ++I G+D HIGSQ+ + + F  A   +  +  +L+  G N++HID+GGGLG+
Sbjct: 182 QYAASLPNLEIVGIDCHIGSQLTETKPFVDALDRVIVMIDELKKLGINLKHIDIGGGLGV 241

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y  D  PPS  +YA+ +      L  K+ +EPGR + A+ G+L+TKV  +K +  + F 
Sbjct: 242 CYK-DETPPSVEEYANSMKPALEKLGLKVYMEPGRSISANAGVLLTKVDLLKPTTHRNFA 300

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND +RP LY+A+ +I  +V P  D +    D+VG ICETGDFI  +R +AL + 
Sbjct: 301 IIDAAMNDLIRPALYEAWMDIQPVV-PRTDTVEKTWDLVGAICETGDFIGKDRSLAL-QE 358

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
            DLL +   GAYG V S  YN+R    E+MV+G + ++IR R T + L E
Sbjct: 359 NDLLTVLGAGAYGFVMSSNYNTRGRAAEVMVSGEKSYLIRERETVESLWE 408


>gi|148978773|ref|ZP_01815153.1| diaminopimelate decarboxylase [Vibrionales bacterium SWAT-3]
 gi|145962194|gb|EDK27478.1| diaminopimelate decarboxylase [Vibrionales bacterium SWAT-3]
          Length = 417

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 199/418 (47%), Positives = 271/418 (64%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y E G L AE+V+L +LA    TP Y YS   +E+++  F ++      +VCYA+
Sbjct: 1   MDYFNYQEDGQLWAEDVALSQLAEQYGTPLYVYSRATLERHWNAFDSSVGEHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA LGSG DIVS GEL R +AA     ++VFSGVGKT  E+  AL+  I
Sbjct: 61  KANSNLGVLNTLARLGSGFDIVSGGELERVVAAGGDPAKVVFSGVGKTAAEMKRALELNI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG KAPI+ R+NPD++ANTH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNKVAGELGVKAPISLRINPDVDANTHPYISTGLRDNKFGIAFDRAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           ++YA+A TL  + I G+D HIGSQ+  IE F  A   L  L  QLR++G NI+H+DVGGG
Sbjct: 181 AVYAFAQTLENLSIHGIDCHIGSQLTDIEPFIDATDRLLALIDQLRADGINIKHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  SDYA +L+ +   +   ++I EPGR + A+ G+L+TKV  +K +  
Sbjct: 241 LGVVYR-DELPPQPSDYAKALLARLENHSDLELIFEPGRAIAANAGVLLTKVEFLKPTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I  ++   G+   +  D+VGPICETGDF+  +R++ 
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDIVPVIPRQGE--AVTYDLVGPICETGDFLGKDRELV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L   GDLL +   GAYG V S  YN+R    E+MV+G++ H++R R     L EL++I
Sbjct: 358 L-EEGDLLAVRSAGAYGFVMSSNYNTRSRAAEVMVDGNKTHLVRQREELTSLWELENI 414


>gi|146305308|ref|YP_001185773.1| diaminopimelate decarboxylase [Pseudomonas mendocina ymp]
 gi|145573509|gb|ABP83041.1| diaminopimelate decarboxylase [Pseudomonas mendocina ymp]
          Length = 415

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 195/416 (46%), Positives = 269/416 (64%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  LA    TP Y YS   IE  Y  +++A  GM  +VC+A+K
Sbjct: 1   MEAFTYRDGELFAEGVALSALAQRFGTPTYVYSRAHIEAQYRAYADALAGMPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA     RIVFSGVGK+ D++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSSGELERVLAAGGEPSRIVFSGVGKSRDDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L + A  LG KAP++ RVNPD++A TH  ISTG KE+KFGI I Q  +
Sbjct: 121 CFNVESSVELERLQKVAAELGLKAPVSLRVNPDVDAGTHPYISTGLKENKFGIDIEQAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LP +++ GVD HIGSQ+  +E F  A   L  L  +L + G +I+H+D+GGGL
Sbjct: 181 VYARAAELPNLEVVGVDCHIGSQLTTLEPFLDALDRLLLLVDRLAARGIHIKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D +PP + DY + + +        ++ EPGRF+VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVQYR-DEQPPLAGDYIAAVRKRLAGRDLALVFEPGRFIVANAGVLLTQVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ +++ +    G+  H   D+VGPICETGDF+A +R++ L 
Sbjct: 300 FAIIDAAMNDLIRPALYQAWMDVSPVQPRDGEARHY--DLVGPICETGDFLAKDRQLVL- 356

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+G Q + +R R T QEL   +S+
Sbjct: 357 EEGDLLAVRSAGAYGFVMSSNYNTRGRAAEVLVDGEQAYEVRRRETVQELYAGESL 412


>gi|315125206|ref|YP_004067209.1| diaminopimelate decarboxylase [Pseudoalteromonas sp. SM9913]
 gi|315013719|gb|ADT67057.1| diaminopimelate decarboxylase [Pseudoalteromonas sp. SM9913]
          Length = 417

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 202/418 (48%), Positives = 271/418 (64%), Gaps = 5/418 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L AE+VS+  +A    TP Y YS    E++YL F+NA     ++VCYA+K
Sbjct: 1   MDFFNYKNNQLFAEDVSVATIAQHYGTPCYVYSRATFERHYLAFANAAQDHKSLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LG+G DIVS+GEL R + A   A ++VFSGV KT DEI  AL+ GI 
Sbjct: 61  ANSNIAVLNILARLGAGFDIVSKGELARVIKAGGAANKVVFSGVAKTADEIAYALELGIK 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SEL+ +++ A  L   API+ RVNPDI+A TH  ISTG KE+KFGI I    S
Sbjct: 121 CFNVESISELERISEVACELNLDAPISIRVNPDIDAKTHPYISTGLKENKFGIGIETALS 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y +A++LPG+ I GVD HIGSQ+ Q + F +A   L  L  +L++ G  + H+D+GGGL
Sbjct: 181 VYQHAASLPGLNIVGVDCHIGSQLTQTKPFLEALDKLLALIDELKNAGIELSHLDIGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y+ D +PP  S+YA+ + Q   N +  ++I EPGR + A+ GILVT+V  IK++ DK
Sbjct: 241 GVTYN-DEQPPHPSEYAAQVTQRLTNYRHLELIFEPGRAIAANAGILVTQVEFIKQNQDK 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHA-DIVGPICETGDFIALNRKIA 358
            F I+D  MND +RP+LY A+ +I   V+   D    H  D+VGP+CETGDF+  +R +A
Sbjct: 300 YFAIVDAGMNDMLRPSLYQAWQKI-IPVSVRDDETPTHNYDVVGPVCETGDFLGKDRPLA 358

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L + GDLL     GAYG   S  YNSR  + EIMV+G Q H+IR R T + L + + I
Sbjct: 359 L-KQGDLLVQRSAGAYGFTMSSNYNSRPRVAEIMVDGEQHHLIRERETIESLYQGEKI 415


>gi|116053426|ref|YP_793751.1| diaminopimelate decarboxylase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|254238026|ref|ZP_04931349.1| diaminopimelate decarboxylase [Pseudomonas aeruginosa C3719]
 gi|296392135|ref|ZP_06881610.1| diaminopimelate decarboxylase [Pseudomonas aeruginosa PAb1]
 gi|313106693|ref|ZP_07792911.1| diaminopimelate decarboxylase [Pseudomonas aeruginosa 39016]
 gi|115588647|gb|ABJ14662.1| diaminopimelate decarboxylase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169957|gb|EAZ55468.1| diaminopimelate decarboxylase [Pseudomonas aeruginosa C3719]
 gi|310879413|gb|EFQ38007.1| diaminopimelate decarboxylase [Pseudomonas aeruginosa 39016]
          Length = 415

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 194/416 (46%), Positives = 265/416 (63%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G L AE V+L ++A    TP Y YS   IE  Y  +++A  GM  +VC+A+K
Sbjct: 1   MDTFSYRDGELFAEGVALSRIAERFGTPTYVYSRAHIEAQYRAYADALAGMPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA     ++VFSGVGKT D++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGDPAKVVFSGVGKTRDDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L + A  LG KAP++ RVNPD++A TH  ISTG KE+KFGI I +  +
Sbjct: 121 CFNVESGEELERLQRVAAELGVKAPVSLRVNPDVDAQTHPYISTGLKENKFGIAIDEAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ L  +++ GVD HIGSQ+ Q+E F  A + L  L  +L   G  I+H+D+GGGL
Sbjct: 181 VYARAAELDHLEVIGVDCHIGSQLTQLEPFLDALERLLGLVDRLAGKGIGIRHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D +PP + DY   I +        ++ EPGR +VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEQPPLAGDYIRAIRERLHGRDLTLVFEPGRSIVANAGVLLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ ++   V P  D +    D+VGPICETGDF+A +R +AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVQ-AVRPR-DAVPRRYDLVGPICETGDFLAKDRDLALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+G Q H +R R T QEL   +S+
Sbjct: 358 E-GDLLAVRSAGAYGFVMSSNYNTRGRAAEVLVDGEQTHEVRRRETVQELYAGESL 412


>gi|149191481|ref|ZP_01869730.1| diaminopimelate decarboxylase [Vibrio shilonii AK1]
 gi|148834669|gb|EDL51657.1| diaminopimelate decarboxylase [Vibrio shilonii AK1]
          Length = 417

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 199/418 (47%), Positives = 269/418 (64%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE  SL +LA    TP Y YS   +E+++  F  +      +VCYA+
Sbjct: 1   MDYFNYQDDGQLWAEETSLTQLAEQYGTPLYVYSRATLERHWNAFDKSVGDHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA LGSG DIVS GEL R +AA     ++VFSGVGKT  E+  AL+ GI
Sbjct: 61  KANSNIGVLNTLARLGSGFDIVSGGELERVVAAGGEPSKVVFSGVGKTAQEMRRALELGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LNQ A  +G  API+ R+NPD++ANTH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNQVAGEMGVVAPISLRINPDVDANTHPYISTGLRDNKFGIAFDRAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           ++Y +A +LP + + G+D HIGSQ+  IE F  A   L  L  QLR++G NI+H+DVGGG
Sbjct: 181 AVYKFAQSLPNLAVHGIDCHIGSQLTDIEPFIDATDRLLALIDQLRADGVNIKHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  SDYA +L+ +   + + ++I EPGR + A+ G+L+TKV  +K +  
Sbjct: 241 LGVVYR-DELPPQPSDYAKALLARLENHPELELIFEPGRAIAANAGVLLTKVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I  +    G+   I  D+VGPICETGDFI  +R + 
Sbjct: 300 KNFAIVDAAMNDLMRPALYQAWQDIIPVSPREGE--AITYDLVGPICETGDFIGKDRSLV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L +  DLL +   GAYG V S  YN+R  + EI+V+G + H++R R + Q L EL+SI
Sbjct: 358 LEQ-NDLLAVRSAGAYGFVMSSNYNTRPRVAEIIVDGDKAHVVRQRESLQSLWELESI 414


>gi|330976601|gb|EGH76645.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. aptata str.
           DSM 50252]
          Length = 415

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 197/416 (47%), Positives = 261/416 (62%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  +A    TP Y YS   IE  Y  +++A  GM  MVC+A+K
Sbjct: 1   MDAFNYRDGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYRAYADALSGMPHMVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   AE+IVFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGKAEKIVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L + A  L  +API+ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNVESTDELERLQEVAAELNVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIAAAED 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS LP +++ GVD HIGSQ+  +E F  A   L DL  +L   G ++ HID+GGGL
Sbjct: 181 VYIRASQLPNLEVIGVDCHIGSQLTTLEPFIDALDRLLDLVDRLGDCGIHLHHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP ++DY   + +        ++ EPGRF+VA+ G L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEEPPLAADYIKAVRERLAGRDLGLLFEPGRFIVANAGALLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ ++   V P       + DIVGPICETGDF+A  R++AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVT-AVRPRDSEPRAY-DIVGPICETGDFLAKGRELALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+GSQ   +R R T  EL   +S+
Sbjct: 358 E-GDLLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGSQAFEVRRRETVAELFAGESL 412


>gi|71738109|ref|YP_277093.1| diaminopimelate decarboxylase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257482608|ref|ZP_05636649.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289624630|ref|ZP_06457584.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289651144|ref|ZP_06482487.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|71558662|gb|AAZ37873.1| diaminopimelate decarboxylase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320326562|gb|EFW82613.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320331372|gb|EFW87313.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330870014|gb|EGH04723.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330881320|gb|EGH15469.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|331012751|gb|EGH92807.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 415

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 197/417 (47%), Positives = 263/417 (63%), Gaps = 6/417 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  +A    TP Y YS   IE  Y  +++A  GM  MVC+A+K
Sbjct: 1   MDAFNYRDGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYRAYADALSGMPHMVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   AE+IVFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGKAEKIVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L + A  L  +API+ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNVESTDELERLQEVAAELDVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIADAED 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS LP +++ GVD HIGSQ+  +E F  A   L DL  +L   G ++ HID+GGGL
Sbjct: 181 VYIRASQLPNLEVIGVDCHIGSQLTTLEPFIDALDRLLDLVDRLGDCGIHLHHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP ++DY   + +        ++ EPGRF+VA+ G L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEEPPLAADYIKAVRERLAGRDLGLLFEPGRFIVANAGALLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGD-RLHIHADIVGPICETGDFIALNRKIAL 359
           F I+D AMND +RP LY A+ ++  +    G+ R +   DIVGPICETGDF+A  R++AL
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVTAVRPRDGEPRAY---DIVGPICETGDFLAKGRELAL 356

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GDLL +   GAYG V S  YN+R    E++V+GSQ   +R R T  EL   +S+
Sbjct: 357 AE-GDLLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGSQAFEVRRRETVAELFAGESL 412


>gi|298489348|ref|ZP_07007362.1| Diaminopimelate decarboxylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298156139|gb|EFH97245.1| Diaminopimelate decarboxylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 415

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 197/417 (47%), Positives = 263/417 (63%), Gaps = 6/417 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  +A    TP Y YS   IE  Y  +++A  GM  MVC+A+K
Sbjct: 1   MDAFNYRDGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYRAYADALSGMPHMVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   AE+IVFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGKAEKIVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L + A  L  +API+ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNVESTDELERLQEVAAELDVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIANAED 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS LP +++ GVD HIGSQ+  +E F  A   L DL  +L   G ++ HID+GGGL
Sbjct: 181 VYIRASQLPNLEVIGVDCHIGSQLTTLEPFIDALDRLLDLVDRLGDCGIHLHHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP ++DY   + +        ++ EPGRF+VA+ G L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEEPPLAADYIKAVRERLAGRDLGLLFEPGRFIVANAGALLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGD-RLHIHADIVGPICETGDFIALNRKIAL 359
           F I+D AMND +RP LY A+ ++  +    G+ R +   DIVGPICETGDF+A  R++AL
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVTAVRPRDGEPRAY---DIVGPICETGDFLAKGRELAL 356

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GDLL +   GAYG V S  YN+R    E++V+GSQ   +R R T  EL   +S+
Sbjct: 357 AE-GDLLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGSQAFEVRRRETVAELFAGESL 412


>gi|77920014|ref|YP_357829.1| diaminopimelate decarboxylase [Pelobacter carbinolicus DSM 2380]
 gi|77546097|gb|ABA89659.1| diaminopimelate decarboxylase [Pelobacter carbinolicus DSM 2380]
          Length = 417

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 198/420 (47%), Positives = 267/420 (63%), Gaps = 3/420 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y +  L  E+V+L+ +A  V TPFY YS   + ++   FS+AF  +  ++CY++K
Sbjct: 1   MNYFQYRDNDLFCEDVALKDIAAQVGTPFYVYSHATLSRHLEAFSSAFADVPHLICYSIK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+KT     +G DIVS GEL RA        +IV+SGVGKT  EI  ALQ+GI 
Sbjct: 61  ANSNLAVLKTFVSHNAGFDIVSGGELFRAQQVGCDPAKIVYSGVGKTEAEIADALQAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL T+N  A  LGKKA IA RVNPD++  TH  ISTG K+ KFGI I Q   
Sbjct: 121 MFNVESRQELDTINAVAGRLGKKAGIAIRVNPDVDPQTHPYISTGMKKAKFGINISQALD 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A++LP +++ GVD HIGSQ+ ++  F  A   +R+L Q L++ G  I+++D+GGGL
Sbjct: 181 DYRLAASLPNLEVIGVDCHIGSQLTKLSPFVDAIAKIRELVQTLQNEGFGIKYLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  +  PPS +DYA +I +    L   ++ EPGR +V + G+LV+KV+ +K+   K 
Sbjct: 241 GITYE-EEEPPSPADYAEVIIEGTKGLGVTLVFEPGRVMVGNAGMLVSKVLYVKEGEAKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FVI+D AMND  RP LY +Y  I  +     D   I AD+VGPICE+GDF+A +R+I   
Sbjct: 300 FVIVDAAMNDLTRPALYGSYQGIQAVDRSTSDT--IVADVVGPICESGDFLAQDREITAF 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
             GDLL +   GAYG   S  YNSR  +PEIMV G Q  +IR R T+ +LI+ +SIP  L
Sbjct: 358 SQGDLLAVASAGAYGFTMSSNYNSRRRVPEIMVKGDQVMVIRKRETYDDLIKGESIPEGL 417


>gi|28867457|ref|NP_790076.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|28850691|gb|AAO53771.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. tomato str.
           DC3000]
          Length = 415

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 197/416 (47%), Positives = 261/416 (62%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  +A    TP Y YS   IE  Y  F++A  GM  MVC+A+K
Sbjct: 1   MDAFNYRDGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYRAFADALSGMPHMVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   AERIVFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGKAERIVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L + A  L  +API+ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNVESTDELERLQEVAAELNVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIAAAED 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS LP +++ GVD HIGSQ+  +E F  A   L DL  +L   G ++ HID+GGGL
Sbjct: 181 VYIRASQLPNLEVIGVDCHIGSQLTTLEPFIDALDRLLDLVDRLGDCGIHLHHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  +  PP + DY   + +        ++ EPGRF+VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYRHEE-PPLAGDYIKAVRERLAGRDLGLLFEPGRFIVANAGVLLTQVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ ++   V P       + DIVGPICETGDF+A  R++AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVT-AVRPRDSEPRAY-DIVGPICETGDFLAKGRELALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+G+Q   +R R T  EL   +S+
Sbjct: 358 E-GDLLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGTQAFEVRRRETVAELFAGESL 412


>gi|330984813|gb|EGH82916.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 415

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 197/416 (47%), Positives = 261/416 (62%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  +A    TP Y YS   IE  Y  +++A  GM  MVC+A+K
Sbjct: 1   MDAFNYRDGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYRAYADALSGMPHMVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   AE+IVFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGKAEKIVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L + A  L  +API+ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNVESTDELERLQEVAAELDVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIADAED 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS LP +++ GVD HIGSQ+  +E F  A   L DL  +L   G ++ HID+GGGL
Sbjct: 181 VYIRASQLPNLEVIGVDCHIGSQLTTLEPFIDALDRLLDLVDRLGDCGIHLHHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP ++DY   + +        ++ EPGRF+VA+ G L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEEPPLAADYIKAVRERLAGRDLGLLFEPGRFIVANAGALLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ ++   V P       + DIVGPICETGDF+A  R++AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVT-AVRPRDSEPRAY-DIVGPICETGDFLAKGRELALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+GSQ   +R R T  EL   +S+
Sbjct: 358 E-GDLLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGSQAFEVRRRETVAELFAGESL 412


>gi|260549303|ref|ZP_05823523.1| diaminopimelate decarboxylase [Acinetobacter sp. RUH2624]
 gi|260407709|gb|EEX01182.1| diaminopimelate decarboxylase [Acinetobacter sp. RUH2624]
          Length = 416

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 195/410 (47%), Positives = 264/410 (64%), Gaps = 3/410 (0%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           +F    G LHAE  SLE+LA    TP Y YS TA EK+YL    AFD +D  +C+A+K+N
Sbjct: 2   SFTRINGVLHAEQCSLEQLAQQFGTPLYVYSKTAFEKHYLDMDRAFDFIDHQICFAVKSN 61

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+  LA LG+G DIVS GEL R L A   A +IVFSG+GKT  +I+ +L  GI CF
Sbjct: 62  SNLAVLSVLAKLGAGFDIVSGGELARVLKAGGDASKIVFSGLGKTEVDIETSLNVGIACF 121

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES +EL  + + A  LGKKAPI+ RVNPD++A TH  ISTG KE+KFGIP   ++  Y
Sbjct: 122 NVESYAELDRIQKVAARLGKKAPISLRVNPDVDAKTHPYISTGLKENKFGIPSDAVYETY 181

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
            YA++LP ++I G+D HIGSQ+ + + F  A   +  +  +L+  G N++HID+GGGLG+
Sbjct: 182 QYAASLPNLEIVGIDCHIGSQLTETKPFVDALDRVIVMIDELKKLGINLKHIDIGGGLGV 241

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y  D  PPS  +YA+ +      L  K+ +EPGR + A+ G+L+TKV  +K +  + F 
Sbjct: 242 CYK-DETPPSVEEYANSMKPALEKLGLKVYMEPGRSISANAGVLLTKVDLLKPTTHRNFA 300

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND +RP LY+A+ +I  +V P  D      D+VG ICETGDFI  +R +AL + 
Sbjct: 301 IIDAAMNDLIRPALYEAWMDIQPVV-PRTDTEEKVWDLVGAICETGDFIGKDRSLAL-QE 358

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
            DLL +   GAYG V S  YN+R    E+MV+G   ++IR R T + L E
Sbjct: 359 NDLLAVLGAGAYGFVMSSNYNTRGRAAEVMVSGENSYLIRERETVESLWE 408


>gi|169632675|ref|YP_001706411.1| diaminopimelate decarboxylase [Acinetobacter baumannii SDF]
 gi|169795020|ref|YP_001712813.1| diaminopimelate decarboxylase [Acinetobacter baumannii AYE]
 gi|184159195|ref|YP_001847534.1| diaminopimelate decarboxylase [Acinetobacter baumannii ACICU]
 gi|213158317|ref|YP_002320368.1| diaminopimelate decarboxylase [Acinetobacter baumannii AB0057]
 gi|215482568|ref|YP_002324760.1| diaminopimelate decarboxylase [Acinetobacter baumannii AB307-0294]
 gi|301345397|ref|ZP_07226138.1| diaminopimelate decarboxylase [Acinetobacter baumannii AB056]
 gi|301511589|ref|ZP_07236826.1| diaminopimelate decarboxylase [Acinetobacter baumannii AB058]
 gi|301594791|ref|ZP_07239799.1| diaminopimelate decarboxylase [Acinetobacter baumannii AB059]
 gi|332854282|ref|ZP_08435282.1| diaminopimelate decarboxylase [Acinetobacter baumannii 6013150]
 gi|332865658|ref|ZP_08436484.1| diaminopimelate decarboxylase [Acinetobacter baumannii 6013113]
 gi|332876024|ref|ZP_08443810.1| diaminopimelate decarboxylase [Acinetobacter baumannii 6014059]
 gi|169147947|emb|CAM85810.1| diaminopimelate decarboxylase [Acinetobacter baumannii AYE]
 gi|169151467|emb|CAP00216.1| diaminopimelate decarboxylase [Acinetobacter baumannii]
 gi|183210789|gb|ACC58187.1| Diaminopimelate decarboxylase [Acinetobacter baumannii ACICU]
 gi|193078108|gb|ABO13049.2| diaminopimelate decarboxylase [Acinetobacter baumannii ATCC 17978]
 gi|213057477|gb|ACJ42379.1| diaminopimelate decarboxylase [Acinetobacter baumannii AB0057]
 gi|213986285|gb|ACJ56584.1| diaminopimelate decarboxylase [Acinetobacter baumannii AB307-0294]
 gi|322509109|gb|ADX04563.1| lysA [Acinetobacter baumannii 1656-2]
 gi|332728098|gb|EGJ59487.1| diaminopimelate decarboxylase [Acinetobacter baumannii 6013150]
 gi|332735179|gb|EGJ66259.1| diaminopimelate decarboxylase [Acinetobacter baumannii 6013113]
 gi|332735890|gb|EGJ66931.1| diaminopimelate decarboxylase [Acinetobacter baumannii 6014059]
          Length = 416

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 194/410 (47%), Positives = 264/410 (64%), Gaps = 3/410 (0%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           +F    G LHAE  SLE+LA    TP Y YS  A EK+YL    AFD +D  +C+A+K+N
Sbjct: 2   SFTRINGVLHAEQCSLEQLAQQFGTPLYVYSKAAFEKHYLDMDRAFDFIDHQICFAVKSN 61

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+  LA LG+G DIVS GEL R L A   A +IVFSG+GKT  +I+ +L  GI CF
Sbjct: 62  SNIAVLNVLAKLGAGFDIVSGGELARVLKAGGDASKIVFSGLGKTEADIETSLNVGIACF 121

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES +EL  + + A  LGKKAPI+ RVNPD++A TH  ISTG KE+KFGIP   ++  Y
Sbjct: 122 NVESYAELDRIQKVAARLGKKAPISLRVNPDVDAKTHPYISTGLKENKFGIPSDAVYETY 181

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
            YA++LP ++I G+D HIGSQ+ + + F  A   +  +  +L+  G N++HID+GGGLG+
Sbjct: 182 QYAASLPNLEIVGIDCHIGSQLTETKPFVDALDRVIVMIDELKKLGINLKHIDIGGGLGV 241

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y  D  PPS  +YA+ +      L  K+ +EPGR + A+ G+L+TKV  +K +  + F 
Sbjct: 242 CYK-DETPPSVEEYANSMKPALEKLGLKVYMEPGRSISANAGVLLTKVDLLKPTTHRNFA 300

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND +RP LY+A+ +I  +V P  D      D+VG ICETGDFI  +R +AL + 
Sbjct: 301 IIDAAMNDLIRPALYEAWMDIQPVV-PRTDTEEKTWDLVGAICETGDFIGKDRSLAL-QE 358

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
            DLL +   GAYG V S  YN+R    E+MV+G + ++IR R T + L E
Sbjct: 359 NDLLTVLGAGAYGFVMSSNYNTRGRAAEVMVSGEKSYLIRERETVESLWE 408


>gi|107104378|ref|ZP_01368296.1| hypothetical protein PaerPA_01005454 [Pseudomonas aeruginosa PACS2]
 gi|218894380|ref|YP_002443250.1| diaminopimelate decarboxylase [Pseudomonas aeruginosa LESB58]
 gi|254243836|ref|ZP_04937158.1| diaminopimelate decarboxylase [Pseudomonas aeruginosa 2192]
 gi|126197214|gb|EAZ61277.1| diaminopimelate decarboxylase [Pseudomonas aeruginosa 2192]
 gi|218774609|emb|CAW30426.1| diaminopimelate decarboxylase [Pseudomonas aeruginosa LESB58]
          Length = 415

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 194/416 (46%), Positives = 264/416 (63%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G L AE V+L ++A    TP Y YS   IE  Y  +++A  GM  +VC+A+K
Sbjct: 1   MDTFSYRDGELFAEGVALSRIAERFGTPTYVYSRAHIEAQYRAYADALAGMPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA     ++VFSGVGKT D++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGDPAKVVFSGVGKTRDDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L + A  LG KAP++ RVNPD++A TH  ISTG KE+KFGI I +  +
Sbjct: 121 CFNVESGEELERLQRVAAELGVKAPVSLRVNPDVDAQTHPYISTGLKENKFGIAIDEAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ L  +++ GVD HIGSQ+ Q+E F  A + L  L  +L   G  I+H+D+GGGL
Sbjct: 181 VYARAAELDHLEVIGVDCHIGSQLTQLEPFLDALERLLGLVDRLAGKGIGIRHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D +PP + DY   I +        ++ EPGR +VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEQPPLAGDYIRAIRERLHGRDLTLVFEPGRSIVANAGVLLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ ++   V P  D      D+VGPICETGDF+A +R +AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVQ-AVRPR-DAAPRRYDLVGPICETGDFLAKDRDLALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+G Q H +R R T QEL   +S+
Sbjct: 358 E-GDLLAVRSAGAYGFVMSSNYNTRGRAAEVLVDGEQTHEVRRRETVQELYAGESL 412


>gi|312884202|ref|ZP_07743913.1| diaminopimelate decarboxylase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368130|gb|EFP95671.1| diaminopimelate decarboxylase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 417

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 198/418 (47%), Positives = 271/418 (64%), Gaps = 6/418 (1%)

Query: 1   MSAFKY-FEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y  +G L AE+V+L  LA    TP Y YS   +E+++  F +A      +VCYA+
Sbjct: 1   MDYFNYQSDGQLWAEDVALTTLAEQYGTPLYVYSRATLERHWNAFDSAVGDHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA LGSG DIVS GEL R +AA    +++VFSGVGKT  E+  AL+ GI
Sbjct: 61  KANSNLGVLNTLARLGSGFDIVSGGELERVIAAGGDPKKVVFSGVGKTRAEMKRALELGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LNQ A  LG  API+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNQVAGELGVVAPISLRINPDVDAKTHPYISTGLRDNKFGIAFERAS 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           ++Y +A +LP + I G+D HIGSQ+ +IE F  A   L  L   L++ G NI+H+DVGGG
Sbjct: 181 TVYDFAQSLPHLSIKGIDCHIGSQLTEIEPFIDATDRLLKLIDDLKTQGINIRHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  SDYA +L+ +  G+ + ++I EPGR + A+ GIL+T+V  +K +  
Sbjct: 241 LGVVYR-DELPPQPSDYAKALLARLDGHKELELIFEPGRAIAANAGILLTRVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ EI  +V   G+      D+VGPICETGDF+  +R++ 
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQEIVPVVPRKGETQTY--DLVGPICETGDFLGKDRELV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L R GDLL +  +GAYG V +  YN+R+   E+MV+G + H++R R   + L  L+ I
Sbjct: 358 L-REGDLLAVRSSGAYGFVMASNYNTRVRSAEVMVDGHKTHLVRQREELESLWALEHI 414


>gi|330892010|gb|EGH24671.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. mori str.
           301020]
          Length = 415

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 198/416 (47%), Positives = 260/416 (62%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  +A    TP Y YS   IE  Y  +++A  GM  MVC+A+K
Sbjct: 1   MDAFNYRDGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYRAYADALSGMPHMVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   AE+IVFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGKAEKIVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L + A  L  +API+ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNVESTDELERLQEVAAELDVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIADAED 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS LP +++ GVD HIGSQ+  +E F  A   L DL  +L   G ++ HID+GGGL
Sbjct: 181 VYIRASQLPNLEVIGVDCHIGSQLTTLEPFIDALARLLDLVDRLGDCGIHLHHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP ++DY   + +        +  EPGRF+VA+ G L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEEPPLAADYIKAVRERLAGRDLGLFFEPGRFIVANAGALLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ ++   V P  D      DIVGPICETGDF+A  R++AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVT-AVRPR-DSEPCAYDIVGPICETGDFLAKGRELALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+GSQ   +R R T  EL   +S+
Sbjct: 358 E-GDLLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGSQAFEVRRRETVAELFAGESL 412


>gi|163859235|ref|YP_001633533.1| hypothetical protein Bpet4914 [Bordetella petrii DSM 12804]
 gi|163262963|emb|CAP45266.1| lysA [Bordetella petrii]
          Length = 430

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 195/418 (46%), Positives = 270/418 (64%), Gaps = 13/418 (3%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
           F Y  G LHAE V+L+ LA  + TP Y YS  A+ + + T+S+A      +VCY +KANS
Sbjct: 17  FHYQNGILHAEGVALDALASQLGTPLYVYSRAALAQAWRTYSDAIGTRPVLVCYGMKANS 76

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFN 123
           N AV+K  A LG+G DIVS GEL+R LAA     ++VFSGVGK   E+  AL++G+ CFN
Sbjct: 77  NLAVLKEFARLGAGFDIVSGGELKRVLAAGGNPAKVVFSGVGKQAWEMRAALEAGVKCFN 136

Query: 124 VESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA 183
           VES++EL+ L+  A S+G++A ++ RVNPD++A TH  ISTG KE+KFGI I      Y 
Sbjct: 137 VESQAELQCLSDVAQSMGQRARVSLRVNPDVDAQTHPYISTGLKENKFGIAIESALDAYR 196

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIA 243
            A+ LPG++I GVD HIGSQ+  I  +  A + L DL +QL + G  IQH+D+GGGLGI 
Sbjct: 197 TAAALPGLEIVGVDCHIGSQLTDISPYFDALEKLLDLIEQLDAAGIAIQHLDLGGGLGIR 256

Query: 244 YHSDHRPPSSSDYASLIHQYFGNLQCK------IILEPGRFLVADVGILVTKVISIKKSA 297
           Y +D  PPS     +L+ Q F  LQ +      ++LEPGR LV + G+L+T V  +K + 
Sbjct: 257 Y-TDEIPPSPK---ALLDQVFERLQARGMAHLHLVLEPGRSLVGNAGVLLTTVQYLKHAQ 312

Query: 298 DKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKI 357
            + F I+D AMND +RP LYDAYH +  +     D   I  DIVGP+CE+ D++A  RK+
Sbjct: 313 ARNFAIVDAAMNDLLRPALYDAYHGVQPVAPR--DGAAIEYDIVGPVCESADWLARQRKL 370

Query: 358 ALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
           AL + GD+L +E  GAY  V +  YN+R    E+MV+GS+ +I+R R T  +L+  +S
Sbjct: 371 AL-QAGDVLALESAGAYAMVMASNYNTRARAAEVMVDGSRHYIVRQRETLDDLLRGES 427


>gi|239500988|ref|ZP_04660298.1| diaminopimelate decarboxylase [Acinetobacter baumannii AB900]
          Length = 416

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 194/410 (47%), Positives = 264/410 (64%), Gaps = 3/410 (0%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           +F    G LHAE  SLE+LA    TP Y YS  A EK+YL    AFD +D  +C+A+K+N
Sbjct: 2   SFTRINGVLHAEQCSLEQLAQQFGTPLYVYSKAAFEKHYLDMDRAFDFIDHQICFAVKSN 61

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+  LA LG+G DIVS GEL R L A   A +IVFSG+GKT  +I+ +L  GI CF
Sbjct: 62  SNIAVLNVLAKLGAGFDIVSGGELARVLKAGGDASKIVFSGLGKTEADIETSLNVGIACF 121

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES +EL  + + A  LGKKAPI+ RVNPD++A TH  ISTG KE+KFGIP   ++  Y
Sbjct: 122 NVESYAELDRIQKVAARLGKKAPISLRVNPDVDAKTHPYISTGLKENKFGIPSDAVYETY 181

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
            YA++LP ++I G+D HIGSQ+ + + F  A   +  +  +L+  G N++HID+GGGLG+
Sbjct: 182 QYAASLPNLEIVGIDCHIGSQLTETKPFVDALDRVIVMIDELKKLGINLKHIDIGGGLGV 241

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y  D  PPS  +YA+ +      L  K+ +EPGR + A+ G+L+TKV  +K +  + F 
Sbjct: 242 CYK-DEIPPSVEEYANSMKPALEKLGLKVYMEPGRSISANAGVLLTKVDLLKPTTHRNFA 300

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND +RP LY+A+ +I  +V P  D      D+VG ICETGDFI  +R +AL + 
Sbjct: 301 IIDAAMNDLIRPALYEAWMDIQPVV-PRTDTEEKTWDLVGAICETGDFIGKDRSLAL-QE 358

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
            DLL +   GAYG V S  YN+R    E+MV+G + ++IR R T + L E
Sbjct: 359 NDLLTVLGAGAYGFVMSSNYNTRGRAAEVMVSGEKSYLIRERETVESLWE 408


>gi|295690237|ref|YP_003593930.1| diaminopimelate decarboxylase [Caulobacter segnis ATCC 21756]
 gi|295432140|gb|ADG11312.1| diaminopimelate decarboxylase [Caulobacter segnis ATCC 21756]
          Length = 421

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/424 (43%), Positives = 269/424 (63%), Gaps = 7/424 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAF---DGMDTMVCY 57
           M+ F+Y    L  E V L K+A  V TP Y YS   +E+++  F +A      +D ++ Y
Sbjct: 1   MNHFEYGPEGLACEGVPLAKIAAEVGTPVYVYSRATLERHFTVFRDALALAGVVDPLIAY 60

Query: 58  ALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQS 117
           A+KANSN AV+K L  LG+G D VSEGE+RRALAA +P ERIVFSGVGKT  EI  AL +
Sbjct: 61  AVKANSNVAVLKVLGDLGAGADTVSEGEIRRALAAGIPGERIVFSGVGKTRREIAFALTT 120

Query: 118 GIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQ 177
           G+   NVESE EL  + Q A  LG KA +AFRVNPD+ A  H KI+TGK E+KFG+   +
Sbjct: 121 GVAEINVESEPELDLIAQVAAELGVKAKVAFRVNPDVAAGGHAKIATGKSENKFGVSFAE 180

Query: 178 IHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVG 237
              LYA AS    ++  GV  HIGSQI  +E    AF  +R L +QL   G +++ +D+G
Sbjct: 181 AARLYANASNNSSLEPVGVACHIGSQITDLEPMRAAFTKMRGLVEQLLGEGLSVERLDLG 240

Query: 238 GGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISI-KKS 296
           GGLG+ Y +   PPS + +A+++ +    L   +  EPGR + A+ G+LV++V+ + ++ 
Sbjct: 241 GGLGVPYFNSPEPPSPAAFAAMVGEVTQGLPVTLAFEPGRVIAANAGVLVSEVVHVHERP 300

Query: 297 ADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRK 356
             + F+++D AMND +RP +YDA+H+I  ++   G+ ++   D+VGP+CETGD    +R 
Sbjct: 301 EGRKFLVIDAAMNDLIRPAMYDAFHDIRPVIQRGGETVY---DVVGPVCETGDTFTRDRA 357

Query: 357 IALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +     GDL+     GAYGA  +  YN+R L+PE++V+G ++ +IR R T++E++  D +
Sbjct: 358 LPPFTTGDLVAFMSAGAYGAAMASEYNTRPLVPEVLVDGDRYAVIRKRPTYEEILARDLV 417

Query: 417 PAWL 420
           P W+
Sbjct: 418 PDWV 421


>gi|330941151|gb|EGH44030.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. pisi str.
           1704B]
          Length = 415

 Score =  375 bits (962), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 197/416 (47%), Positives = 260/416 (62%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  +A    TP Y YS   IE  Y  +++A  GM  MVC+A+K
Sbjct: 1   MDAFNYRDGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYRAYADALSGMPHMVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   AE+IVFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGKAEKIVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L + A  L  +API+ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNVESTDELERLQEVAAELNVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIAAAED 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS LP +K+ GVD HIGSQ+  +E F  A   L  L  +L   G ++ HID+GGGL
Sbjct: 181 VYIRASQLPNLKVIGVDCHIGSQLTTLEPFIDALDRLLALVDRLGDCGIHLHHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP ++DY   + +        ++ EPGRF+VA+ G L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEEPPLAADYIKAVRERLAGRDLGLLFEPGRFIVANAGALLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ ++   V P       + DIVGPICETGDF+A  R++AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVT-AVRPRDSEPRAY-DIVGPICETGDFLAKGRELALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+GSQ   +R R T  EL   +S+
Sbjct: 358 E-GDLLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGSQAFEVRRRETVAELFAGESL 412


>gi|77359070|ref|YP_338645.1| diaminopimelate decarboxylase [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76873981|emb|CAI85202.1| putative diaminopimelate decarboxylase [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 417

 Score =  375 bits (962), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 201/418 (48%), Positives = 270/418 (64%), Gaps = 5/418 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L AE+VS+  +A    TP Y YS    E++YL F+NA     ++VCYA+K
Sbjct: 1   MDFFNYKNNQLFAEDVSIASIAQQYGTPCYVYSRATFERHYLAFANATKNHKSLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS+GEL R + A   A ++VFSGV KT DEI  AL+ GI 
Sbjct: 61  ANSNIAVLNILARLGSGFDIVSKGELARVIKAGGDASKVVFSGVAKTADEIAYALKLGIK 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SEL+ +++ A  L   API+ RVNPDI+A TH  ISTG KE+KFGI I    S
Sbjct: 121 CFNVESVSELERISEVACELNLAAPISIRVNPDIDAKTHPYISTGLKENKFGIDIQTAVS 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y +A++LPG+ I GVD HIGSQ+ +   F +A   L  L  +L++    + H+D+GGGL
Sbjct: 181 VYQHAASLPGLNIIGVDCHIGSQLTETRPFLEALDKLLTLIDELKACNIELTHLDIGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y+ D +PP  S+YA+ + +   N +  ++I EPGR + A+ G+LVT+V  IK++ DK
Sbjct: 241 GVTYN-DEQPPHPSEYAAQVTERLVNYRHLELIFEPGRAIAANAGVLVTQVEFIKQNQDK 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHA-DIVGPICETGDFIALNRKIA 358
            F I+D  MND +RP LY A+ +I   V+   D    H  DIVGP+CETGDF+  +R++A
Sbjct: 300 YFAIVDAGMNDMLRPALYQAWQKI-IPVSVRDDETPTHNFDIVGPVCETGDFLGKDRELA 358

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L + GDLL     GAYG   S  YNSR  + EIMV+GSQ H+IR R T + L + + I
Sbjct: 359 L-KQGDLLVQRSAGAYGFTMSSNYNSRPRVAEIMVDGSQHHLIRERETIESLYQGEKI 415


>gi|15600470|ref|NP_253964.1| diaminopimelate decarboxylase [Pseudomonas aeruginosa PAO1]
 gi|12230897|sp|P19572|DCDA_PSEAE RecName: Full=Diaminopimelate decarboxylase; Short=DAP
           decarboxylase
 gi|9951590|gb|AAG08662.1|AE004940_6 diaminopimelate decarboxylase [Pseudomonas aeruginosa PAO1]
          Length = 415

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 193/416 (46%), Positives = 263/416 (63%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +  L AE V+L ++A    TP Y YS   IE  Y  +++A  GM  +VC+A+K
Sbjct: 1   MDTFSYRDAELFAEGVALSRIAERFGTPTYVYSRAHIEAQYRAYADALAGMPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA     ++VFSGVGKT D++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGDPAKVVFSGVGKTRDDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L + A  LG KAP++ RVNPD++A TH  ISTG KE+KFGI I +  +
Sbjct: 121 CFNVESGEELERLQRVAAELGVKAPVSLRVNPDVDAQTHPYISTGLKENKFGIAIDEAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ L  +++ GVD HIGSQ+ Q+E F  A + L  L  +L   G  I+H+D+GGGL
Sbjct: 181 VYARAAELDHLEVIGVDCHIGSQLTQLEPFLDALERLLGLVDRLAGKGIGIRHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D +PP + DY   I +        ++ EPGR +VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEQPPLAGDYIRAIRERLHGRDLTLVFEPGRSIVANAGVLLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ ++   V P  D      D+VGPICETGDF+A +R +AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVQ-AVRPR-DAAPRRYDLVGPICETGDFLAKDRDLALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+G Q H +R R T QEL   +S+
Sbjct: 358 E-GDLLAVRSAGAYGFVMSSNYNTRGRAAEVLVDGEQTHEVRRRETVQELYAGESL 412


>gi|77163847|ref|YP_342372.1| diaminopimelate decarboxylase [Nitrosococcus oceani ATCC 19707]
 gi|254436067|ref|ZP_05049574.1| diaminopimelate decarboxylase [Nitrosococcus oceani AFC27]
 gi|76882161|gb|ABA56842.1| diaminopimelate decarboxylase [Nitrosococcus oceani ATCC 19707]
 gi|207089178|gb|EDZ66450.1| diaminopimelate decarboxylase [Nitrosococcus oceani AFC27]
          Length = 417

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 196/411 (47%), Positives = 260/411 (63%), Gaps = 5/411 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L AE + L ++A    TP Y YS  AIE  +  F  AF+     +CYA+K
Sbjct: 2   MEYFHYRYNVLWAEEIPLPEIASRFDTPCYVYSRAAIEHQWRAFDQAFEKHPHQICYAVK 61

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R LAA     RIVFSGVGK  DE++ AL  GI 
Sbjct: 62  ANSNLAVLNILARLGSGFDIVSVGELERVLAAGGDPGRIVFSGVGKRADEMERALAVGIA 121

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE+EL  LN+ A  L ++AP++ RVNPD++A TH  I+TG +++KFGI I Q  +
Sbjct: 122 CFNVESEAELIRLNEIAGKLEQRAPVSLRVNPDVDARTHPYIATGLRDNKFGIEIDQALA 181

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+TLP + I GVD HIGSQ+  +  F  A + +  L  QL   G  I+HID+GGGL
Sbjct: 182 VYARAATLPHIDILGVDCHIGSQLTSLSPFLAALERVLALVDQLAERGIKIRHIDLGGGL 241

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  D  PPS   YA+ + Q       +I +EPGR +V + G+L+T++  +K++  K 
Sbjct: 242 GIIYR-DEAPPSPQQYAAALRQKLAGRNLEIWIEPGRAIVGNGGVLLTRIEYLKQAPQKN 300

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYI-VNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           F I+D AMND +RP LYDA+ EI  + V+  G+ L    D+VGP+CETGDF+   R++A+
Sbjct: 301 FAIVDAAMNDLLRPALYDAWQEIIPVAVDATGEPLFF--DVVGPVCETGDFLGKRRQLAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
              GDLL +   GAYG   S  YNSR    EIMV+G++ H++R R T + L
Sbjct: 359 -EAGDLLVVRAAGAYGFTMSSNYNSRPRAAEIMVDGAEAHLVRERETVESL 408


>gi|24375791|ref|NP_719834.1| diaminopimelate decarboxylase [Shewanella oneidensis MR-1]
 gi|24350739|gb|AAN57278.1|AE015863_7 diaminopimelate decarboxylase [Shewanella oneidensis MR-1]
          Length = 414

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/412 (46%), Positives = 267/412 (64%), Gaps = 4/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y + +L+AE   +  LA    TP Y YS   +E+++  F+NA  G   +VCYA+K
Sbjct: 1   MDHFLYQDNTLYAEGCRVNDLAQTYGTPLYIYSRATLERHWHAFNNAVAGHPHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R + A     ++VFSGVGKT+ E++ AL  GIY
Sbjct: 61  ANSNLAVLNVLARLGSGFDIVSGGELARVIEAGGDPAKVVFSGVGKTVAEMEQALNLGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN  A  LGK AP++ RVNPD++A TH  ISTG KE+KFGI + +  +
Sbjct: 121 CFNVESSAELEQLNLVAGRLGKVAPVSLRVNPDVDAGTHPYISTGLKENKFGIAMDEAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++A A  LP +++ GVD HIGSQ+ +I+ F  A   +  L  +L   G  I+H DVGGGL
Sbjct: 181 VFARAHALPHLQVKGVDCHIGSQLTEIQPFLDAMDRMLSLIDRLAEQGIVIEHFDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP    YA+ + +  G+ + K+I EPGR + A+ GI VT+V+ +K+++DK 
Sbjct: 241 GVTY-DDETPPHPDVYAAALLKRLGHRKLKLIFEPGRAIAANAGIFVTEVLYLKENSDKR 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ +I   V P  D+ H+  DIVGP+CETGDF+  +R+ A+ 
Sbjct: 300 FAIVDGAMNDLIRPALYSAWQKI-IPVTPRDDQAHVF-DIVGPVCETGDFLGKDREFAIA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
            PGDLL +  +GAYG   +  YN+R    E+MV+G + +++R R    +L +
Sbjct: 358 -PGDLLVVRSSGAYGFAMASNYNTRPRAAEVMVDGDKAYLVREREKLPQLWQ 408


>gi|66043452|ref|YP_233293.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. syringae
           B728a]
 gi|63254159|gb|AAY35255.1| Diaminopimelate decarboxylase [Pseudomonas syringae pv. syringae
           B728a]
 gi|330970500|gb|EGH70566.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 415

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 196/416 (47%), Positives = 260/416 (62%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  +A    TP Y YS   IE  Y  +++A  GM  MVC+A+K
Sbjct: 1   MDAFNYRDGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYRAYADALSGMPHMVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   AE+IVFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGKAEKIVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L + A  L  +API+ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNVESTDELERLQEVAAELNVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIAAAED 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS LP +++ GVD HIGSQ+  +E F  A   L  L  +L   G ++ HID+GGGL
Sbjct: 181 VYIRASQLPNLEVIGVDCHIGSQLTTLEPFIDALDRLLALVDRLGDCGIHLHHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP ++DY   + +        ++ EPGRF+VA+ G L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEEPPLAADYIKAVRERLAGRDLGLLFEPGRFIVANAGALLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ ++   V P       + DIVGPICETGDF+A  R++AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVT-AVRPRDSEPRAY-DIVGPICETGDFLAKGRELALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+GSQ   +R R T  EL   +S+
Sbjct: 358 E-GDLLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGSQAFEVRRRETVAELFAGESL 412


>gi|330501238|ref|YP_004378107.1| diaminopimelate decarboxylase [Pseudomonas mendocina NK-01]
 gi|328915524|gb|AEB56355.1| diaminopimelate decarboxylase [Pseudomonas mendocina NK-01]
          Length = 415

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 195/416 (46%), Positives = 265/416 (63%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  LA    TP Y YS   IE  Y  +++A  GM  +VC+A+K
Sbjct: 1   MEAFNYRDGELFAEGVALSALAQRFGTPTYVYSRAHIEWQYRAYADALAGMPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA     RIVFSGVGK+ D++  AL+ G++
Sbjct: 61  ANSNIGVLNVLARLGAGFDIVSSGELERVLAAGGEPSRIVFSGVGKSRDDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L + A  LG KAP++ RVNPD++A TH  ISTG KE+KFGI I Q  +
Sbjct: 121 CFNVESSVELERLQKVAAELGVKAPVSLRVNPDVDAGTHPYISTGLKENKFGIDIEQAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LP + + GVD HIGSQ+  +E F  A   L  L  +L   G  I+H+D+GGGL
Sbjct: 181 VYARAAELPNLDVIGVDCHIGSQLTTLEPFLDALDRLLLLVDKLAERGITIKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D +PP + DY + + +        ++ EPGRF+VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVQYR-DEQPPLAGDYIAAVRKRLAGRDLSLVFEPGRFIVANAGVLLTQVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ +++ +    G+  +   D+VGPICETGDF+A +R++ L 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVSPVQPREGEARNY--DLVGPICETGDFLAKDRQLVL- 356

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E+MV+G Q   +R R T QEL   +S+
Sbjct: 357 EEGDLLAVRSAGAYGFVMSSNYNTRGRAAEVMVDGEQAFEVRRRETVQELYAGESL 412


>gi|157377262|ref|YP_001475862.1| diaminopimelate decarboxylase [Shewanella sediminis HAW-EB3]
 gi|157319636|gb|ABV38734.1| diaminopimelate decarboxylase [Shewanella sediminis HAW-EB3]
          Length = 414

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/412 (45%), Positives = 264/412 (64%), Gaps = 4/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L AE+  + +LA    TP Y YS   +E+++  F  A      ++CYA+K
Sbjct: 1   MDHFLYKNNELQAEDCQVAQLAQTYGTPLYIYSRATLERHWHAFDRAVANHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R + A    +++VFSGVGKT+ E+++AL  GI+
Sbjct: 61  ANSNIAVLNVLARLGSGFDIVSGGELSRVIEAGGSPDKVVFSGVGKTVAEMEMALNLGIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN  AV LGK AP++ RVNPD++A TH  ISTG KE+KFGI + +  +
Sbjct: 121 CFNVESAAELEQLNLVAVQLGKVAPVSLRVNPDVDAGTHPYISTGLKENKFGIAMDEAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++A A++LPG+++ GVD HIGSQ+ +I+ F  A   +  L  +L   G NI+H DVGGGL
Sbjct: 181 IFARANSLPGLEVKGVDCHIGSQLTEIQPFLDAMDRMLALIDRLAEQGINIEHFDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP    YA+ + +  G    K+I EPGR + A+ GI VT+V+ +K ++DK 
Sbjct: 241 GVTY-DDETPPQPDVYAAALLERLGGRDLKLIFEPGRAIAANAGIFVTQVLYLKGNSDKH 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F ++D AMND +RP+LY A+  I  +    G+  +   DIVGP+CETGDF+  +R++ L 
Sbjct: 300 FALVDGAMNDLIRPSLYSAWQNIIPVKPREGETRNY--DIVGPVCETGDFLGKDRELNLD 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
             GD L +  +GAYG   S  YNSR    EIMV+GS+ H+IR R    +L +
Sbjct: 358 -AGDFLAVRSSGAYGFTMSSNYNSRPRAAEIMVDGSRAHLIREREKLSQLWQ 408


>gi|149376983|ref|ZP_01894737.1| diaminopimelate decarboxylase [Marinobacter algicola DG893]
 gi|149358760|gb|EDM47230.1| diaminopimelate decarboxylase [Marinobacter algicola DG893]
          Length = 416

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 187/409 (45%), Positives = 258/409 (63%), Gaps = 3/409 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G L AENV++E +A    TP Y YS   +E++Y  + +A  G   +VCYA+K
Sbjct: 1   MDHFNYRSGELFAENVAVEDIARRFGTPAYVYSRATLERHYRAYDDALAGRPHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LG+G DIVS GEL R + A     + VFSGVGK   E+  AL++G+ 
Sbjct: 61  ANSNIAVLNVLARLGAGFDIVSAGELERVIRAGGDPAKTVFSGVGKQRWEMRRALEAGVR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES++EL  LN+ A  LG +AP++ RVNPD++A TH  ISTG KE+KFGI I +  +
Sbjct: 121 CFNVESDTELDRLNEVAGELGVRAPVSLRVNPDVDAGTHPYISTGLKENKFGIDIAEAPA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ +  + I GVD HIGSQ+  +  F  A   + +L   L     NI+H+D+GGGL
Sbjct: 181 VYERAAAMANLDIQGVDCHIGSQLTSVSPFLDALDRVLELIDTLAKKNINIRHLDMGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  +  PP  SDY + + +  G+   ++I+EPGR + A+ GIL+T+V  +K +  + 
Sbjct: 241 GVTYDQEQ-PPQPSDYVTALAERLGDRSLELIMEPGRSIAANAGILLTRVEFLKCTEHRN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I D AMND +RP LY A+  I   V P  D    H D+VGP+CETGDF+  +RK+ L 
Sbjct: 300 FAITDAAMNDLIRPALYSAWQSI-IPVTPRNDGDEKHWDLVGPVCETGDFLGKDRKLRL- 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
           + GDLL +   GAYG V S  YN+R   PE+MV+G Q H++R R T +E
Sbjct: 358 QAGDLLAVRSAGAYGFVMSSNYNTRNRPPELMVDGEQVHVVRRRETLEE 406


>gi|94499872|ref|ZP_01306408.1| putative diaminopimelate decarboxylase [Oceanobacter sp. RED65]
 gi|94428073|gb|EAT13047.1| putative diaminopimelate decarboxylase [Oceanobacter sp. RED65]
          Length = 417

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/413 (45%), Positives = 261/413 (63%), Gaps = 3/413 (0%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
           F Y  G L AE  ++  LA    +P Y YS  A  ++YL ++NAF   D ++CYA+KANS
Sbjct: 5   FDYQNGELFAEQCAVSDLADRYGSPLYIYSRKAFSEHYLEYANAFKNEDALICYAVKANS 64

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFN 123
           N AV+  LA LG+G DIVS GEL R L A     +IVFSGV KT DE+  AL  G++CFN
Sbjct: 65  NIAVLNVLAKLGAGFDIVSVGELERVLKAGGDPSKIVFSGVAKTADEMRRALAVGVHCFN 124

Query: 124 VESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA 183
           VESESEL+ LN  A  +G KAP++ RVNPD++A TH  ISTG KE+KFG+ I     +YA
Sbjct: 125 VESESELERLNAVAEEMGVKAPLSLRVNPDVDAQTHPYISTGLKENKFGVDIDTAKQVYA 184

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIA 243
            A  + G++I GVD HIGSQ+ Q+E F  A   +  L  +L+     ++HID+GGGLG+ 
Sbjct: 185 KAKGMQGIEIKGVDCHIGSQLTQLEPFMDALDRVLVLVDELKEQAIELEHIDLGGGLGVT 244

Query: 244 YHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVI 303
           Y  D  PP+  ++A  +         K++LEPGR + A+ GI VT+V  +K + DK F I
Sbjct: 245 Y-DDEVPPTPQEFADAVLPKLAGRNLKLVLEPGRSIAANAGIFVTQVEFLKSNGDKHFAI 303

Query: 304 LDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPG 363
           +D  MND +RP+LY A+  I   V P       + D+VGP+CETGDF+  +R++A+  PG
Sbjct: 304 IDGGMNDLIRPSLYSAWQRI-VEVQPREKTPKQNYDVVGPVCETGDFLGKDRELAI-LPG 361

Query: 364 DLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           DLL ++  GAYG V +  YN+R    E+MV+G Q H+IR R T  + + L+++
Sbjct: 362 DLLAVKSAGAYGFVMASNYNTRNKPAEVMVDGDQSHLIRRRETISDQLMLEAL 414


>gi|70733296|ref|YP_263070.1| diaminopimelate decarboxylase [Pseudomonas fluorescens Pf-5]
 gi|68347595|gb|AAY95201.1| diaminopimelate decarboxylase [Pseudomonas fluorescens Pf-5]
          Length = 415

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 195/416 (46%), Positives = 260/416 (62%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  +A    TP Y YS   IE  Y  ++ A  GM  +VC+A+K
Sbjct: 1   MDAFNYRDGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYQAYAQALAGMPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   A++IVFSGVGKT D++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGQADKIVFSGVGKTRDDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L   A  LG +AP++ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNVESAEELERLQLVAAELGVRAPVSLRVNPDVDAGTHPYISTGLKENKFGIDIATAED 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LP ++I GVD HIGSQ+  +E F  A   L DL  +L   G  ++HID+GGGL
Sbjct: 181 VYIRAAQLPNLEIVGVDCHIGSQLTTLEPFIDALDRLLDLVDRLGECGIYLRHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP ++DY   + +        ++ EPGRF+VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEEPPLAADYVKAVRERLDGRDLALVFEPGRFIVANAGVLLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ +++  V P       + DIVGPICETGDF+A  R +AL 
Sbjct: 300 FAIVDGAMNDLIRPALYQAWMDVS-AVRPRDTEPRTY-DIVGPICETGDFLAKERTLALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+G Q   +R R T  EL   +S+
Sbjct: 358 E-GDLLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGDQAVEVRRRETVAELFAGESL 412


>gi|300113121|ref|YP_003759696.1| diaminopimelate decarboxylase [Nitrosococcus watsonii C-113]
 gi|299539058|gb|ADJ27375.1| diaminopimelate decarboxylase [Nitrosococcus watsonii C-113]
          Length = 417

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 195/415 (46%), Positives = 260/415 (62%), Gaps = 3/415 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L AE + L ++A     P Y YS  AIE  +  F  AF+     +CYA+K
Sbjct: 2   MEYFHYCNNVLWAEEIPLPEIASRFGMPCYIYSRAAIEHQWRAFDQAFEEHPHQICYAVK 61

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R LAA     RIVFSGVGK  DE++ AL  GI 
Sbjct: 62  ANSNLAVLDILARLGSGFDIVSVGELERVLAAGGDPGRIVFSGVGKRTDEMERALAVGIA 121

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE+EL  LN+ A  LG++AP++ RVNPD++A TH  I+TG +++KFGI I Q  +
Sbjct: 122 CFNVESEAELLRLNEIAGKLGQRAPVSLRVNPDVDARTHPYIATGLRDNKFGIEIDQALA 181

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A TLP + I GVD HIGSQ+  +  F  A + +  L  QL   G  ++HID+GGGL
Sbjct: 182 VYARAVTLPHIDILGVDCHIGSQLTSLSPFLAALERVLALVDQLAKRGIEVRHIDLGGGL 241

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  D  PPS   YA+ + +       +I +EPGR +V + G+L+T++  +K++  K 
Sbjct: 242 GIIYR-DEAPPSPQQYAAALREKLAGRDLEIWIEPGRAIVGNGGVLLTRIEYLKQAPQKN 300

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LYDA+ EI  +   A  R  +  D+VGP+CETGDF+   R++A+ 
Sbjct: 301 FAIVDAAMNDLLRPALYDAWQEIIPVTVDA-TREALLFDVVGPVCETGDFLGKQRQLAI- 358

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
             GDLL +   GAYG   S  YNSR    EIMV+G++ H++R R T + L E +S
Sbjct: 359 EAGDLLVVRAAGAYGFTMSSNYNSRPRAAEIMVDGAEAHLVRERETVESLYEGES 413


>gi|16126452|ref|NP_421016.1| diaminopimelate decarboxylase [Caulobacter crescentus CB15]
 gi|221235233|ref|YP_002517669.1| diaminopimelate decarboxylase [Caulobacter crescentus NA1000]
 gi|13423716|gb|AAK24184.1| diaminopimelate decarboxylase [Caulobacter crescentus CB15]
 gi|220964405|gb|ACL95761.1| diaminopimelate decarboxylase [Caulobacter crescentus NA1000]
          Length = 421

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/424 (42%), Positives = 270/424 (63%), Gaps = 7/424 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAF---DGMDTMVCY 57
           M+ F+Y    L  E V L K+A  V TP Y YS   +E++++ F +A      +D ++ Y
Sbjct: 1   MNHFEYGPQGLACEGVPLAKIAAEVGTPVYVYSRATLERHFVVFRDALAMSGVVDPLIAY 60

Query: 58  ALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQS 117
           A+KANSN AV+K L  LG+G D VSEGE+RRALAA +P ERIVFSGVGK   EI  ALQ+
Sbjct: 61  AVKANSNVAVLKVLGDLGAGADTVSEGEVRRALAAGIPGERIVFSGVGKARREIAFALQA 120

Query: 118 GIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQ 177
           G+   NVESE EL  + + A  LG +A +AFRVNPD+ A  H KI+TGK E+KFG+   +
Sbjct: 121 GVAEINVESEPELNLIAEVAAELGVRAKVAFRVNPDVAAGGHAKIATGKSENKFGVSFAE 180

Query: 178 IHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVG 237
              LYA AS    ++  GV  HIGSQI  +     AF  +R L +QL + G +++ +D+G
Sbjct: 181 AARLYANASNNANLQPVGVACHIGSQITDLAPMRAAFTKMRGLVEQLLAEGLSVERLDLG 240

Query: 238 GGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISI-KKS 296
           GGLG+ Y +   PPS +++A+++ +    L   +  EPGR + A+ G+LV++VI + ++ 
Sbjct: 241 GGLGVPYFNHPEPPSPAEFAAMVGEVTQGLPVTLAFEPGRVIAANAGVLVSEVIHVHERP 300

Query: 297 ADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRK 356
             + F+++D AMND +RP +YDA+H+I  ++   G+ ++   D+VGP+CETGD    +R 
Sbjct: 301 EGRKFLVIDAAMNDLVRPAMYDAFHDIRPVIQRTGETVY---DVVGPVCETGDTFTRDRA 357

Query: 357 IALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +     GDL+     GAYGA  +  YN+R L+PE++V+G ++ +IR R T+ E++  D +
Sbjct: 358 LPPFAAGDLVAFMSAGAYGAAMASEYNTRPLVPEVLVDGDRYAVIRQRPTYDEMLARDLV 417

Query: 417 PAWL 420
           P W+
Sbjct: 418 PDWV 421


>gi|49088246|gb|AAT51548.1| PA5277 [synthetic construct]
          Length = 416

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 192/416 (46%), Positives = 263/416 (63%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +  L AE V+L ++A    TP Y YS   IE  Y  +++A  GM  +VC+A+K
Sbjct: 1   MDTFSYRDAELFAEGVALSRIAERFGTPTYVYSRAHIEAQYRAYADALAGMPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA     ++VFSGVGKT D++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGDPAKVVFSGVGKTRDDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CF+VES  EL+ L + A  LG KAP++ RVNPD++A TH  ISTG KE+KFGI I +  +
Sbjct: 121 CFDVESGEELERLQRVAAELGVKAPVSLRVNPDVDAQTHPYISTGLKENKFGIAIDEAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ L  +++ GVD HIGSQ+ Q+E F  A + L  L  +L   G  I+H+D+GGGL
Sbjct: 181 VYARAAELDHLEVIGVDCHIGSQLTQLEPFLDALERLLGLVDRLAGKGIGIRHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D +PP + DY   I +        ++ EPGR +VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEQPPLAGDYIRAIRERLHGRDLTLVFEPGRSIVANAGVLLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ ++   V P  D      D+VGPICETGDF+A +R +AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVQ-AVRPR-DAAPRRYDLVGPICETGDFLAKDRDLALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+G Q H +R R T QEL   +S+
Sbjct: 358 E-GDLLAVRSAGAYGFVMSSNYNTRGRAAEVLVDGEQTHEVRRRETVQELYAGESL 412


>gi|330900736|gb|EGH32155.1| diaminopimelate decarboxylase [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 415

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 195/416 (46%), Positives = 259/416 (62%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  +A    TP Y YS   IE  Y  +++A  GM  MVC+A+K
Sbjct: 1   MDAFNYRDGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYRAYADALSGMPHMVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   AE+IVFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGKAEKIVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L + A  L  +API+ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNVESTDELERLQEVAAELNVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIAAAED 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS LP +++ GVD HIGSQ+  +E F  A   L DL  +L   G ++ HID+GGGL
Sbjct: 181 VYIRASQLPNLEVIGVDCHIGSQLTTLEPFIDALDRLLDLVDRLGDCGIHLHHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP +++Y   + +        ++ EPGRF+VA+ G L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEEPPLAAEYIKAVRERLAGRDLGLLFEPGRFIVANAGALLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ ++        D      DIVGPICETGDF+A  R++AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVT--AGRPRDSEPRAYDIVGPICETGDFLAKGRELALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+GSQ   +R R T  EL   +S+
Sbjct: 358 E-GDLLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGSQAFEVRRRETVAELFAGESL 412


>gi|146280906|ref|YP_001171059.1| diaminopimelate decarboxylase [Pseudomonas stutzeri A1501]
 gi|145569111|gb|ABP78217.1| diaminopimelate decarboxylase [Pseudomonas stutzeri A1501]
 gi|327479175|gb|AEA82485.1| diaminopimelate decarboxylase [Pseudomonas stutzeri DSM 4166]
          Length = 415

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 197/416 (47%), Positives = 263/416 (63%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  LA    TP Y YS   IE  Y  +++A +GM  +VC+A+K
Sbjct: 1   MEAFSYRDGQLFAEGVALPALAQRFGTPTYVYSRAHIEAQYRAYADALEGMPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA     RIVFSGVGKT D++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGEPGRIVFSGVGKTRDDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L Q A  LG KAP++ RVNPD++A TH  ISTG KE+KFGI I    +
Sbjct: 121 CFNVESTDELERLQQVAAELGMKAPVSLRVNPDVDAGTHPYISTGLKENKFGIDIDNAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LP +++ GVD HIGSQ+  +  F  A   L  L  +L + G  I+H+D+GGGL
Sbjct: 181 VYARAAELPNLEVVGVDCHIGSQLTSLPPFLDALDRLLALIDRLATRGIQIRHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D +PP + DY   + Q        ++ EPGR +VA+ G+L+T+V  +K +A K 
Sbjct: 241 GVRYR-DEQPPLAGDYIQAVRQRIEGRGLALVFEPGRSIVANAGLLLTRVEYLKHTAHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+  +  +    GD      DIVGPICETGDF+A +R++AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMNVIAVQPHEGDTRRY--DIVGPICETGDFLAKDRELALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+G Q   +R R + QEL   +S+
Sbjct: 358 E-GDLLAVCSAGAYGFVMSSNYNTRGRAAEVLVDGDQAFEVRRRESVQELYAGESL 412


>gi|156972658|ref|YP_001443565.1| diaminopimelate decarboxylase [Vibrio harveyi ATCC BAA-1116]
 gi|156524252|gb|ABU69338.1| hypothetical protein VIBHAR_00310 [Vibrio harveyi ATCC BAA-1116]
          Length = 417

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 198/418 (47%), Positives = 267/418 (63%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE+VSL+ LA    TP Y YS   +E+++  F +A      +VCYA+
Sbjct: 1   MDYFNYQDDGQLWAEDVSLQALAEQHGTPLYVYSRATLERHWNAFDSAVGQYPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+  LA LGSG DIVS GEL R +AA   A+++VFSGVGKT  E+  AL+ GI
Sbjct: 61  KANSNLGVLNALARLGSGFDIVSGGELERVIAAGGDAKKVVFSGVGKTPAEMKRALELGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG  API+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNKVAGELGVVAPISLRINPDVDAKTHPYISTGLRDNKFGIAFDRAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           ++Y +A +LP + + G+D HIGSQ+ +IE F  A   L  L   L++ G NI+H+DVGGG
Sbjct: 181 AVYKFAQSLPNLNVQGIDCHIGSQLTEIEPFIDATDRLLALIDDLKAQGINIRHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  SDYA  +     N Q  ++I EPGR + A+ GIL+T+V  +K +  
Sbjct: 241 LGVVYR-DELPPQPSDYAKALLGRLENHQDLELIFEPGRAIAANAGILLTRVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I   V+P     H + D+VGPICETGDF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDI-VPVSPREGEAHTY-DLVGPICETGDFLGKDRALV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L + GDLL +   GAYG V S  YN+R    E+MV+G+Q H++R R     L +L+ I
Sbjct: 358 L-QEGDLLAVRSAGAYGFVMSSNYNTRTRAAEVMVDGNQSHLVRQREELTSLWQLEQI 414


>gi|323519139|gb|ADX93520.1| diaminopimelate decarboxylase [Acinetobacter baumannii TCDC-AB0715]
          Length = 407

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 191/402 (47%), Positives = 261/402 (64%), Gaps = 3/402 (0%)

Query: 11  LHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKT 70
           +HAE  SLE+LA    TP Y YS  A EK+YL    AFD +D  +C+A+K+NSN AV+  
Sbjct: 1   MHAEQCSLEQLAQQFGTPLYVYSKAAFEKHYLDMDRAFDFIDHQICFAVKSNSNIAVLNV 60

Query: 71  LAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESEL 130
           LA LG+G DIVS GEL R L A   A +IVFSG+GKT  +I+ +L  GI CFNVES +EL
Sbjct: 61  LAKLGAGFDIVSGGELARVLKAGGDASKIVFSGLGKTEADIETSLNVGIACFNVESYAEL 120

Query: 131 KTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPG 190
             + + A  LGKKAPI+ RVNPD++A TH  ISTG KE+KFGIP   ++  Y YA++LP 
Sbjct: 121 DRIQKVAARLGKKAPISLRVNPDVDAKTHPYISTGLKENKFGIPSDAVYETYQYAASLPN 180

Query: 191 VKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRP 250
           ++I G+D HIGSQ+ + + F  A   +  +  +L+  G N++HID+GGGLG+ Y  D  P
Sbjct: 181 LEIVGIDCHIGSQLTETKPFVDALDRVIVMIDELKKLGINLKHIDIGGGLGVCYK-DETP 239

Query: 251 PSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMND 310
           PS  +YA+ +      L  K+ +EPGR + A+ G+L+TKV  +K +  + F I+D AMND
Sbjct: 240 PSVEEYANSMKPALEKLGLKVYMEPGRSISANAGVLLTKVDLLKPTTHRNFAIIDAAMND 299

Query: 311 FMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEK 370
            +RP LY+A+ +I  +V P  D      D+VG ICETGDFI  +R +AL +  DLL +  
Sbjct: 300 LIRPALYEAWMDIQPVV-PRTDTEEKTWDLVGAICETGDFIGKDRSLAL-QENDLLTVLG 357

Query: 371 TGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
            GAYG V S  YN+R    E+MV+G + ++IR R T + L E
Sbjct: 358 AGAYGFVMSSNYNTRGRAAEVMVSGEKSYLIRERETVESLWE 399


>gi|152985290|ref|YP_001351336.1| diaminopimelate decarboxylase [Pseudomonas aeruginosa PA7]
 gi|150960448|gb|ABR82473.1| diaminopimelate decarboxylase [Pseudomonas aeruginosa PA7]
          Length = 415

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 192/416 (46%), Positives = 264/416 (63%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G L AE V+L ++A    TP Y YS   IE  Y  +++A  GM  +VC+A+K
Sbjct: 1   MDTFSYRDGELFAEGVALSRIAERFGTPTYVYSRAHIEAQYRAYADALAGMPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA     ++VFSGVGK+ D++  ALQ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGDPAKVVFSGVGKSRDDMRRALQVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L + A  LG KAP++ RVNPD++A TH  ISTG KE+KFGI I +  +
Sbjct: 121 CFNVESSEELERLQRVAAELGVKAPVSLRVNPDVDAQTHPYISTGLKENKFGIAIDEAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ L  +++ GVD HIGSQ+ Q+  F  A + L  L  +L + G  I+H+D+GGGL
Sbjct: 181 IYARAAELDHLEVIGVDCHIGSQLTQLAPFLDALERLLGLVDRLAARGIAIRHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D +PP + DY   I +        ++ EPGR +VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEQPPLAGDYIRAIRERLHGRDLTLVFEPGRSIVANAGVLLTRVEYLKHTGHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ ++   V P  D      D+VGPICETGDF+A +R++AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVQ-AVRPR-DAAPRRYDLVGPICETGDFLAKDRELALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL I   GAYG V S  YN+R    E++V+G + H +R R T  EL   +S+
Sbjct: 358 E-GDLLAIRSAGAYGFVMSSNYNTRGRAAEVLVDGERAHEVRRRETVPELYAGESL 412


>gi|86148171|ref|ZP_01066469.1| diaminopimelate decarboxylase [Vibrio sp. MED222]
 gi|218710945|ref|YP_002418566.1| diaminopimelate decarboxylase [Vibrio splendidus LGP32]
 gi|85834018|gb|EAQ52178.1| diaminopimelate decarboxylase [Vibrio sp. MED222]
 gi|218323964|emb|CAV20326.1| Diaminopimelate decarboxylase [Vibrio splendidus LGP32]
          Length = 417

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 198/418 (47%), Positives = 266/418 (63%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y E G L AE+V+L +LA    TP Y YS   +E+++  F ++      +VCYA+
Sbjct: 1   MDYFNYQEDGQLWAEDVALSQLAEQYGTPLYVYSRATLERHWNAFDSSVGEHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA LGSG DIVS GEL R +AA     ++VFSGVGKT  E+  AL+  I
Sbjct: 61  KANSNLGVLNTLARLGSGFDIVSGGELERVVAAGGDPAKVVFSGVGKTAAEMKRALELNI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG KAPI+ R+NPD++ANTH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNKVAGELGVKAPISLRINPDVDANTHPYISTGLRDNKFGIAFDRAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           ++YA+A TL  + I G+D HIGSQ+  IE F  A   L  L  QLR+N  NI+H+DVGGG
Sbjct: 181 AVYAFAKTLDNLSIHGIDCHIGSQLTDIEPFIDATDRLLALIDQLRANDINIKHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  SDYA +L+ +   +   ++I EPGR + A+ G+L+TKV  +K +  
Sbjct: 241 LGVVYR-DELPPQPSDYAKALLARLDNHSDLELIFEPGRAIAANAGVLLTKVEFLKPTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I  +    G+   +  D+VGPICETGDF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDIVPVSPRQGE--AVTYDLVGPICETGDFLGKDRDLV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L   GDLL +   GAYG   S  YN+R    E+MV+G + H++R R     L EL++I
Sbjct: 358 L-EEGDLLAVRSAGAYGFAMSSNYNTRSRAAEVMVDGDKTHLVRQREELTSLWELENI 414


>gi|163803627|ref|ZP_02197492.1| diaminopimelate decarboxylase [Vibrio sp. AND4]
 gi|159172575|gb|EDP57435.1| diaminopimelate decarboxylase [Vibrio sp. AND4]
          Length = 417

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 197/418 (47%), Positives = 268/418 (64%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE+VSL+ LA    TP Y YS   +E+++  F +A      +VCYA+
Sbjct: 1   MDYFNYQDDGQLWAEDVSLQVLAKQYGTPLYVYSRATLERHWKAFDSAVGQHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+  LA LGSG DIVS GEL R +AA   A+++VFSGVGKT  E+  AL+ GI
Sbjct: 61  KANSNLGVLNALARLGSGFDIVSGGELERVIAAGGDAKKVVFSGVGKTPAEMKRALELGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG  API+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNKVAGELGVVAPISLRINPDVDAKTHPYISTGLRDNKFGIAFDRAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           ++Y +A +LP + + G+D HIGSQ+ +IE F  A   L  L   L++ G +I+H+DVGGG
Sbjct: 181 AVYQFAQSLPNLNVQGIDCHIGSQLTEIEPFIDATDRLLTLIDGLKAQGIDIRHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  SDYA  +     N Q  ++I EPGR + A+ GIL+T+V  +K +  
Sbjct: 241 LGVVYR-DELPPQPSDYAKALLGRLENHQDLELIFEPGRAIAANAGILLTRVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I  +V   G+  +   D+VGPICETGDF+  +R +A
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDIVPVVPREGETQNY--DLVGPICETGDFLGKDRALA 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L + GDLL +   GAYG V S  YN+R    E+MV+G+Q H++R R     L +L+ I
Sbjct: 358 L-QEGDLLAVRSAGAYGFVMSSNYNTRTRAAEVMVDGNQSHLVRQREELTSLWQLEQI 414


>gi|187251103|ref|YP_001875585.1| diaminopimelate decarboxylase [Elusimicrobium minutum Pei191]
 gi|186971263|gb|ACC98248.1| Diaminopimelate decarboxylase [Elusimicrobium minutum Pei191]
          Length = 417

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 186/419 (44%), Positives = 265/419 (63%), Gaps = 3/419 (0%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
           F Y    LHAENV +E +A  V TP Y YS   + KN+  F NA       + Y++KANS
Sbjct: 2   FHYINCVLHAENVPVEIIAKEVGTPCYIYSNEILTKNFKDFDNALKKFKNTISYSIKANS 61

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFN 123
           N  ++KT+A LG G D+VS GE+  AL A +PA +IVFSGVGKT  E++ A+++ I   N
Sbjct: 62  NLGIVKTIASLGGGADVVSAGEMCIALKAGIPANKIVFSGVGKTKRELEEAIKNEILQIN 121

Query: 124 VESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA 183
            ESE+E+ T+N  A+ LGKKA IA RVNPD++A TH KI+TGKKE+KFG+       LY 
Sbjct: 122 AESEAEVNTINHIALKLGKKANIALRVNPDVDAKTHVKITTGKKENKFGVDWDIAKDLYI 181

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIA 243
            AS + G+ + G+ MHIGSQ+  ++ F  AF  + D+  +L   G  ++++D+GGGLGI 
Sbjct: 182 KASKMEGLNVVGIAMHIGSQLLDLDPFRLAFTKMADMVSELEKEGIILKNLDLGGGLGIN 241

Query: 244 YHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVI 303
           Y+ +  PP+   YA +I +  G     II+EPGR ++ +  IL+++VI  K    K F+I
Sbjct: 242 YNVE-LPPTKEAYAQVIEETLGKFNKHIIIEPGRSIIGEAAILISEVIFTKDMGSKHFII 300

Query: 304 LDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPG 363
           +D  MND MRP +YD++H I  +V        I ADIVGPICE+ D  A +R I   + G
Sbjct: 301 VDAGMNDLMRPAMYDSWHTIVPVVKKG--LAPITADIVGPICESSDTFAKDRIIEPVKQG 358

Query: 364 DLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWLQK 422
           +L+ +   GAYG+  S  YN R L+PE+MVN + F ++R R T++E++   +IP WL+K
Sbjct: 359 ELVAMMSAGAYGSSMSSVYNFRPLVPEVMVNKNAFTVVRKRTTYEEMLSGQTIPDWLKK 417


>gi|85859277|ref|YP_461479.1| diaminopimelate decarboxylase [Syntrophus aciditrophicus SB]
 gi|85722368|gb|ABC77311.1| diaminopimelate decarboxylase [Syntrophus aciditrophicus SB]
          Length = 427

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/421 (45%), Positives = 274/421 (65%), Gaps = 3/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y +  L  EN+ + ++A  V TPFY YS   +  ++  F+ AF  + +++C+A+K
Sbjct: 1   MNDFLYKDQQLWCENIPVSQIAEEVGTPFYLYSHATLRNHFRVFAEAFAKVPSIICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV++ L   G G+DIVS GEL RAL A V   ++V+SGVGK +DEI+ AL+SGI 
Sbjct: 61  ANSNLAVLRVLIAEGGGVDIVSGGELYRALQAGVEPGKVVYSGVGKRVDEIEYALRSGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL+ +N+ A +LG  A IA RVNPD++  TH  ISTG KE+KFGI I +   
Sbjct: 121 MFNVESLQELEVINRCAQNLGVSAGIALRVNPDVDPKTHPHISTGLKENKFGIDIERSLE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y +A +L  + I GV  HIGSQ+ ++  F +A + L  L  QL+    +I+++D+GGGL
Sbjct: 181 TYRHARSLQHLDIRGVSCHIGSQVTRLSPFLEALERLSLLVHQLKREDFDIRYVDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y+ +  PP  S+YA  I +   +L C  I EPGR +V + GILVT+V+  K + +K 
Sbjct: 241 GITYNQEM-PPHPSEYAKAILETSRDLDCTFIFEPGRVIVGNAGILVTRVLYTKSNDNKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F+I+D  MND +RP+LY+++H I  ++    +R  I AD+VGPICE+GD++A  RK+   
Sbjct: 300 FIIVDAGMNDLVRPSLYNSFHAIRPVIEE--NRKEIIADVVGPICESGDYLAKARKLKDF 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
             GDLL +   GAYG   +  YNSR  IPEIMV   Q++++R R T+ +LI  + IPA+L
Sbjct: 358 HRGDLLAVFSAGAYGFTMASNYNSRPRIPEIMVREDQYYVVRRRETYADLISHEEIPAFL 417

Query: 421 Q 421
           +
Sbjct: 418 K 418


>gi|308051401|ref|YP_003914967.1| diaminopimelate decarboxylase [Ferrimonas balearica DSM 9799]
 gi|307633591|gb|ADN77893.1| diaminopimelate decarboxylase [Ferrimonas balearica DSM 9799]
          Length = 414

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/416 (45%), Positives = 266/416 (63%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+L AE V L ++A    TP Y YS   IE+++  F  A      ++CYA+K
Sbjct: 1   MDHFSYRQGALSAEEVPLAEVAAAYGTPCYVYSRATIERHFHAFDRAVGDHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R + A     ++VFSGVGKT DE+  ALQ+GIY
Sbjct: 61  ANSNLAVLNLLARLGSGFDIVSGGELARVIQAGGDPGKVVFSGVGKTADEMRQALQAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE+EL+ LN+ A ++G KAP++ R+NPD++A TH  ISTG KE+KFGI + +   
Sbjct: 121 CFNVESEAELERLNEVAGAMGLKAPVSLRINPDVDAGTHPYISTGLKENKFGIAMARAEQ 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++  A++LP +++ G D HIGSQ+  +  F  A   L  L  +L   G  + H+DVGGGL
Sbjct: 181 VFQRAASLPNLQVKGADCHIGSQLTTLPPFIDALDRLLALVDRLAELGIVLSHLDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  +  PP   +YA  + ++ GN    +ILEPGR ++A+ G+L+T+V  +K   D+ 
Sbjct: 241 GVRY-DEESPPLPDEYARALREHLGNRPLTLILEPGRAIMANAGVLLTEVAYLKTGEDRH 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP+LY A+  I   V P  D  H   D+VGP+CETGDF+   R++ + 
Sbjct: 300 FAIVDAAMNDLIRPSLYSAWQAI-IPVEPR-DGPHQTYDVVGPVCETGDFLGKGRELCI- 356

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            PGDLL +  +GAYG   +  YNSR    E+MV+G   H+IR R T ++L + +S+
Sbjct: 357 EPGDLLAVRSSGAYGFTMASNYNSRPRAAEVMVDGDAHHLIRARETVEQLWQGESL 412


>gi|293602585|ref|ZP_06685029.1| diaminopimelate decarboxylase [Achromobacter piechaudii ATCC 43553]
 gi|292819012|gb|EFF78049.1| diaminopimelate decarboxylase [Achromobacter piechaudii ATCC 43553]
          Length = 429

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/418 (45%), Positives = 264/418 (63%), Gaps = 13/418 (3%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
           F+Y    L+AE+V L+ LAH + TP Y YS  A++  + T+ +A   +  +VCY +KANS
Sbjct: 17  FQYRNNVLYAEDVPLDHLAHGLGTPLYVYSRAALKAAWETYRSAIGPLPVLVCYGMKANS 76

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFN 123
           N AV+K    LG+G DIVS GEL+RALA      +IVFSGVGK + E+  AL +G+ CFN
Sbjct: 77  NLAVLKEFVRLGAGFDIVSGGELKRALAVGADPAKIVFSGVGKQVWEMRDALAAGVKCFN 136

Query: 124 VESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA 183
           VESE EL+ L+  A  +G +AP++ RVNPD+NA TH  ISTG KE+KFGI I     +Y 
Sbjct: 137 VESEGELRRLSDVAQEMGMRAPVSLRVNPDVNAQTHPYISTGLKENKFGIAIESALGVYL 196

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIA 243
            A  LPGV+I GVD HIGSQ+  I  +  A + L DL  QL   G  I H+D+GGGLGI 
Sbjct: 197 TAQALPGVEIVGVDCHIGSQLTDISPYFDALEKLLDLIGQLDQAGIRIAHLDLGGGLGIR 256

Query: 244 YHSDHRPPSSSDYASLIHQYFGNLQCK------IILEPGRFLVADVGILVTKVISIKKSA 297
           Y +D  PPS     +L+ + F  L  +      +ILEPGR LV + G+L+T V  +K + 
Sbjct: 257 Y-TDETPPSPK---ALLDRVFERLNARGQGHLHLILEPGRSLVGNAGVLLTTVQYLKHAD 312

Query: 298 DKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKI 357
            + F I+D AMND +RP LYDAYH +  +   AGD   +  DIVGP+CE+ D++A  R +
Sbjct: 313 ARNFAIVDAAMNDLLRPALYDAYHGVQPLRPRAGDL--VEYDIVGPVCESADWLAKGRAL 370

Query: 358 ALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
           A+ + GD+L +E  GAY    +  YN+R    E+MV+GS +H++R R T  +L+  +S
Sbjct: 371 AI-QQGDVLAVESAGAYSMAMASNYNTRARAAEVMVDGSNYHVVRQRETLDDLLRGES 427


>gi|254788013|ref|YP_003075442.1| diaminopimelate decarboxylase [Teredinibacter turnerae T7901]
 gi|237687153|gb|ACR14417.1| diaminopimelate decarboxylase [Teredinibacter turnerae T7901]
          Length = 421

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 181/411 (44%), Positives = 265/411 (64%), Gaps = 2/411 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y +  L  E  +L  +A    TP Y YS  +IE++Y  +++A      M+CYA+K
Sbjct: 1   MAHFSYNDNQLTVEGCTLSAIADTYDTPCYVYSRASIEQSYQAYASALGAHPGMICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANS+ AV++ LA  G+G DIVS+GEL+R LAA   A+R++FSGVGK  +E+  ALQ  I 
Sbjct: 61  ANSSLAVLQVLAQQGAGFDIVSQGELQRVLAAGGSADRVIFSGVGKKAEEMRFALQQQIA 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+TL Q A ++G  A ++ RVNPD++ANTH  ISTG KE+KFG+ I     
Sbjct: 121 CFNVESAAELETLAQVAQAMGTTARVSLRVNPDVDANTHPYISTGLKENKFGVDIQTALD 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A++L G+ + G+D HIGSQ+ Q+  F  A   +  L  QL   G  I+H+D+GGGL
Sbjct: 181 VYRRAASLDGIDVVGIDCHIGSQLTQLAPFMDALDRVLALMDQLAEEGITIRHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y+++ +PPS +DY   +    G+    ++ EPGR +VA+ G+L+T+V+ +K +  K 
Sbjct: 241 GVTYNNE-QPPSPADYVGQVIAKLGDRAVALMFEPGRSIVANAGVLLTRVLYLKPTEHKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP+LY A+  +  ++ P         D+VGP+CETGD++A +R +AL 
Sbjct: 300 FAIIDAAMNDNIRPSLYQAWQRVLPVIAPEESEPTQQWDLVGPVCETGDWLAKDRALAL- 358

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELI 411
             G +L +  +GAYG   S  YNSR    EIMV+G + H+IR R TF +L+
Sbjct: 359 HEGSVLALMSSGAYGFTMSSNYNSRTRAAEIMVDGDKHHLIRARETFADLV 409


>gi|84393560|ref|ZP_00992314.1| diaminopimelate decarboxylase [Vibrio splendidus 12B01]
 gi|84375839|gb|EAP92732.1| diaminopimelate decarboxylase [Vibrio splendidus 12B01]
          Length = 417

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 197/418 (47%), Positives = 266/418 (63%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y E G L AE+V+L +LA    TP Y YS   +E+++  F ++      +VCYA+
Sbjct: 1   MDYFNYQEDGQLWAEDVALSQLAEQYGTPLYVYSRATLERHWNAFDSSVGEHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA +GSG DIVS GEL R +AA     ++VFSGVGKT  E+  AL+  I
Sbjct: 61  KANSNLGVLNTLARMGSGFDIVSGGELERVVAAGGDPAKVVFSGVGKTAAEMKRALELNI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG KAPI+ R+NPD++ANTH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNKVAGELGVKAPISLRINPDVDANTHPYISTGLRDNKFGIAFDRAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           ++YA+A TL  + I G+D HIGSQ+  IE F  A   L  L  QLR+N  NI+H+DVGGG
Sbjct: 181 AVYAFAKTLDNLSIHGIDCHIGSQLTDIEPFIDATDRLLALIDQLRANDINIKHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  SDYA +L+ +   +   ++I EPGR + A+ G+L+TKV  +K +  
Sbjct: 241 LGVVYR-DELPPQPSDYAKALLARLDNHSDLELIFEPGRAIAANAGVLLTKVEFLKPTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I  +    G+   +  D+VGPICETGDF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDIVPVSPRQGE--AVTYDLVGPICETGDFLGKDRDLV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L   GDLL +   GAYG   S  YN+R    E+MV+G + H++R R     L EL++I
Sbjct: 358 L-EEGDLLAVRSAGAYGFAMSSNYNTRSRAAEVMVDGDKTHLVRQREELTSLWELENI 414


>gi|163793816|ref|ZP_02187790.1| D-3-phosphoglycerate dehydrogenase [alpha proteobacterium BAL199]
 gi|159180927|gb|EDP65444.1| D-3-phosphoglycerate dehydrogenase [alpha proteobacterium BAL199]
          Length = 420

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 194/421 (46%), Positives = 277/421 (65%), Gaps = 4/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+  +G+L  ENV L  +A  V TP Y YS  AI   Y   + A D +   + YA+K
Sbjct: 1   MQGFEIRDGALAVENVPLATIAEQVGTPAYVYSAGAIRTRYRALAAALDPLGIAIHYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSNQA+I  L  LG+G D+VS GEL RALAA +PA+RIVF+GVGKT DE+  AL +GI+
Sbjct: 61  ANSNQAIITLLRGLGAGADVVSGGELARALAAGIPADRIVFAGVGKTRDEMAAALDAGIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FN+ESE EL+TL + A S G  A +  RVNP+++A TH KI+TGK E+KFG+PI +  +
Sbjct: 121 LFNIESEPELETLAEVARSKGTTARVGLRVNPNVDAKTHAKITTGKAENKFGVPIERAPA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            +A A  L GV+  G+ +HIGSQI  +E + + +  +R++   LR+ G+ ++++D+GGGL
Sbjct: 181 FFARAGELSGVEAVGLSVHIGSQILDLEPYRQTYVRVREMALTLRAQGYGLRNLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  +   P     A++I +  G+L  ++ +EPGR+LV   G+L+ +VI +K+   K 
Sbjct: 241 GIGYRGEEG-PDPQGLAAIIKEQLGDLDFELAVEPGRWLVGAAGVLLARVILVKQGETKR 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHI-HADIVGPICETGDFIALNRKIAL 359
            V++D AMND +RPTLY+ +H I  +V    DR     ADIVGPICE+GD++A +R +  
Sbjct: 300 HVVVDAAMNDLIRPTLYEGFHRIEPVVGR--DRADAGMADIVGPICESGDYLAKDRPLPA 357

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              G+LL +   GAYGAV S TYN+R L PE++V+G ++ +IRPR +   LI LD +P W
Sbjct: 358 VAAGELLVVRDAGAYGAVMSSTYNARPLAPEVLVDGDRWTVIRPRQSVDALIALDKVPDW 417

Query: 420 L 420
           L
Sbjct: 418 L 418


>gi|294651118|ref|ZP_06728454.1| diaminopimelate decarboxylase [Acinetobacter haemolyticus ATCC
           19194]
 gi|292823012|gb|EFF81879.1| diaminopimelate decarboxylase [Acinetobacter haemolyticus ATCC
           19194]
          Length = 416

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/410 (46%), Positives = 263/410 (64%), Gaps = 3/410 (0%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           +F    G LHAE  SL++LA    TP Y YS   +EK+YL    AFD +D  +C+A+K+N
Sbjct: 2   SFTRINGVLHAEQCSLDQLAQQYGTPLYVYSKATLEKHYLDMDRAFDFIDHQICFAVKSN 61

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+  LA LG+G DIV+ GEL R LAA     +IVFSG+GK+  +I+ AL  GI CF
Sbjct: 62  SNIAVLNVLAKLGAGFDIVTGGELARVLAAGGDPAKIVFSGLGKSEADIEKALTVGIACF 121

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES +EL  + + A  LGKKAPI+ RVNPD++A TH  ISTG KE+KFGIP   + + Y
Sbjct: 122 NVESHAELDRIQKVAAKLGKKAPISLRVNPDVDAKTHPYISTGLKENKFGIPSDAVDATY 181

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
            YA++L  ++I G+D HIGSQ+ + + F  A   +  + +QL+  G N++HID+GGGLG+
Sbjct: 182 QYAASLSNLEIVGIDCHIGSQLTETKPFVDALDRVILMIEQLKKLGINLKHIDIGGGLGV 241

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y  D  PP+ ++YA+ +      L  K+ +EPGR + A+ G L+TKV  +K +  + F 
Sbjct: 242 CY-KDETPPTVAEYANSMRPALEKLGLKVYMEPGRSISANAGALLTKVDLLKPTNHRNFA 300

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND +RP LY+A+ +I   VNP  D      D+VG ICETGDF+   R +AL + 
Sbjct: 301 IIDAAMNDLIRPALYEAWMDIQS-VNPNSDVEVKTWDLVGAICETGDFLGKERNLAL-QE 358

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
            D+L +   GAYG V S  YNSR    E+MVNG Q ++IR R T + L E
Sbjct: 359 NDVLAVLGAGAYGFVMSSNYNSRGRAAEVMVNGDQVYLIRERETIESLWE 408


>gi|88861274|ref|ZP_01135906.1| putative diaminopimelate decarboxylase [Pseudoalteromonas tunicata
           D2]
 gi|88816755|gb|EAR26578.1| putative diaminopimelate decarboxylase [Pseudoalteromonas tunicata
           D2]
          Length = 416

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/412 (46%), Positives = 269/412 (65%), Gaps = 3/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +  L AE VS++ +A    TP Y YS   +E++Y  F++A  G   +VCYA+K
Sbjct: 1   MDHFNYRDNQLFAEGVSVQDIATQFGTPCYVYSRATLERHYHAFTDAAAGQHHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS+GEL R +AA     ++VFSGV KT  EI  AL+ GI 
Sbjct: 61  ANSNLAVLNVLARLGSGFDIVSQGELARVVAAGGDPRKVVFSGVAKTAHEIRYALELGIK 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE+EL+ ++  A  LG+ API+ RVNPDI+A TH  ISTG KE+KFGI IH+  S
Sbjct: 121 CFNVESEAELERISDVATELGQTAPISIRVNPDIDAKTHPYISTGLKENKFGIEIHRAVS 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y +A+TLPG+ I G+D HIGSQ+ ++E F  A   +  + +QL++   +I+H+DVGGGL
Sbjct: 181 VYQHAATLPGISIEGIDFHIGSQLTEVEPFLAALDKVLAIIKQLKTLNIHIKHLDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+AY ++  P  SS  + L+ +       +++ EPGR + A+ GIL+T+V  +K++  K 
Sbjct: 241 GVAYLAEEPPHPSSYVSQLVERLSEFSDLELVFEPGRAIAANAGILITQVEFLKQNQGKN 300

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D  MND +RP+LY A+  I  +   +G       DIVGP+CETGDF+  +R+++L 
Sbjct: 301 FAIVDAGMNDLLRPSLYQAWQNIIAVSPRSGTPSSY--DIVGPVCETGDFLGKDRELSL- 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
           + GDLL +   GAYG   S  YNSR  + EIMV+G+  H IR R T  +L +
Sbjct: 358 QQGDLLAVRSAGAYGFSMSSNYNSRPRVAEIMVDGATAHEIRKRETIADLYQ 409


>gi|313501204|gb|ADR62570.1| LysA_2 [Pseudomonas putida BIRD-1]
          Length = 415

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/417 (45%), Positives = 267/417 (64%), Gaps = 6/417 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+AF Y +G L AE V+L  +A    TP Y YS   IE  Y ++++A  G + +VC+A+K
Sbjct: 1   MNAFNYRDGELFAEGVALSAIAERYGTPTYVYSRAHIEAQYRSYADALQGTEHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   A+R+VFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSGGELERVLAAGGRADRVVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L   A  +GK AP++ RVNPD++A TH  ISTG KE+KFGI I    +
Sbjct: 121 CFNVESTDELERLQVVAAEMGKVAPVSLRVNPDVDAGTHPYISTGLKENKFGIAIADAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LP +++ GVD HIGSQ+  +E F  A   L  L  +L   G +++H+D+GGG+
Sbjct: 181 IYVRAAQLPNLEVVGVDCHIGSQLTTVEPFLDALDRLLVLVDRLAECGIHLRHLDLGGGV 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D +PP  +DY   I +  G     ++ EPGR++VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEQPPQVADYIKAIRERVGERDLALVFEPGRYIVANAGVLLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGD-RLHIHADIVGPICETGDFIALNRKIAL 359
           F I+D AMND +RP LY A+  ++ +   AG+ R +   D+VGPICETGDF+  +R + L
Sbjct: 300 FAIIDAAMNDLIRPALYQAWMGVSAVKPRAGEGRAY---DLVGPICETGDFLGKDRVLNL 356

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GDLL +E  GAYG V S  YN+R    EI+V+G Q   +R R T  EL   +S+
Sbjct: 357 AE-GDLLAVESAGAYGFVMSSNYNTRGRCAEILVDGDQAFEVRRRETVAELYAGESL 412


>gi|167647175|ref|YP_001684838.1| diaminopimelate decarboxylase [Caulobacter sp. K31]
 gi|167349605|gb|ABZ72340.1| diaminopimelate decarboxylase [Caulobacter sp. K31]
          Length = 432

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 184/418 (44%), Positives = 266/418 (63%), Gaps = 7/418 (1%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDG---MDTMVCYALK 60
           F+Y    L  E V L K+A  V TP Y YS   +E+++  F +A      +D ++ YA+K
Sbjct: 15  FEYGPEGLACEGVPLAKIASQVGTPVYVYSRATLERHFTVFRDALLAAGVIDPLIAYAVK 74

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+K L +LG+G D VSEGE+RRALAA +P ERIVFSGVGK   EI  AL++G+ 
Sbjct: 75  ANSNVAVLKVLGNLGAGADTVSEGEVRRALAAGIPGERIVFSGVGKKRGEIAFALRAGVA 134

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
             NVESE EL  +   A  LG KA +AFRVNPD+ A  H KI+TGK E+KFG+   +   
Sbjct: 135 EINVESEPELNLIAAVAAELGVKAKVAFRVNPDVAAGGHAKIATGKSENKFGVSFAEAAR 194

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LYA AS    ++  GV  HIGSQI  +    +AF  +R L +QL   G +++ +D+GGGL
Sbjct: 195 LYANASNNANLEPIGVACHIGSQITDLSPMRQAFTKMRGLVEQLLGEGLHVERLDLGGGL 254

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISI-KKSADK 299
           G+ Y     PPS +D+A+++ +    L  K+  EPGR + A+ G+LV++VI + ++   K
Sbjct: 255 GVPYFDMPEPPSPADFAAMVGEVTQGLPVKLAFEPGRVIAANAGVLVSEVIHVHERPEGK 314

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+++D AMND +RP +YDA+H+I  ++  AG+ ++   D+VGPICETGD    +R +  
Sbjct: 315 RFLVIDAAMNDLIRPAMYDAFHDIRPLIKRAGETVY---DVVGPICETGDTFTRDRALPP 371

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIP 417
              GDL+     GAYGA  +  YN+R L+PE++V+G  F +IR R +++E++  D +P
Sbjct: 372 LAAGDLVAFMSAGAYGAAMASEYNTRPLVPEVLVDGDTFAVIRARPSYEEILARDLVP 429


>gi|127511256|ref|YP_001092453.1| diaminopimelate decarboxylase [Shewanella loihica PV-4]
 gi|126636551|gb|ABO22194.1| diaminopimelate decarboxylase [Shewanella loihica PV-4]
          Length = 414

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 184/412 (44%), Positives = 264/412 (64%), Gaps = 4/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +  L+AE  ++  LA    TP Y YS   +E+++  F NA      M+CYA+K
Sbjct: 1   MDHFLYQQDELYAEQCTVASLAETYGTPLYVYSRATLERHWHAFDNAVADHPHMICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R L A   A ++VFSGVGKT+ E+++AL++GIY
Sbjct: 61  ANSNLAVLNVLARLGSGFDIVSGGELARVLEAGGEASKVVFSGVGKTVAEMEMALEAGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN  A+ LGK AP++ RVNPD++A TH  ISTG KE+KFGI + +  +
Sbjct: 121 CFNVESAAELEQLNLVALRLGKVAPVSLRVNPDVDAGTHPYISTGLKENKFGIAMEEAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++  A+ LPG+ + G D HIGSQ+ +++ F  A   +  L  +L   G  I H+DVGGGL
Sbjct: 181 IFLRANELPGLAVKGADCHIGSQLTELQPFLDAMDRMLALIDRLAEQGVKIAHLDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  + +PP  S YAS +         K+I EPGR + A+ GI VT+V+ +K++A+K 
Sbjct: 241 GVTYDGE-QPPEPSAYASALLGKLAGRDLKLIFEPGRAIAANAGIFVTQVLYLKENAEKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F ++D AMND +RP+LY A+ +I  +V   G+      D+VGP+CETGDF+  +R + + 
Sbjct: 300 FALVDGAMNDLIRPSLYSAWQKIIPVVPRPGETRQY--DVVGPVCETGDFLGKDRALNI- 356

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
           R  DLL +  +GAYG   +  YNSR    E+MV+G + +++R R    +L +
Sbjct: 357 RANDLLAVRSSGAYGFTMASNYNSRPRAAEVMVDGERHYLVREREKVAQLWQ 408


>gi|254419909|ref|ZP_05033633.1| diaminopimelate decarboxylase [Brevundimonas sp. BAL3]
 gi|196186086|gb|EDX81062.1| diaminopimelate decarboxylase [Brevundimonas sp. BAL3]
          Length = 424

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/426 (43%), Positives = 267/426 (62%), Gaps = 8/426 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGM-----DTMV 55
           M  F   +G+L+AE V LE +A  V TP Y YST  ++++Y     A D       + ++
Sbjct: 1   MHHFDLKDGALYAEGVPLEIIADEVGTPVYVYSTATLKRHYGLLRAAADAHREALGEALI 60

Query: 56  CYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLAL 115
            +A+KANSN +V+ TLA LGSG D VSEGE+RRALAA +PA+RI+FSGVGKT  E+  A+
Sbjct: 61  AFAVKANSNLSVLATLAKLGSGADTVSEGEIRRALAAGIPADRIIFSGVGKTDVEMVFAI 120

Query: 116 QSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPI 175
             G+   N+ES +EL  L   A  +     +A RVNP++ A  H KI+TG K DKFG+P+
Sbjct: 121 GVGVRQINIESGAELDRLIAVAALMQASPAVAVRVNPNVGAGGHAKITTGGKGDKFGVPV 180

Query: 176 HQIHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHID 235
            +  +LYA AS  P V   G+  HIGSQI+ +     AF +L  +T+ LR+ GH +  +D
Sbjct: 181 EEAMALYARASASPYVTPVGLACHIGSQINDLAPLEAAFTVLAQMTRDLRAQGHAVTRLD 240

Query: 236 VGGGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKK 295
           +GGGLG+ Y     PPS +DY ++  +    L  +   EPGR L A+ G+L+++VI + +
Sbjct: 241 LGGGLGVPYSGGVEPPSPADYVAMAARVLSGLDVEAAFEPGRLLAANAGVLLSQVIQVNE 300

Query: 296 SAD-KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALN 354
            +D + F++LD AMND MRP LYDA+H+I   VNP       H D+VGP+CETGD  A +
Sbjct: 301 RSDGRRFLVLDAAMNDLMRPALYDAFHDIKP-VNPRPGAALSH-DVVGPVCETGDTFARD 358

Query: 355 RKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELD 414
           R +      DL+     GAYGAV +  YNSR L+PE++V+G Q+ +IRPR T++++++ +
Sbjct: 359 RSLPPLEAEDLVVFTGAGAYGAVMASEYNSRPLVPEVLVDGDQWAVIRPRPTYEDMLDRE 418

Query: 415 SIPAWL 420
               WL
Sbjct: 419 PFADWL 424


>gi|26991903|ref|NP_747328.1| diaminopimelate decarboxylase [Pseudomonas putida KT2440]
 gi|24987026|gb|AAN70792.1|AE016723_4 diaminopimelate decarboxylase [Pseudomonas putida KT2440]
          Length = 415

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/417 (45%), Positives = 267/417 (64%), Gaps = 6/417 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+AF Y +G L AE V+L  +A    TP Y YS   IE  Y ++++A  G + +VC+A+K
Sbjct: 1   MNAFNYRDGELFAEGVALSAIAERYGTPTYVYSRAHIEAQYRSYADALQGTEHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   A+R+VFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSGGELERVLAAGGRADRVVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L   A  +GK AP++ RVNPD++A TH  ISTG KE+KFGI I    +
Sbjct: 121 CFNVESTDELERLQVVAAEMGKVAPVSLRVNPDVDAGTHPYISTGLKENKFGIAIADAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LP +++ GVD HIGSQ+  +E F  A   L  L  +L   G +++H+D+GGG+
Sbjct: 181 IYVRAAQLPNLEVVGVDCHIGSQLTTVEPFLDALDRLLVLVDRLAECGIHLRHLDLGGGV 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D +PP  +DY   I +  G     ++ EPGR++VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEQPPRVADYIKAIRERVGERDLALVFEPGRYIVANAGVLLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGD-RLHIHADIVGPICETGDFIALNRKIAL 359
           F I+D AMND +RP LY A+  ++ +   AG+ R +   D+VGPICETGDF+  +R + L
Sbjct: 300 FAIIDAAMNDLIRPALYQAWMGVSAVKPRAGEGRAY---DLVGPICETGDFLGKDRVLNL 356

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GDLL +E  GAYG V S  YN+R    EI+V+G Q   +R R T  EL   +S+
Sbjct: 357 AE-GDLLAVESAGAYGFVMSSNYNTRGRCAEILVDGDQAFEVRRRETVAELYAGESL 412


>gi|302343308|ref|YP_003807837.1| diaminopimelate decarboxylase [Desulfarculus baarsii DSM 2075]
 gi|301639921|gb|ADK85243.1| diaminopimelate decarboxylase [Desulfarculus baarsii DSM 2075]
          Length = 420

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/420 (45%), Positives = 273/420 (65%), Gaps = 1/420 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y +G LHAE VSL ++A  V TP Y Y+ +A+   +  F  AF G+D ++CYA+K
Sbjct: 1   MDLFEYRDGVLHAEGVSLTEIAQAVGTPTYVYAQSAMRAEFAAFQEAFAGLDHLICYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN+AV+ + A +G G DIVS GEL RALAA VPAERIV+SGVGK   E++ AL++GI 
Sbjct: 61  ANSNKAVLGSFAAMGGGADIVSGGELARALAAGVPAERIVYSGVGKLDWELEAALKAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL  L+Q A  LG KAP++ RVNPD++A TH KI+TG  ++KFG+ +    +
Sbjct: 121 MFNVESAQELTVLDQIAGRLGLKAPVSLRVNPDVDAKTHPKITTGLAKNKFGLDMGLAFA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y +A+ LP + + GV  HIGSQ+ ++  F  A + L DL Q+LR  G  ++ ID+GGG+
Sbjct: 181 QYLHAARLPNLVVKGVSCHIGSQLTEVAPFVDALERLADLVQRLRREGLRLEIIDLGGGI 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y+ +  PP+  +YA+ +      L  K++LEPGR LV + G+L+T+V   K +  K 
Sbjct: 241 GIRYNQET-PPTPREYAARLRPVLEGLGLKLVLEPGRRLVGEAGVLLTRVHYAKTTPAKH 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FV++D AMND +RP  YD++H +  +   AG+   + AD+VG ICETGDF+   R + + 
Sbjct: 300 FVVVDAAMNDLIRPAFYDSFHAVRPVAQNAGNGQRLVADVVGGICETGDFLVRERDLPVL 359

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
           R GDLL I   GAYG   S  YNSR    E++V G ++ ++R R + ++L   + +  W+
Sbjct: 360 RRGDLLAIMSAGAYGFAMSSQYNSRPRAAEVLVCGQEWAVVRRRESIEDLSRGEELAPWM 419


>gi|148550336|ref|YP_001270438.1| diaminopimelate decarboxylase [Pseudomonas putida F1]
 gi|148514394|gb|ABQ81254.1| diaminopimelate decarboxylase [Pseudomonas putida F1]
          Length = 415

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/417 (45%), Positives = 267/417 (64%), Gaps = 6/417 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+AF Y +G L AE V+L  +A    TP Y YS   IE  Y ++++A  G + +VC+A+K
Sbjct: 1   MNAFNYRDGELFAEGVALSAIAERYGTPTYVYSRAHIEAQYRSYADALQGTEHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   A+R+VFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSGGELERVLAAGGRADRVVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L   A  +GK AP++ RVNPD++A TH  ISTG KE+KFGI I    +
Sbjct: 121 CFNVESTDELERLQVVAAEMGKVAPVSLRVNPDVDAGTHPYISTGLKENKFGIAIADAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LP +++ GVD HIGSQ+  +E F  A   L  L  +L   G +++H+D+GGG+
Sbjct: 181 IYVRAAQLPNLEVVGVDCHIGSQLTTVEPFLDALDRLLVLVDRLAECGIHLRHLDLGGGV 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D +PP  +DY   I +  G     ++ EPGR++VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEQPPRVADYIKAIRERVGERDLALVFEPGRYIVANAGVLLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGD-RLHIHADIVGPICETGDFIALNRKIAL 359
           F I+D AMND +RP LY A+  ++ +   AG+ R +   D+VGPICETGDF+  +R + L
Sbjct: 300 FAIIDAAMNDLIRPALYQAWMGVSAVKPRAGEGRAY---DLVGPICETGDFLGKDRVLNL 356

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GDLL +E  GAYG V S  YN+R    EI+V+G Q   +R R T  EL   +S+
Sbjct: 357 TE-GDLLAVESAGAYGFVMSSNYNTRGRCAEILVDGDQAFEVRRRETVAELYAGESL 412


>gi|302879299|ref|YP_003847863.1| diaminopimelate decarboxylase [Gallionella capsiferriformans ES-2]
 gi|302582088|gb|ADL56099.1| diaminopimelate decarboxylase [Gallionella capsiferriformans ES-2]
          Length = 417

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 197/412 (47%), Positives = 266/412 (64%), Gaps = 14/412 (3%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
           F Y    LHAE+VSL  +A V +TP Y YS  A+ + +  FS+A  G + ++CYA+KAN+
Sbjct: 7   FNYINNQLHAEDVSLSDIAAVHETPCYVYSRAALTEGFREFSDALQGREHLICYAVKANA 66

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFN 123
           N A++   A LG+G DIVS GEL+R LAA   A ++VFSGVGKT  E+ LAL +GI CFN
Sbjct: 67  NLAILNVFARLGAGFDIVSGGELQRVLAAGGDARKVVFSGVGKTRAEMRLALDAGILCFN 126

Query: 124 VESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA 183
           VES +EL  LN+ A S+GK A I+ RVNPD++A TH  ISTG K++KFG+   +  +LY 
Sbjct: 127 VESAAELDRLNEVAGSMGKIAAISLRVNPDVDAKTHPYISTGLKQNKFGVAYTEAVALYR 186

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIA 243
            AS L  ++I+G+D HIGSQ+ +   F  A + +  L  +L S G  ++H+D+GGGLGI 
Sbjct: 187 KASGLKNLRITGMDCHIGSQLTETSPFIAAIEKILLLVDELASEGIALEHLDLGGGLGIC 246

Query: 244 YHSDHRPPSSSDY-ASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
           Y  D  PP+  +Y A+L+    G  Q K+ILEPGR LV + G+L+T+V  IK   +K F 
Sbjct: 247 Y-DDETPPAIGEYIAALLGALQGRTQ-KLILEPGRVLVGNAGVLLTRVEYIKPGEEKNFA 304

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHA----DIVGPICETGDFIALNRKIA 358
           I+D AMND MRP LYDAYH I  +V  A      HA    ++VGPICETGDFI   R++A
Sbjct: 305 IVDAAMNDLMRPALYDAYHGILPVVREA------HAVQSYEVVGPICETGDFIGHARELA 358

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
           +  P  LL +   GAYG   S  YN+R    E+MV+G+  H++R R T  +L
Sbjct: 359 IA-PHSLLAVMSAGAYGMSMSSNYNTRPRAAEVMVDGTAVHLVRERETVPQL 409


>gi|39995269|ref|NP_951220.1| diaminopimelate decarboxylase [Geobacter sulfurreducens PCA]
 gi|39982031|gb|AAR33493.1| diaminopimelate decarboxylase [Geobacter sulfurreducens PCA]
 gi|298504274|gb|ADI82997.1| diaminopimelate decarboxylase [Geobacter sulfurreducens KN400]
          Length = 417

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/420 (44%), Positives = 264/420 (62%), Gaps = 3/420 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    LHAE VSL+++   V +P Y YS   + +++  F  AF G+   +CY++K
Sbjct: 1   MNHFQYKGNELHAEEVSLKEIVARVGSPVYVYSHATLTRHFTAFDEAFAGVPHTICYSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANS QAV++T   LG G DIVS GEL RAL A V  +++V+SGVGK  DEI+ AL +GI 
Sbjct: 61  ANSTQAVLRTFITLGGGADIVSGGELYRALQAGVDPKKVVYSGVGKKDDEIEYALNTGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE EL  +++ A  +GKKA IA RVNPD++  TH  I+TG K  KFGI I +  +
Sbjct: 121 MFNVESEQELTRISEIASRMGKKAGIAIRVNPDVDPQTHPYITTGLKNAKFGITIDRAMA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A TLPG+ + G+DMHIGSQ+ ++  F  + + L+ +   LR  G ++Q+ D GGGL
Sbjct: 181 EYARAKTLPGIDVIGIDMHIGSQLTKVTPFVDSIEKLKTMIANLRGQGIDLQYFDCGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y S   PP  +DY   I      L   ++ EPGR +V + GILV   +  K+  +K 
Sbjct: 241 GIQY-STEEPPLPADYGKEIVAATKELGMHLLFEPGRNIVGNAGILVATCLFTKERDEKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F+++D  MND  RP LY ++H +  +V        I ADIVGPICE+GDF+  +R++ + 
Sbjct: 300 FIMIDAGMNDLARPALYGSFHGVQPVVKDQDG--MIVADIVGPICESGDFLVKDREVPMF 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
           R GDL+     GAYG   S TYNSR  + E+MV G+QF ++R R T ++LI  + +P++L
Sbjct: 358 RQGDLMAFMSAGAYGFAMSSTYNSRPRVAEVMVKGNQFEVVRERETVEDLIRGERVPSFL 417


>gi|219871605|ref|YP_002475980.1| diaminopimelate decarboxylase [Haemophilus parasuis SH0165]
 gi|219691809|gb|ACL33032.1| diaminopimelate decarboxylase [Haemophilus parasuis SH0165]
          Length = 419

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 194/417 (46%), Positives = 274/417 (65%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L AE+V++  +     TP Y YS   +E+++  F  AF     ++C+A+K
Sbjct: 1   MDYFHYKNQQLFAEDVAIADIIAQHGTPAYIYSRATLERHWHAFDKAFGDHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN A++  +A LGSG DIVS+GEL R LAA   A ++VFSGV KT  EI  AL+ GI 
Sbjct: 61  SNSNLALLNVMARLGSGFDIVSQGELERVLAAGGDASKVVFSGVAKTHREIARALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SELK +N+ A  LGK API+ RVNPD++A TH  ISTG KE+KFG+ + +   
Sbjct: 121 CFNVESVSELKRINEVAGQLGKIAPISLRVNPDVDAKTHPYISTGLKENKFGVSVKEARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y +A+TLP VKI+G+D HIGSQ+ +++ F  A   +  L +QL+ +G  + H+D+GGGL
Sbjct: 181 VYRFATTLPHVKITGMDCHIGSQLTELQPFLDATDRVIVLMEQLKQDGIELHHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDY-ASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP   +Y A+L+++       +IILEPGR + A+ GILVTKV  IK++ D+
Sbjct: 241 GVTY-TDETPPHPMEYAAALLNKLRAYPNLEIILEPGRAITANAGILVTKVEYIKQNEDR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY+AY +I   VN +  R     D+VGPICET DF+   R++A+
Sbjct: 300 RFAIVDTGMNDMIRPALYEAYMQI-IEVNQSLVREKAIYDVVGPICETSDFLGKQRELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GDL+ +   GAYGA  S TYNSR    E+MV+G + H+I+ R +F++L  L++I
Sbjct: 359 AE-GDLIAMRSAGAYGATMSSTYNSRPQAIEVMVDGDKAHLIKARASFEDLWRLENI 414


>gi|157960206|ref|YP_001500240.1| diaminopimelate decarboxylase [Shewanella pealeana ATCC 700345]
 gi|157845206|gb|ABV85705.1| diaminopimelate decarboxylase [Shewanella pealeana ATCC 700345]
          Length = 414

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 185/416 (44%), Positives = 270/416 (64%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L+AE   + +LA    TP Y YS   +E+++  F NA      ++CYA+K
Sbjct: 1   MDHFLYQADELYAEQCQVAELAKQHGTPLYIYSRATLERHWRAFDNAVSEHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R + A     ++VFSGVGKT+ E+++AL  GIY
Sbjct: 61  ANSNIAVLNVLARLGSGFDIVSGGELSRVIEAGGDPTKVVFSGVGKTVSEMEMALNLGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN  A+ LGK AP++ R+NPD++A TH  ISTG KE+KFGI + +  +
Sbjct: 121 CFNVESAAELEQLNLVALRLGKVAPVSLRINPDVDAGTHPYISTGLKENKFGIAMEEAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++A A+ LPG+ + GVD HIGSQ+ +I+ F  A   +  L  +L   G  I+H DVGGGL
Sbjct: 181 IFARANELPGLAVKGVDCHIGSQLTEIKPFLDAMDRMLALIDRLAEQGIEIKHFDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D +PP    YA+ + +  G+   K+I EPGR + A+ GI VT+V+ +K+++DK 
Sbjct: 241 GVTY-DDEQPPQPDVYAAALLERLGDRDLKLIFEPGRAIAANAGIFVTQVLYLKENSDKR 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F ++D AMND +RP+LY A+ +I  ++  AG+  H + D+VGP+CETGDF+  +R++ + 
Sbjct: 300 FALVDGAMNDLIRPSLYSAWQKIVPVIERAGES-HSY-DVVGPVCETGDFLGKDRQLNV- 356

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           + GD L +  +GAYG   +  YNSR    E+MV+G + ++IR R    +L + + I
Sbjct: 357 QEGDYLAVRSSGAYGFTMASNYNSRPRAAELMVDGDKAYVIREREKVAQLWQGEQI 412


>gi|332286107|ref|YP_004418018.1| diaminopimelate decarboxylase [Pusillimonas sp. T7-7]
 gi|330430060|gb|AEC21394.1| diaminopimelate decarboxylase [Pusillimonas sp. T7-7]
          Length = 420

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 194/418 (46%), Positives = 268/418 (64%), Gaps = 11/418 (2%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
           F++  G+LHAE++SL +LA    TP Y YS  A+   +  +  A +G D +VCY +KANS
Sbjct: 7   FQFKNGALHAEDISLAQLATTYGTPLYVYSRQALHDAWEAYRIASEGRDVLVCYGMKANS 66

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFN 123
           N AV+    +LG+G DIVS GEL R LA      ++VFSGVGK + E+  AL++G+ CFN
Sbjct: 67  NLAVLNEFKNLGTGFDIVSGGELARVLAVGADPAKVVFSGVGKQVWEMQAALEAGVKCFN 126

Query: 124 VESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA 183
           VESE+EL  L Q A  +GK AP++ RVNPD++A TH  ISTG KE+KFGI I +   +Y 
Sbjct: 127 VESEAELTRLAQVAQDMGKVAPVSLRVNPDVDAQTHPYISTGLKENKFGIAIEKAIEVYQ 186

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIA 243
            A+TLP + I GVD HIGSQI ++  +  A   L  L Q L S+  +++H+D+GGG+GI 
Sbjct: 187 RAATLPSLSIVGVDCHIGSQITEVSPYLDALDKLIVLIQTLASHNIHLKHLDLGGGIGIR 246

Query: 244 YHSDHRPPSSSDYASLIHQYFGNLQ---CKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           Y +D +P + SD    + Q  G  Q    +I+LEPGR LV + G+L+T+V  +K S  K 
Sbjct: 247 Y-TDEQPLTPSDLLDKVFQTLGRHQLDHLQIVLEPGRSLVGNAGVLLTQVEYLKHSEAKN 305

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNP--AGDRLHIHADIVGPICETGDFIALNRKIA 358
           F I+D AMND +RPTLYDA+H +   V P   GD L+   DIVGPICE+GD++A +RK+ 
Sbjct: 306 FAIVDAAMNDLVRPTLYDAWHSVE-AVKPRQQGDTLY---DIVGPICESGDWLARDRKLT 361

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L + GDLL I   GAY    +  YN+R    E+MV+G   H++RPR   + L   ++I
Sbjct: 362 L-QQGDLLAIMSAGAYAFTMASQYNTRPRAAEVMVDGDTAHLVRPREPLESLYASETI 418


>gi|254292613|ref|YP_003058636.1| diaminopimelate decarboxylase [Hirschia baltica ATCC 49814]
 gi|254041144|gb|ACT57939.1| diaminopimelate decarboxylase [Hirschia baltica ATCC 49814]
          Length = 421

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/421 (45%), Positives = 264/421 (62%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G L  E V L+ +A+ V TP Y YST  +E++Y   + AF+G   ++ Y++K
Sbjct: 1   MHHFNYVNGRLQCEGVPLDDIANQVGTPTYVYSTATLERHYNVLAEAFEGSKYLIAYSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A  N  VI TLA LG+G D+VS GEL +AL A +PAE+IVFSGVGKT  E+  AL +GI+
Sbjct: 61  ACGNIGVIATLAKLGAGADVVSGGELAKALHAGIPAEKIVFSGVGKTHAELTAALNAGIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  E++ LN+ A+ LGK APIAFRVNP ++A  H  ISTG  E KFGI  H+   
Sbjct: 121 QFNVESFPEMERLNEIAIGLGKVAPIAFRVNPHVDAGGHANISTGGAEHKFGIAWHEAAD 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ + G+   GVD+HIGSQI  IE    AF+ +  L ++LR+ G  I+ +D+GGGL
Sbjct: 181 MYAKAAAMEGINPIGVDVHIGSQIMDIEPMRIAFEKVVALVRELRAQGIEIKRMDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  +  P S + YA +I +    +  ++ILEPGR +  + G+++  V  +K+   +T
Sbjct: 241 GIPYAPEDNPDSPAKYAQMIREVKQGVDVELILEPGRMIAGNAGVMLANVEYVKERDGRT 300

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FVILD  MND  RP LYD+ HE+  ++ PA D      D+VGP+CET D     R +   
Sbjct: 301 FVILDAGMNDLARPALYDSIHEVQPLIEPASDAPIAPVDLVGPVCETTDRFQKARPMHPL 360

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
           +  D +     GAYGAV S  YN+R L  E++VNG  F +IRPR ++ ++I L+  P WL
Sbjct: 361 KQDDKIAFMSAGAYGAVLSSQYNARPLAAEVLVNGDSFSVIRPRPSYDDIIALEKQPDWL 420

Query: 421 Q 421
           +
Sbjct: 421 E 421


>gi|90019887|ref|YP_525714.1| diaminopimelate decarboxylase [Saccharophagus degradans 2-40]
 gi|89949487|gb|ABD79502.1| diaminopimelate decarboxylase [Saccharophagus degradans 2-40]
          Length = 414

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 191/411 (46%), Positives = 262/411 (63%), Gaps = 4/411 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           MS F Y  G L AE  SL  +A  + TP Y YS  A  + Y  ++NA      MVCYA+K
Sbjct: 1   MSDFHYQNGELFAEQCSLNAIADALGTPCYVYSKAAFTRAYQDYANALGNHPGMVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV++ LA LG+G DIVS GELRR L A     RI+FSGVGKT +E+  AL+ GI 
Sbjct: 61  ANSNIAVLQVLAKLGAGFDIVSSGELRRVLKAGGQPNRIIFSGVGKTREEMREALEVGIA 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE+EL+ L   A  LG  A I+ RVNPD++A TH  ISTG KE+KFGI I +  +
Sbjct: 121 CFNVESEAELERLADVAAELGVVASISLRVNPDVDAKTHPYISTGLKENKFGIDIQRAPA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA AS L  +K+ GVD HIGSQ+ ++  F  A   L  L   L   G  I+H+D+GGGL
Sbjct: 181 VYARASELASLKVVGVDCHIGSQLTELTPFLDALDRLLQLVDTLAETGITIEHLDIGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP+ +DY + I    G+ +  II+EPGR + A+ G+++T+V  +K +  K 
Sbjct: 241 GVTYR-DEVPPAVADYLTQIKAKLGDRKLAIIMEPGRSIAANAGVMLTEVEFLKPTEHKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ ++  +    G+      D+VGP+CETGDF+A +R +AL 
Sbjct: 300 FAIIDGAMNDNIRPALYQAWQDVKPLSQREGETQQW--DLVGPVCETGDFLAKDRALAL- 356

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELI 411
           + GD L +  +GAYG V S  YN+R    E++V+G ++ ++R R +F++LI
Sbjct: 357 QAGDRLALMSSGAYGFVMSSNYNTRGRAAEVLVDGDKYFVVRERESFEDLI 407


>gi|120553431|ref|YP_957782.1| diaminopimelate decarboxylase [Marinobacter aquaeolei VT8]
 gi|120323280|gb|ABM17595.1| diaminopimelate decarboxylase [Marinobacter aquaeolei VT8]
          Length = 416

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/415 (45%), Positives = 263/415 (63%), Gaps = 3/415 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G L+AE+V++  +A    TP Y YS   +E++Y  +  A      +VCYA+K
Sbjct: 1   MDHFNYRNGELYAEDVAVADIAERFGTPAYIYSRATLERHYRAYDEALKNRPHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LG+G DIVS GEL R L A   A ++VFSGVGK   E+  AL++G+ 
Sbjct: 61  ANSNLAVLNVLARLGAGFDIVSAGELERVLRAGGDAGKVVFSGVGKQEWEMKRALEAGVR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES++EL  LN+ A  LG KAPI+ RVNPD++A TH  ISTG KE+KFGI I +  +
Sbjct: 121 CFNVESDTELDRLNKVAGELGVKAPISLRVNPDVDAGTHPYISTGLKENKFGIDIAEAPA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A++LP + I GVD HIGSQ+  +  F  A   +  L   L   G  I+H+D+GGGL
Sbjct: 181 VYARAASLPNLDIHGVDCHIGSQLTSVSPFLDALGRVLSLIDTLAEQGIRIRHLDMGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y+ +  PP  +DY   +++  G+ + +++LEPGR + A+ GILVT+V  +K +  + 
Sbjct: 241 GVTYNQET-PPQPADYVKALNERMGDRELELVLEPGRSIAANAGILVTRVEFLKCTEHRN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+  I   V P  D      D+VGP+CETGDF+  +R + L 
Sbjct: 300 FAIIDAAMNDLIRPALYSAWQAI-IPVQPHQDSEERPWDLVGPVCETGDFLGKDRALRL- 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
           + GDLL +   GAYG V +  YN+R   PE+MV+G Q H++R R T  + +  +S
Sbjct: 358 KAGDLLAVRSAGAYGFVMASNYNTRNRPPELMVDGDQVHVVRRRETLDDQLAPES 412


>gi|269961537|ref|ZP_06175900.1| diaminopimelate decarboxylase [Vibrio harveyi 1DA3]
 gi|269833766|gb|EEZ87862.1| diaminopimelate decarboxylase [Vibrio harveyi 1DA3]
          Length = 417

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 196/418 (46%), Positives = 265/418 (63%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE+VSL+ LA    TP Y YS   +E+++  F +A      +VCYA+
Sbjct: 1   MDYFNYQDDGQLWAEDVSLQALAEQHGTPLYVYSRATLERHWNAFDSAVGEHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+  LA LGSG DIVS GEL R +AA   A+++VFSGVGKT  E+  AL+ GI
Sbjct: 61  KANSNLGVLNALARLGSGFDIVSGGELERVIAAGGDAKKVVFSGVGKTPAEMKRALELGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG  API+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNKVAGELGVVAPISLRINPDVDAKTHPYISTGLRDNKFGIAFDRAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           ++Y +A +LP + + G+D HIGSQ+ +IE F  A   L  L   L++ G NI+H+DVGGG
Sbjct: 181 AVYKFAQSLPNLNVQGIDCHIGSQLTEIEPFIDATDRLLALIDDLKAQGINIRHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  SDYA  +     N Q  ++I EPGR + A+ GIL+T+V  +K +  
Sbjct: 241 LGVVYR-DELPPQPSDYAKALLGRLENHQDLELIFEPGRAIAANAGILLTRVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I  +    G+      D+VGPICETGDF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDIVPVAPREGEAQTY--DLVGPICETGDFLGKDRALV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L + GDLL +   GAYG V S  YN+R    E+MV+G+Q H++R R     L +L+ I
Sbjct: 358 L-QEGDLLAVRSAGAYGFVMSSNYNTRTRAAEVMVDGNQSHLVRQREELTSLWQLEQI 414


>gi|241762096|ref|ZP_04760179.1| diaminopimelate decarboxylase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|241373346|gb|EER62946.1| diaminopimelate decarboxylase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 421

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/424 (44%), Positives = 263/424 (62%), Gaps = 7/424 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGM---DTMVCY 57
           M  F    G+L  E++ L ++A    TP Y YS + + +    F+ A DG      +V +
Sbjct: 1   MIPFSLKNGTLCVEDIPLPEIAAQYGTPCYVYSHSYLTERARRFTKALDGAGKGKALVAF 60

Query: 58  ALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQS 117
           A+KAN +QA++ + A  G G D+VS GE+RRA+ A +P ERIVFSGVGKT +E+  AL+ 
Sbjct: 61  AVKANPSQAILASFAKEGLGADVVSAGEIRRAVHAGIPPERIVFSGVGKTAEEMRYALEI 120

Query: 118 GIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQ 177
           GI  FN+ES SE++ L + A SLGKKA +A R+NPD++ +TH KI+TGK + KFGI    
Sbjct: 121 GIGQFNIESVSEIEMLAEVAASLGKKAAVALRINPDVDPHTHAKIATGKADTKFGIAAED 180

Query: 178 IHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVG 237
             S Y   ++ P +KI G+  HIGSQI  +  F  A + + ++   L   GH I+  D+G
Sbjct: 181 ALSAYEKLASYPSLKIQGIASHIGSQITDLAPFEAAAERIYEIITALEKAGHAIETADLG 240

Query: 238 GGLGIAYHSDH-RPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKS 296
           GGLG+ Y  D   PPS   Y  +I +      C++I EPGR L+A+ GIL++KVI +K+S
Sbjct: 241 GGLGVRYKDDQPEPPSIEAYGEMIKRVTKGWNCRLIFEPGRSLIANAGILLSKVIRVKES 300

Query: 297 ADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRK 356
               FVILD AMND +RPTLYDAYHEI   V P+       ADIVGP+CETGD  A NR 
Sbjct: 301 KTARFVILDAAMNDLVRPTLYDAYHEIK-AVTPSAQAY--QADIVGPVCETGDIFARNRS 357

Query: 357 IALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           I   +P DL+ I   GAYGA  +  YNSR L+ E+MV+G++  +IR R + ++L+  +  
Sbjct: 358 IPAVKPDDLVAIMSAGAYGATMASAYNSRPLVAEVMVSGNKSALIRKRQSVEDLMRDEQK 417

Query: 417 PAWL 420
             WL
Sbjct: 418 VEWL 421


>gi|329847898|ref|ZP_08262926.1| diaminopimelate decarboxylase [Asticcacaulis biprosthecum C19]
 gi|328842961|gb|EGF92530.1| diaminopimelate decarboxylase [Asticcacaulis biprosthecum C19]
          Length = 458

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 184/432 (42%), Positives = 261/432 (60%), Gaps = 12/432 (2%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFD---------GM 51
           M+ F Y +G LH E VSL  +A  V TP Y YS+  +E++Y  F+ A +         G 
Sbjct: 1   MNHFDYLDGELHCEGVSLTDIARDVGTPVYVYSSATLERHYNVFAGALNASPALRSPKGE 60

Query: 52  DTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEI 111
             +V YA+KANSN AV++TLA  G G D VSEGE+R+A+ A VPAE+IVFSGVGKT  E+
Sbjct: 61  APLVAYAMKANSNLAVLRTLALQGCGADTVSEGEIRKAMTAGVPAEKIVFSGVGKTDAEM 120

Query: 112 DLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKF 171
             AL++GIY  NVES  EL  L + A SL   AP   R+NP + +  H KI+TG   DKF
Sbjct: 121 AFALKAGIYQLNVESRPELDRLARVAASLNMIAPFVIRINPGVGSGGHAKITTGGARDKF 180

Query: 172 GIPIHQIHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNI 231
           GI   +   LYA A+    +   G+  HIGSQI  +     AF  ++   + LR+ G ++
Sbjct: 181 GISAEEALKLYADAAAHRNLAPVGIACHIGSQITDLTPLQAAFSRMKGWVEALRAEGLSV 240

Query: 232 QHIDVGGGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVI 291
           + +D+GGGLG+ Y +   PP   D+A +     G+L  +   EPGR + A+ G+LV++V+
Sbjct: 241 ERLDLGGGLGVPYFNQPAPPHPVDFAEMAALTVGHLGLRYTFEPGRVIAANAGVLVSRVV 300

Query: 292 SIKKSAD--KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGD 349
            + +  D  + F++LD AMND +RP LYDAYH+I  +  P  D   I+ D+VGP+CETGD
Sbjct: 301 HVHERIDSGQKFLVLDAAMNDLIRPALYDAYHDIRPVAAPTNDDSDIY-DVVGPVCETGD 359

Query: 350 FIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
               NR++   R G+L+     GAYGAV    YNSR L PE++V    F ++RPR ++ E
Sbjct: 360 TFTRNRELPRLRAGELVAFMSAGAYGAVMGSEYNSRPLAPEVLVRDGGFAVVRPRPSYDE 419

Query: 410 LIELDSIPAWLQ 421
           ++  + +P WL+
Sbjct: 420 MMAREPLPQWLE 431


>gi|325271631|ref|ZP_08138133.1| diaminopimelate decarboxylase [Pseudomonas sp. TJI-51]
 gi|324103235|gb|EGC00580.1| diaminopimelate decarboxylase [Pseudomonas sp. TJI-51]
          Length = 415

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/416 (45%), Positives = 266/416 (63%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+AF Y +G L AE V+L  +A    TP Y YS   IE  Y ++++A  G + +VC+A+K
Sbjct: 1   MNAFNYRDGELFAEGVALSAIAERHGTPTYVYSRAHIEAQYRSYTDALQGAEHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   A+R+VFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSGGELERVLAAGGRADRVVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L   A  +GK AP++ RVNPD++A TH  ISTG KE+KFGI I    +
Sbjct: 121 CFNVESTDELERLQVVAAEMGKVAPVSLRVNPDVDAGTHPYISTGLKENKFGIAIADAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LP +++ GVD HIGSQ+  I+ F  A   L  L  +L   G +++H+D+GGG+
Sbjct: 181 IYVRAAQLPNLEVVGVDCHIGSQLTTIDPFLDALDRLLVLVDRLAECGIHLRHLDLGGGV 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D +PP  +DY   I +  G+    ++ EPGR++VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEQPPLVADYIKAIRERVGDRDLALVFEPGRYIVANAGVLLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+  ++  V P G     + D+VGPICETGDF+  +R + L 
Sbjct: 300 FAIIDAAMNDLIRPALYQAWMGVS-AVKPRGGEGRAY-DLVGPICETGDFLGKDRVLDLA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +E  GAYG V S  YN+R    EI+V+G Q   +R R T  EL   +S+
Sbjct: 358 E-GDLLAVESAGAYGFVMSSNYNTRGRCAEILVDGDQAFEVRRRETIAELYAGESL 412


>gi|167854915|ref|ZP_02477691.1| diaminopimelate decarboxylase [Haemophilus parasuis 29755]
 gi|167853982|gb|EDS25220.1| diaminopimelate decarboxylase [Haemophilus parasuis 29755]
          Length = 419

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 193/417 (46%), Positives = 273/417 (65%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L AE+V++  +     TP Y YS   +E+++  F  AF     ++C+A+K
Sbjct: 1   MDYFHYKNQQLFAEDVAITDIIAQHGTPAYIYSRATLERHWHAFDKAFGDHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN A++  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+  EI  AL+ GI 
Sbjct: 61  SNSNLALLNVIARLGSGFDIVSQGELERVLAAGGDASKVVFSGVAKSHREIARALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SELK +N+ A  LGK API+ RVNPD++A TH  ISTG KE+KFG+ + +   
Sbjct: 121 CFNVESVSELKRINEVAGQLGKIAPISLRVNPDVDAKTHPYISTGLKENKFGVSVKEARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y +A+TLP VKI+G+D HIGSQ+ +++ F  A   +  L +QL+ +G  + H+D+GGGL
Sbjct: 181 VYRFATTLPHVKITGMDCHIGSQLTELQPFLDATDRVIVLMEQLKQDGIELHHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDY-ASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP   +Y A+L+H+       +IILEPGR + A+ GILVTKV  IK++ D+
Sbjct: 241 GVTY-TDETPPHPMEYAAALLHKLRTYPNLEIILEPGRAITANAGILVTKVEYIKQNEDR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY+AY +I   VN +  R     D+VGPICET DF+   R++ +
Sbjct: 300 RFAIVDTGMNDMIRPALYEAYMQI-IEVNQSLVREKAIYDVVGPICETSDFLGKQRELTI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GDL+ +   GAYGA  S TYNSR    E+MV+G + H+I+ R +F++L  L++I
Sbjct: 359 TE-GDLIAMRSAGAYGATMSSTYNSRPQAIEVMVDGDKAHLIKARASFEDLWRLENI 414


>gi|262273212|ref|ZP_06051028.1| diaminopimelate decarboxylase [Grimontia hollisae CIP 101886]
 gi|262222790|gb|EEY74099.1| diaminopimelate decarboxylase [Grimontia hollisae CIP 101886]
          Length = 417

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 191/418 (45%), Positives = 266/418 (63%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE++ L +LA    TP Y YS   +E+++  F  A      ++CYA+
Sbjct: 1   MDYFNYQDDGQLWAEDLPLAQLAGQYGTPLYVYSRATLERHWHAFDKAVGDHPHLICYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+  LA LGSG DIVS+GEL R +AA    +++VFSGVGKT  E+  AL+ GI
Sbjct: 61  KANSNLGVLNVLARLGSGFDIVSQGELERVVAAGGDPKKVVFSGVGKTAPEMARALELGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE+EL  LNQ A  LGKKAP++ R+NPD++A TH  ISTG KE+KFGI   +  
Sbjct: 121 KCFNVESEAELDRLNQIAGELGKKAPVSLRINPDVDAKTHPYISTGLKENKFGIAFDRAR 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y YA++LP + + G+D HIGSQ+  +  F ++   L  L   LR +G +I H+DVGGG
Sbjct: 181 EVYHYANSLPHLDVHGIDCHIGSQLTDLAPFIESTDRLLGLIDDLRQDGIHITHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y +D +PP  SDYA  + +   N Q  +++ EPGR + A+ G+L+TKV  +K + +
Sbjct: 241 LGVTY-NDEKPPEPSDYAKALLERLANHQEIELVFEPGRAIAANAGVLLTKVEFLKHNEE 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND +RP LY A+ EI   V P       + D+VGP+CETGD++  +R + 
Sbjct: 300 KNFAIIDAAMNDLLRPALYQAWQEI-VPVKPRQGEAKTY-DLVGPVCETGDYLGKDRSLV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L   GDLL +  +GAYG V S  YN+R    E+MV+G+Q H++R R     L  L+ +
Sbjct: 358 L-EAGDLLAVRSSGAYGFVMSSNYNTRCRAAEVMVDGNQSHLVRQREPLASLWALEQV 414


>gi|260583176|ref|ZP_05850956.1| diaminopimelate decarboxylase [Haemophilus influenzae NT127]
 gi|260093794|gb|EEW77702.1| diaminopimelate decarboxylase [Haemophilus influenzae NT127]
          Length = 415

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/416 (45%), Positives = 271/416 (65%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L+AE++ +++LA    TP Y YS   +E+++  F +AF     ++C+A+K
Sbjct: 1   MNFFQYKNNKLYAEDIPVQQLAEQFDTPLYVYSRATLERHWHAFDSAFGKRPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN  V+  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+ +EI  AL+ GI 
Sbjct: 61  SCSNIGVLNIMAKLGSGFDIVSQGELERVLAAGGDASKVVFSGVAKSREEIMRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SELK +NQ A  +GK API+ RVNPD++A+TH  ISTG KE+KFG+ +++   
Sbjct: 121 CFNVESVSELKHINQIAGEMGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVNEARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  ASTLP +KI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYKLASTLPNIKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGITLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  SDYA+ + +   N  + +IILEPGR + A+ GILV KV  +K +  +
Sbjct: 241 GVTY-TDETPPHPSDYANALLEKLKNYPELEIILEPGRAISANAGILVAKVQYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I D  MND +RP LY+AY  I  I         I+ D+VGP+CET DF+   R++++
Sbjct: 300 NFAITDTGMNDMIRPALYEAYMNIIEIDRTLAREKAIY-DVVGPVCETSDFLGKQRELSI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
              GD +     GAYGA  S  YNSR    E++V+G Q ++IR R T QEL  L+S
Sbjct: 359 AE-GDYIAQCSAGAYGASMSSNYNSRARTAEVLVDGDQSYLIRRRETLQELWALES 413


>gi|170724853|ref|YP_001758879.1| diaminopimelate decarboxylase [Shewanella woodyi ATCC 51908]
 gi|169810200|gb|ACA84784.1| diaminopimelate decarboxylase [Shewanella woodyi ATCC 51908]
          Length = 414

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/412 (45%), Positives = 264/412 (64%), Gaps = 4/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G L AE+  + +LA    TP Y YS   +E+++  F +A      ++CYA+K
Sbjct: 1   MDHFLYKNGELLAEDCQVAELARTYGTPLYIYSRATLERHWHAFDSAVANHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R + A    +++VFSGVGKT++E+++AL  GI+
Sbjct: 61  ANSNIAVLNVLARLGSGFDIVSGGELSRVIEAGGDPKKVVFSGVGKTVEEMEMALNLGIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN  A+ LGK AP++ RVNPD++A TH  ISTG KE+KFGI +    +
Sbjct: 121 CFNVESAAELEQLNLVALKLGKIAPVSLRVNPDVDAGTHPYISTGLKENKFGIAMDDAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++A A  LPG+++ GVD HIGSQ+ +I+ F  A   +  L  +L      I+H DVGGGL
Sbjct: 181 IFARAHALPGLQVKGVDCHIGSQLTEIKPFLDAMDRILALIDRLAEQDIIIEHFDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP    YAS + +  G+ + K+I EPGR + A+ GI VT+V+ +K ++DK 
Sbjct: 241 GVTY-DDETPPQPDVYASALVERLGDRKLKLIFEPGRAIAANAGIFVTQVLYLKGNSDKH 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F ++D AMND +RP+LY A+ +I  +V   G+  +   DIVGP+CETGDF+   R++ L 
Sbjct: 300 FALVDGAMNDLIRPSLYSAWQKIIPVVPREGESRNY--DIVGPVCETGDFLGKERELCL- 356

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
            P D L +  +GAYG   S  YNSR    E+MV+G Q H+IR R    +L +
Sbjct: 357 EPQDYLAVRSSGAYGFTMSSNYNSRPRAAEVMVDGEQAHLIRQREKLSQLWQ 408


>gi|329890871|ref|ZP_08269214.1| diaminopimelate decarboxylase [Brevundimonas diminuta ATCC 11568]
 gi|328846172|gb|EGF95736.1| diaminopimelate decarboxylase [Brevundimonas diminuta ATCC 11568]
          Length = 424

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/426 (43%), Positives = 263/426 (61%), Gaps = 8/426 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGM-----DTMV 55
           M  F   +G LHAE VSLE LA  V TP Y YS+  + ++Y     A D       + ++
Sbjct: 1   MHHFDLKDGVLHAEGVSLEALAETVGTPTYVYSSATLRRHYGLLREACDAHKDALGEALI 60

Query: 56  CYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLAL 115
            +A+KANSN +V+ TLA LG G D VSEGE+RRALAA VP ERI+FSGVGKT  E+  A+
Sbjct: 61  AFAVKANSNLSVLATLAKLGCGADTVSEGEIRRALAAGVPGERIIFSGVGKTDAELAFAI 120

Query: 116 QSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPI 175
             G+   NVES +EL  L   A + G     A RVNP I A  H KI+TG   DKFG+P+
Sbjct: 121 DVGVRQINVESSAELDRLIAVAAAKGAAPATAIRVNPKIGAGGHAKITTGGAGDKFGVPV 180

Query: 176 HQIHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHID 235
            +  +LYA AS  P V   G+  HIGSQI  +     AF++LR +T+ LR+ GH+I  +D
Sbjct: 181 EEAMALYARASASPHVTPVGLACHIGSQITDLAPLEAAFRVLRQMTEDLRAQGHSITRLD 240

Query: 236 VGGGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKK 295
           +GGGLG+ Y+ +   PS +DY ++  +    L  +   EPGR + A+ G+L+++VI + +
Sbjct: 241 LGGGLGVPYYGETATPSPADYVAMAARVLDGLNVEAAFEPGRLMAANAGVLLSRVIQVNE 300

Query: 296 SAD-KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALN 354
             D + F++LD AMND MRP LYDA+H++  +    G  L    D+VGP+CETGD  A +
Sbjct: 301 RTDGRRFLVLDAAMNDLMRPALYDAFHDLKPVRPVEGAALPY--DVVGPVCETGDTFARD 358

Query: 355 RKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELD 414
           R +   + GDL+     GAYGAV SG YN+R L  E++V+G ++ +IRPR T++++   +
Sbjct: 359 RDLPPLKAGDLVVFMSAGAYGAVMSGEYNTRPLAAEVLVDGERYAVIRPRPTYEQMFARE 418

Query: 415 SIPAWL 420
            +  WL
Sbjct: 419 PMADWL 424


>gi|114330425|ref|YP_746647.1| diaminopimelate decarboxylase [Nitrosomonas eutropha C91]
 gi|114307439|gb|ABI58682.1| diaminopimelate decarboxylase [Nitrosomonas eutropha C91]
          Length = 417

 Score =  368 bits (944), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 192/416 (46%), Positives = 266/416 (63%), Gaps = 4/416 (0%)

Query: 2   SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKA 61
           S+F Y    L AE + L  +A    TP Y YS+ AI   Y +F  AF   + ++CYA+KA
Sbjct: 5   SSFNYRNHQLFAEEIPLTAIAAEFGTPCYVYSSAAIRTAYQSFDRAFGQRNHLICYAVKA 64

Query: 62  NSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYC 121
           NSN AV+  LA LGSG DIVS GEL+R L A    ++ VFSGVGKT +EI +AL + I+C
Sbjct: 65  NSNLAVLNLLARLGSGFDIVSGGELQRVLKAGGDLQKTVFSGVGKTFEEIRIALAANIFC 124

Query: 122 FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSL 181
           FNVESE EL  LN+ A  +GK AP++ RVNPD++ANTH  ISTG KE+KFGIP  +   +
Sbjct: 125 FNVESEMELIALNEIAGQMGKIAPVSLRVNPDVDANTHPYISTGMKENKFGIPAAEAERI 184

Query: 182 YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG 241
           YA A  LP +++SG+D HIGSQ+ +I  F +A   + DL  +L++ G +I+H+D+GGGLG
Sbjct: 185 YAIAQQLPYIRVSGLDCHIGSQLTEIAPFIEAAHKMLDLLARLQATGISIEHLDLGGGLG 244

Query: 242 IAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTF 301
           + Y  +  PP+  +Y   +     N   ++++EPGR +V + G+L+T+V  +K +  + F
Sbjct: 245 VRYDLE-IPPTIEEYVKALCAATENYPQQLLIEPGRSMVGNAGLLLTRVHYLKHAPHRNF 303

Query: 302 VILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPR 361
            I+D AMND +RP LY AYH I  I    G+   I+  IVGP+CETGDF+  +R + L  
Sbjct: 304 AIVDAAMNDMLRPALYQAYHSILPIAKRTGET-KIY-QIVGPVCETGDFLGHDRNLTL-E 360

Query: 362 PGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIP 417
             DLL +   GAYG   S  YN+R    E+MV+GS  H+IR R T ++L  L+ IP
Sbjct: 361 SNDLLAVMSAGAYGMSMSSNYNTRPRAVEVMVDGSSVHLIRARETIEDLYALEKIP 416


>gi|56552664|ref|YP_163503.1| diaminopimelate decarboxylase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|13124113|sp|Q9Z661|DCDA_ZYMMO RecName: Full=Diaminopimelate decarboxylase; Short=DAP
           decarboxylase
 gi|4378171|gb|AAD19416.1| diaminopimelate decarboxylase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|56544238|gb|AAV90392.1| diaminopimelate decarboxylase [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 421

 Score =  368 bits (944), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 189/424 (44%), Positives = 264/424 (62%), Gaps = 7/424 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGM---DTMVCY 57
           M  F    G+L  E++ L ++A    TP Y YS + + +    F+ A DG     ++V +
Sbjct: 1   MIPFSLKNGTLCVEDIPLPEIAAQYGTPCYVYSHSYLTERARRFTKALDGAGKGKSLVAF 60

Query: 58  ALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQS 117
           A+KAN +QA++ + A  G G D+VS GE+RRA+ A +P ERIVFSGVGKT +E+  AL+ 
Sbjct: 61  AVKANPSQAILASFAKEGLGADVVSAGEIRRAVHAGIPPERIVFSGVGKTAEEMRYALEI 120

Query: 118 GIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQ 177
           GI  FN+ES SE++ L + A SLGKKA +A R+NPD++ +TH KI+TGK + KFGI    
Sbjct: 121 GIGQFNIESVSEIEMLAEVATSLGKKAAVALRINPDVDPHTHAKIATGKADTKFGIAAED 180

Query: 178 IHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVG 237
             S Y   ++ P +KI G+  HIGSQI  +  F  A + + ++   L   GH I+  D+G
Sbjct: 181 ALSAYEKLASYPSLKIQGIASHIGSQITDLAPFEAAAERIYEIITALEKAGHAIETADLG 240

Query: 238 GGLGIAYHSDH-RPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKS 296
           GGLG+ Y  D   PPS   Y  +I +      C++I EPGR L+A+ G+L++KVI IK+S
Sbjct: 241 GGLGVRYKDDQPEPPSVEAYGEMIKRVTKGWNCRLIFEPGRSLIANAGVLLSKVIRIKES 300

Query: 297 ADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRK 356
               FVILD AMND +RPTLYDAYHEI   V P+       ADIVGP+CETGD  A NR 
Sbjct: 301 KTARFVILDAAMNDLVRPTLYDAYHEIK-AVTPSAQTY--QADIVGPVCETGDIFARNRS 357

Query: 357 IALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           I+  +  DL+ I   GAYGA  +  YNSR L+ E+MV+G++  +IR R + ++L+  +  
Sbjct: 358 ISAVKADDLMAIMSAGAYGATMASAYNSRPLVAEVMVSGNKSALIRKRQSVEDLMRDEQK 417

Query: 417 PAWL 420
             WL
Sbjct: 418 VEWL 421


>gi|30249905|ref|NP_841975.1| Orn/DAP/Arg decarboxylase family protein [Nitrosomonas europaea
           ATCC 19718]
 gi|30180942|emb|CAD85868.1| Orn/DAP/Arg decarboxylases family 2 [Nitrosomonas europaea ATCC
           19718]
          Length = 417

 Score =  368 bits (944), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 191/416 (45%), Positives = 266/416 (63%), Gaps = 4/416 (0%)

Query: 2   SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKA 61
           S+F+Y +  L  E+V L ++A    TP Y YS+ AI   Y  F +AF   D ++CYA+KA
Sbjct: 5   SSFEYRDSQLFVESVPLAEIAAKFGTPCYVYSSAAIRTTYQIFDHAFGQRDHLICYAVKA 64

Query: 62  NSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYC 121
           NSN A++  LA LGSG DIVS GEL+R L A    ++ VFSGVGKT +EI  AL + I C
Sbjct: 65  NSNLAILNLLARLGSGFDIVSGGELQRVLKAGGDPQKTVFSGVGKTPEEIRAALAANILC 124

Query: 122 FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSL 181
           FNVESE EL  LN+ A  +GK AP++ RVNPD++ANTH  ISTG KE+KFGIP  +   +
Sbjct: 125 FNVESEMELMVLNEIAGQMGKIAPVSLRVNPDVDANTHPYISTGMKENKFGIPAAEAGRI 184

Query: 182 YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG 241
           Y+ A  LP +++SG+D HIGSQ+ +I  F +A   + DL  +L++ G  I+H+D+GGGLG
Sbjct: 185 YSLAHQLPHIQVSGLDCHIGSQLTEIAPFIEAADKMLDLLARLQTMGVTIKHLDLGGGLG 244

Query: 242 IAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTF 301
           I Y  +  PPS   Y   +     N   ++++EPGR +V + G+L+T+V  +K ++ + F
Sbjct: 245 IRYDRE-SPPSIEAYIKALCTIAENHPQQLLIEPGRSMVGNAGLLLTRVHYLKHTSHRNF 303

Query: 302 VILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPR 361
            I+D AMND +RP LY AYH I  +    G+       IVGP+CETGDF+  +R +AL +
Sbjct: 304 AIVDAAMNDMLRPALYQAYHSILPVTKRTGETKTYQ--IVGPVCETGDFLGHDRNLALTK 361

Query: 362 PGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIP 417
             DLL +   GAYG   S  YN+R    E+MV+GS  H+IR R T ++L  L+ +P
Sbjct: 362 -NDLLAVMSAGAYGMSMSSNYNTRPRAAEVMVDGSTVHLIRARETVEDLYALEKLP 416


>gi|104784267|ref|YP_610765.1| diaminopimelate decarboxylase [Pseudomonas entomophila L48]
 gi|95113254|emb|CAK17982.1| diaminopimelate decarboxylase [Pseudomonas entomophila L48]
          Length = 415

 Score =  368 bits (944), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 187/417 (44%), Positives = 267/417 (64%), Gaps = 6/417 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  +A    TP Y YS   IE  Y ++++A  G++ +VC+A+K
Sbjct: 1   MDAFNYRDGELFAEGVALSAVAERFGTPTYVYSRAHIEAQYRSYTDALQGVEHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   A+R+VFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNLLARLGAGFDIVSGGELERVLAAGGRADRVVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L   A  +GK AP++ RVNPD++A TH  ISTG KE+KFGI I    +
Sbjct: 121 CFNVESSDELERLQVVAAEMGKTAPVSLRVNPDVDAGTHPYISTGLKENKFGIAIADAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LP + + GVD HIGSQ+  +E F  A   L  L  +L   G +++H+D+GGG+
Sbjct: 181 IYVRAAQLPNLDVVGVDCHIGSQLTTVEPFLDALDRLLVLVDRLAECGIHLRHLDLGGGV 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D +PP  +DY   I +  G+ +  ++ EPGR++VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEQPPVLADYIQAIRERVGDRELALVFEPGRYIVANGGVLLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGD-RLHIHADIVGPICETGDFIALNRKIAL 359
           F I+D AMND +RP LY A+ +++ +    G+ R +   D+VGPICETGDF+  +R + L
Sbjct: 300 FAIIDAAMNDLIRPALYQAWMDVSAVKPREGEGRAY---DLVGPICETGDFLGKDRVLDL 356

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GDLL +   GAYG V S  YN+R    E++V+G Q   +R R T  EL   +S+
Sbjct: 357 AE-GDLLAVRSAGAYGFVMSSNYNTRGRCAEVLVDGDQAFEVRRRETVAELFAGESL 412


>gi|37196770|dbj|BAC92756.1| diaminopimelate decarboxylase [Methylophilus methylotrophus]
          Length = 414

 Score =  367 bits (943), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 190/414 (45%), Positives = 257/414 (62%), Gaps = 4/414 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+AF   +G LHAENV+L  +A   QTP Y YS  A+   +  F     G D ++C+A+K
Sbjct: 1   MTAFSIQQGLLHAENVALRDIAQTHQTPTYVYSRAALTTAFERFQAGLTGHDHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           AN + A++   A +G+G DIVS GEL R LAA    +++VFSGVGK+  EI  AL++GI 
Sbjct: 61  ANPSLAILNLFARMGAGFDIVSGGELARVLAAGGDPKKVVFSGVGKSHAEIKAALEAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL  + Q A SLGKKAPI+ RVNP+++A TH  ISTG K +KFG+       
Sbjct: 121 CFNVESVNELDRIQQVAASLGKKAPISLRVNPNVDAKTHPYISTGLKNNKFGVAFEDALG 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LY  A+ LP +++ GVD HIGSQI ++  F  A   +  L   L + G +IQHIDVGGG+
Sbjct: 181 LYEKAAQLPNIEVHGVDCHIGSQITELSPFLDALDKVLGLVDALAAKGIHIQHIDVGGGV 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y SD  PP  + Y + I +       K++ EPGR LV + G+L+TKV  +K    K 
Sbjct: 241 GITY-SDETPPDFAAYTAAILKKLAGRNVKVLFEPGRALVGNAGVLLTKVEYLKPGETKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND MRP LYDA+H I  I   A     I+ +IVGP+CE+GDF+  +R +A+ 
Sbjct: 300 FAIVDAAMNDLMRPALYDAFHNITTIATSAAPA-QIY-EIVGPVCESGDFLGHDRTLAI- 356

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELD 414
             GD L I   GAYG   +  YN+R    E++V+G Q H+IR R    +L +L+
Sbjct: 357 EEGDYLAIHSAGAYGMSMASNYNTRARAAEVLVDGDQVHVIREREQIADLFKLE 410


>gi|89074449|ref|ZP_01160926.1| putative diaminopimelate decarboxylase [Photobacterium sp. SKA34]
 gi|89049737|gb|EAR55287.1| putative diaminopimelate decarboxylase [Photobacterium sp. SKA34]
          Length = 416

 Score =  367 bits (943), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 195/418 (46%), Positives = 266/418 (63%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFEGS-LHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + + L AENV L +LA    TP Y YS   +E+++  F  A      ++CYA+
Sbjct: 1   MDYFNYQQNNQLWAENVPLAQLAEQYGTPLYVYSRATLERHWKAFDEAVATHPHLICYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+  LA LGSG DIVS+GEL R +AA     ++VFSGVGKT  E+  AL+ GI
Sbjct: 61  KANSNLGVLNVLARLGSGFDIVSQGELERVIAAGGDPAKVVFSGVGKTAAEMKRALELGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN  A  LG  API+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNAVAEELGVTAPISLRINPDVDAKTHPYISTGLRDNKFGIVFDRAV 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y  A +LP +++ G+D HIGSQ+  I  F  A   L  L  +L++ G +IQH+D+GGG
Sbjct: 181 EVYRLAHSLPHLQVVGMDCHIGSQLTDITPFIDATDRLLALVDELKAEGIHIQHLDLGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y +D +PP  SDYAS +     N    ++I EPGR + A+ G+L+TKV  +K +  
Sbjct: 241 LGVTY-NDEQPPQPSDYASALLARLENYPDLELIFEPGRAIAANAGVLLTKVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND +RPTLY A+ +I   V+P     H++ D+VGPICETGDFI  +R + 
Sbjct: 300 KNFAIVDAAMNDLIRPTLYSAWQDI-VPVSPRQGEAHVY-DLVGPICETGDFIGKDRSLC 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L + GDLL +   GAYG V +  YN+R    EIMV+G Q H++R R T  +L +L+ I
Sbjct: 358 LAQ-GDLLAVRSAGAYGFVMASNYNTRARAAEIMVDGEQAHVVRERETLTQLWQLEQI 414


>gi|254508819|ref|ZP_05120930.1| diaminopimelate decarboxylase [Vibrio parahaemolyticus 16]
 gi|219548276|gb|EED25290.1| diaminopimelate decarboxylase [Vibrio parahaemolyticus 16]
          Length = 417

 Score =  367 bits (943), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 193/418 (46%), Positives = 263/418 (62%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AENV+L  LA    TP Y YS   +E+++  F  +      +VCYA+
Sbjct: 1   MDYFNYQDDGQLWAENVALSDLAQQYGTPLYVYSRATLERHWNAFDKSVGDHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+  LA +GSG DIVS GEL R +AA   A ++VFSGVGKT  E+  AL+ GI
Sbjct: 61  KANSNLGVLNALARIGSGFDIVSGGELERVIAAGGDASKVVFSGVGKTEQEMQRALELGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG KAPI+ R+NPD++ANTH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNKVAGQLGVKAPISLRINPDVDANTHPYISTGLRDNKFGIAFDRAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           ++Y +A++L  + + G+D HIGSQ+  IE F  A   L  L   L+  G +I+H+DVGGG
Sbjct: 181 AVYQFAASLENLDVKGIDCHIGSQLTDIEPFIDATDRLLALIDDLKEQGIDIKHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  SDYA +L+ +   +   ++I EPGR + A+ GIL+TKV  +K +  
Sbjct: 241 LGVVYR-DEMPPEPSDYAKALLSRLDNHKHLELIFEPGRAIAANAGILLTKVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I  +    G+      D+VGPICETGDF+  +R++ 
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDIVPVAPREGEATEY--DLVGPICETGDFLGKDRRLV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L    DLL +   GAYG V S  YN+R+   E+MV+G Q H++R R     L  L++I
Sbjct: 358 L-EENDLLAVRSAGAYGFVMSSNYNTRVRAAEVMVDGDQSHLVRQREELSSLWALENI 414


>gi|167036274|ref|YP_001671505.1| diaminopimelate decarboxylase [Pseudomonas putida GB-1]
 gi|166862762|gb|ABZ01170.1| diaminopimelate decarboxylase [Pseudomonas putida GB-1]
          Length = 415

 Score =  367 bits (943), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 189/417 (45%), Positives = 266/417 (63%), Gaps = 6/417 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+AF Y +G L AE V+L  +A    TP Y YS   IE  Y ++++A  G + +VC+A+K
Sbjct: 1   MNAFNYRDGELFAEGVALSAIAERYGTPTYVYSRAHIEAQYRSYADALQGTEHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   A+R+VFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSGGELERVLAAGGRADRVVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L   A  +GK AP++ RVNPD++A TH  ISTG KE+KFGI I    +
Sbjct: 121 CFNVESTDELERLQVVAAEMGKVAPVSLRVNPDVDAGTHPYISTGLKENKFGIAIADAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LP +++ GVD HIGSQ+  +E F  A   L  L  +L   G +++H+D+GGG+
Sbjct: 181 IYVRAAQLPNLEVVGVDCHIGSQLTTVEPFLDALDRLLVLVDRLAECGIHLRHLDLGGGV 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D +PP  +DY   I +  G     ++ EPGR++VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEQPPLVADYIKAIRERVGERDLALVFEPGRYIVANAGVLLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGD-RLHIHADIVGPICETGDFIALNRKIAL 359
           F I+D AMND +RP LY A+  ++ +   AG+ R +   D+VGPICETGDF+  +R + L
Sbjct: 300 FAIIDAAMNDLIRPALYQAWMGVSAVKPRAGEGRAY---DLVGPICETGDFLGKDRVLNL 356

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GDLL +   GAYG V S  YN+R    EI+V+G Q   +R R T  EL   +S+
Sbjct: 357 AE-GDLLAVASAGAYGFVMSSNYNTRGRCAEILVDGDQAFEVRRRETIAELYAGESL 412


>gi|319775330|ref|YP_004137818.1| diaminopimelate decarboxylase, PLP-binding [Haemophilus influenzae
           F3047]
 gi|329122674|ref|ZP_08251252.1| diaminopimelate decarboxylase [Haemophilus aegyptius ATCC 11116]
 gi|317449921|emb|CBY86133.1| diaminopimelate decarboxylase, PLP-binding [Haemophilus influenzae
           F3047]
 gi|327472548|gb|EGF17978.1| diaminopimelate decarboxylase [Haemophilus aegyptius ATCC 11116]
          Length = 415

 Score =  367 bits (943), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 190/416 (45%), Positives = 272/416 (65%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L+AE++ +++LA    TP Y YS   +E+++  F +AF     ++C+A+K
Sbjct: 1   MNFFQYKHNKLYAEDIPIQQLAEQFGTPLYVYSRATLERHWHAFDSAFGKRPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN  V+  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+ +EI  AL+ GI 
Sbjct: 61  SCSNIGVLNIMAKLGSGFDIVSQGELERVLAAGGDASKVVFSGVAKSREEIMRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SELK +NQ A  +GK API+ RVNPD++A+TH  ISTG KE+KFG+ +++   
Sbjct: 121 CFNVESVSELKHINQIAGEMGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVNEARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  ASTLP +KI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYKLASTLPNIKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGITLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  SDYA+ + +   N  + +IILEPGR + A+ GILV KV  +K +  +
Sbjct: 241 GVTY-TDETPPHPSDYANALLEKLKNYPELEIILEPGRAISANAGILVAKVQYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I D  MND +RP LY+AY  I  I +   +R     D+VGP+CET DF+   R++++
Sbjct: 300 NFAITDTGMNDMIRPALYEAYMNIVEI-DRTLEREKAIYDVVGPVCETSDFLGKQRELSI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
              GD +     GAYGA  S  YNSR    E++V+G Q ++IR R T QEL  L+S
Sbjct: 359 AE-GDYIAQCSAGAYGASMSSNYNSRARTAEVLVDGDQSYLIRRRETLQELWALES 413


>gi|323500161|ref|ZP_08105106.1| diaminopimelate decarboxylase [Vibrio sinaloensis DSM 21326]
 gi|323314790|gb|EGA67856.1| diaminopimelate decarboxylase [Vibrio sinaloensis DSM 21326]
          Length = 417

 Score =  367 bits (943), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 195/419 (46%), Positives = 265/419 (63%), Gaps = 8/419 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AENV+L  LA    TP Y YS   +E+++  F  +      +VCYA+
Sbjct: 1   MDYFNYQDDGQLWAENVALSDLAQQYGTPLYVYSRATLERHWNAFDKSVGEHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+  LA LGSG DIVS GEL R +AA   A+++VFSGVGKT  E+  AL+ GI
Sbjct: 61  KANSNLGVLNALARLGSGFDIVSGGELERVIAAGGDAKKVVFSGVGKTEQEMQRALELGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG KAPI+ R+NPD++ANTH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNKVAGQLGVKAPISLRINPDVDANTHPYISTGLRDNKFGIAFDRAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           ++Y +AS+L  + I G+D HIGSQ+  IE F  A   L  L   L++ G  I+H+DVGGG
Sbjct: 181 AVYQFASSLENLDIKGIDCHIGSQLTDIEPFIDATDRLLALIDDLKAQGIQIEHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  SDYA  +     N Q  ++I EPGR + A+ G+L+TKV  +K +  
Sbjct: 241 LGVVYR-DELPPQPSDYAKALLGRLANHQDLELIFEPGRAIAANAGVLLTKVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGD-RLHIHADIVGPICETGDFIALNRKI 357
           K F I+D AMND MRP LY A+ +I  +    GD +++   D+VGPICETGDF+  +R++
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDIVPVSPRQGDAKVY---DLVGPICETGDFLGKDREL 356

Query: 358 ALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            +    DLL +   GAYG V S  YN+R  + E+MV+G + H++R R     L  L++I
Sbjct: 357 VI-EENDLLAVRSAGAYGFVMSSNYNTRTRVAEVMVDGEKAHLVRQREELSSLWALENI 414


>gi|114561631|ref|YP_749144.1| diaminopimelate decarboxylase [Shewanella frigidimarina NCIMB 400]
 gi|114332924|gb|ABI70306.1| diaminopimelate decarboxylase [Shewanella frigidimarina NCIMB 400]
          Length = 414

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 189/412 (45%), Positives = 264/412 (64%), Gaps = 4/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y   SL AE+  + KLA    TP Y YS   +E+++  F+NA      ++CYA+K
Sbjct: 1   MDYFSYQNNSLFAEDCDVAKLAKTHGTPLYIYSRATLERHWHAFNNAVADHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R L A    +++VFSGVGKT+ E++ AL  GIY
Sbjct: 61  ANSNLAVLNVLARLGSGFDIVSGGELSRVLQAGGDPKKVVFSGVGKTVAEMEQALNIGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN+ A  LGK AP++ R+NPD++A TH  ISTG KE+KFGI + +   
Sbjct: 121 CFNVESSAELEQLNEVASRLGKVAPVSLRINPDVDAGTHPYISTGLKENKFGIAMEEAEV 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++A A+ L  + + GVD HIGSQ+ +I+ F  A   +  L  +L   G  I+H DVGGGL
Sbjct: 181 VFARAAELAHLHVKGVDCHIGSQLTEIKPFLDAMDRMLALIDRLGEQGIQIEHFDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y+S+  PP    YA+ + +     + K+I EPGR + A+ GI VT+V+ +K+++DK 
Sbjct: 241 GVTYNSE-TPPHPDAYAAALLERLNGRKLKLIFEPGRAIAANAGIFVTQVLYLKENSDKR 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP+LY A+   N I     D      DIVGP+CETGDF+  +R++A+ 
Sbjct: 300 FAIVDGAMNDLIRPSLYSAWQ--NIIPVQQNDAPTFAYDIVGPVCETGDFLGKDRQLAV- 356

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
           + GDLL I  +GAYG   +  YNSR  + EIMV+G    ++R R T ++L +
Sbjct: 357 KSGDLLAIRSSGAYGFAMASNYNSRPRVAEIMVDGGNDFVVRQRETLEQLWQ 408


>gi|119469651|ref|ZP_01612520.1| putative diaminopimelate decarboxylase [Alteromonadales bacterium
           TW-7]
 gi|119446898|gb|EAW28169.1| putative diaminopimelate decarboxylase [Alteromonadales bacterium
           TW-7]
          Length = 417

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 195/417 (46%), Positives = 266/417 (63%), Gaps = 3/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L AE+V +  +A    TP Y YS    E++YL F+NA     ++VCYA+K
Sbjct: 1   MDFFNYKNNQLFAEDVGIAAIAQQYGTPCYVYSRATFERHYLAFANATKNHKSLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS+GEL R + A   A ++VFSGV KT DEI  AL+ GI 
Sbjct: 61  ANSNIAVLNILARLGSGFDIVSKGELARVIKAGGDAGKVVFSGVAKTADEIAYALKLGIK 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SEL+ +++ A  L   API+ RVNPDI+A TH  ISTG KE+KFGI I    S
Sbjct: 121 CFNVESASELERISEVACELNLVAPISIRVNPDIDAKTHPYISTGLKENKFGIDIQTAVS 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LPG+ + GVD HIGSQ+ +++ F +A   L  L  +L+S G  + H+D+GGGL
Sbjct: 181 VYQQAAALPGLNVIGVDCHIGSQLTEVKPFLEALDKLLALIDELKSVGIELSHLDIGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y ++ +PP  S+YA  +     N +  ++I EPGR + A+ G+L+T+V  IK++  K
Sbjct: 241 GVPYDNE-QPPHPSEYAEQVTARLENYRHLELIFEPGRAIAANAGVLITQVEFIKQNQSK 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP+LY A+ +I  +     D    + DIVGP+CETGDF+  +R++AL
Sbjct: 300 FFAIVDAGMNDMLRPSLYQAWQKIIPVSVRDDDTPTHNFDIVGPVCETGDFLGKDRELAL 359

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            + GDLL     GAYG   S  YNSR  + EIMV+G Q H+IR R T + L + + I
Sbjct: 360 -KQGDLLAQRSAGAYGFTMSSNYNSRPRVAEIMVDGEQHHLIRERETIESLYQGEKI 415


>gi|304320595|ref|YP_003854238.1| Orn/DAP/Arg decarboxylase, family 2 [Parvularcula bermudensis
           HTCC2503]
 gi|303299497|gb|ADM09096.1| Orn/DAP/Arg decarboxylase, family 2 [Parvularcula bermudensis
           HTCC2503]
          Length = 419

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 181/418 (43%), Positives = 261/418 (62%), Gaps = 3/418 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F      L+AE+V L ++A  V TP Y YS   + ++Y   ++ F   D ++ +A+K
Sbjct: 1   MDHFSSRHDGLYAEDVPLRRIADAVGTPLYIYSAATLRRHYDILADEFKNRDALIAFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SN AV+  L   G+G DIVS GEL RAL A +PAER+VFSGV K+  E++ AL +GI 
Sbjct: 61  ALSNIAVLALLGRRGAGADIVSGGELYRALKAGIPAERVVFSGVAKSRGEMEAALNAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE+EL  L+  A +LGK AP+A RVNPD++A T  +ISTG+K+DKFG+P      
Sbjct: 121 QFNVESEAELAHLSAVASALGKTAPVALRVNPDVDAGTDTRISTGRKDDKFGVPFADAGR 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LY  A+ LPG++  G+ +HIGSQI  +  F +A   +  L   LR+ GH + H+D+GGGL
Sbjct: 181 LYRLAAALPGLRPQGLTVHIGSQITSVAPFERAAARVGGLVTSLRAEGHEVTHLDLGGGL 240

Query: 241 GIAY-HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           GI Y  +   PP   DYA+ +++   +L  ++ILEPGR +  + G+ VT+++  K     
Sbjct: 241 GIPYERAAAAPPLPVDYAATLNRATADLNVRLILEPGRLIAGNAGLFVTRIVLTKNQEGT 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            + ++D AMND +RP LY A HE+     P G  +H H  I GP+CE+ D  A +  +  
Sbjct: 301 HYALVDGAMNDLIRPALYGARHEVMEDTPPTGVPVHHH--IAGPVCESTDLFAKDVPLHE 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIP 417
              G LL     GAYGAVQ+  YN+R L+PE++V+G +F +IR R T++E++ L+ IP
Sbjct: 359 VSAGALLAFRTAGAYGAVQASQYNTRPLVPEVLVDGDRFTVIRRRPTYEEMLSLEVIP 416


>gi|116747509|ref|YP_844196.1| diaminopimelate decarboxylase [Syntrophobacter fumaroxidans MPOB]
 gi|116696573|gb|ABK15761.1| diaminopimelate decarboxylase [Syntrophobacter fumaroxidans MPOB]
          Length = 434

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 185/420 (44%), Positives = 267/420 (63%), Gaps = 3/420 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L+ E V L +LA  V TP Y YS   +  ++  F +AF+G+  + C+++K
Sbjct: 11  MHHFHYHNDELYCERVPLRELAARVGTPCYVYSHATLLHHFTVFDSAFEGVPHLTCFSVK 70

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV++    LG G+DIVS GEL RA  A +  ++IV+SGVGKT++EID AL+  I 
Sbjct: 71  ANSNLAVLRLFGSLGGGVDIVSGGELYRARQAGIAPDKIVYSGVGKTLEEIDYALRENIL 130

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FN+ES  EL+ +N RA + G +A IA RVNPD++ NTH  ISTG K++KFGI I     
Sbjct: 131 MFNIESTQELEAINARAAAFGCRARIALRVNPDVDPNTHPYISTGMKKNKFGIEIDSAVK 190

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A +L  V++ GVD HIGSQ+ +I  F  A K LR L ++L + G  IQ++D+GGGL
Sbjct: 191 AYERARSLDHVEVVGVDCHIGSQLTEISPFVDALKRLRLLIEKLEAVGITIQYLDLGGGL 250

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  +  PP   +YA  I +    + C +I EPGR +V + G+L+ +V+  K++  K+
Sbjct: 251 GIVYDQEA-PPEPREYARAILRELKGMHCTLIFEPGRVIVGNAGVLLARVLYTKRTQSKS 309

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F+I D AMND +RP+LY +YH++  +   + +  HI  D+VGPICE+GDFIA +R + + 
Sbjct: 310 FIITDTAMNDLIRPSLYGSYHQVQPLRRQSRES-HI-VDVVGPICESGDFIAKDRGLPMV 367

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
             GD L +   GAYG   S  YNSR    E++V   ++ +IR R T+ +LI+ ++IPA+L
Sbjct: 368 ESGDFLAVMSAGAYGFTMSSNYNSRPRAAEVLVKDDRYFVIRRRETWDDLIQCETIPAFL 427


>gi|90581046|ref|ZP_01236846.1| putative diaminopimelate decarboxylase [Vibrio angustum S14]
 gi|90437742|gb|EAS62933.1| putative diaminopimelate decarboxylase [Vibrio angustum S14]
          Length = 416

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 194/418 (46%), Positives = 266/418 (63%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFEGS-LHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + + L AENV L +LA    TP Y YS   +E+++  F  A      ++CYA+
Sbjct: 1   MDYFNYQQNNQLWAENVPLAQLAEQYGTPLYVYSRATLERHWKAFDEAVATHPHLICYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+  LA LGSG DIVS+GEL R +AA     ++VFSGVGKT  E+  AL+ GI
Sbjct: 61  KANSNLGVLNVLARLGSGFDIVSQGELERVIAAGGDPAKVVFSGVGKTATEMKRALELGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN  A  LG  API+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNAVAEELGVTAPISLRINPDVDAKTHPYISTGLRDNKFGIVFDRAV 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y  A +LP +++ G+D HIGSQ+  I  F  A   L  L  +L++ G +IQH+D+GGG
Sbjct: 181 EVYRLAHSLPHLQVVGMDCHIGSQLTDISPFIDATDRLLALVDELKAEGIHIQHLDLGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y +D +PP  +DYAS +     N    ++I EPGR + A+ G+L+TKV  +K +  
Sbjct: 241 LGVTY-NDEQPPQPADYASALLARLENYPDLELIFEPGRAIAANAGVLLTKVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND +RPTLY A+ +I   V+P     H++ D+VGPICETGDFI  +R + 
Sbjct: 300 KNFAIVDAAMNDLIRPTLYSAWQDI-VPVSPRQGEAHVY-DLVGPICETGDFIGKDRSLC 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L + GDLL +   GAYG V +  YN+R    EIMV+G Q H++R R T  +L +L+ I
Sbjct: 358 LAQ-GDLLAVRSAGAYGFVMASNYNTRARAAEIMVDGEQAHVVRERETLTQLWQLEQI 414


>gi|312963815|ref|ZP_07778286.1| Diaminopimelate decarboxylase [Pseudomonas fluorescens WH6]
 gi|311281850|gb|EFQ60460.1| Diaminopimelate decarboxylase [Pseudomonas fluorescens WH6]
          Length = 415

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 192/416 (46%), Positives = 261/416 (62%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  +A    TP Y YS   IE  Y +F++A +G+  +VCYA+K
Sbjct: 1   MDAFNYRDGELFAEGVALSAIAQRFGTPTYVYSRAHIEAQYRSFTDALNGIPHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   A++IVFSGVGKT D++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGQADKIVFSGVGKTRDDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ES  EL+ L   A  +G +API+ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNIESTDELERLQVVAAEMGVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIADAED 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LP +++ GVD HIGSQ+  +  F  A   L  LT +L   G  +QHID+GGG+
Sbjct: 181 VYIRAAQLPNLEVLGVDCHIGSQLTTLPPFIDALDRLLALTDRLGDCGIYLQHIDLGGGV 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP  +DY   + +        ++ EPGR++VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVQYR-DEEPPLIADYIQAVRERIEGRDLTLMFEPGRYIVANAGVLLTQVEYLKHTEYKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+  +   V P       + DIVGPICETGDF+A +R++AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMNVT-AVTPRASVARAY-DIVGPICETGDFLAKDRQLAL- 356

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+G Q   +R R T  EL   +S+
Sbjct: 357 EEGDLLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGDQAFEVRRRETVAELYAGESL 412


>gi|229845773|ref|ZP_04465885.1| diaminopimelate decarboxylase [Haemophilus influenzae 7P49H1]
 gi|229810777|gb|EEP46494.1| diaminopimelate decarboxylase [Haemophilus influenzae 7P49H1]
          Length = 415

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 190/416 (45%), Positives = 272/416 (65%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L+AE++ +++LA    TP Y YS   +E+++  F +AF     ++C+A+K
Sbjct: 1   MNFFQYKNNKLYAEDIPVQQLAEQFGTPLYVYSRATLERHWHAFDSAFGKHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN  V+  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+ +EI  AL+ GI 
Sbjct: 61  SCSNIGVLNIMAKLGSGFDIVSQGELERVLAAGGDASKVVFSGVAKSREEIMRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SELK +NQ A  +GK API+ RVNPD++A+TH  ISTG KE+KFG+ +++   
Sbjct: 121 CFNVESVSELKHINQIAGEMGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVNEARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  ASTLP +KI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYKLASTLPNIKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGITLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  SDYA+ + +   N  + +IILEPGR + A+ GILV KV  +K +  +
Sbjct: 241 GVTY-TDETPPHPSDYANALLEKLKNYPELEIILEPGRAISANAGILVAKVQYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I D  MND +RP LY+AY  I  I +   +R     D+VGP+CET DF+   R++++
Sbjct: 300 NFAITDTGMNDMIRPALYEAYMNIVEI-DRTLEREKAIYDVVGPVCETSDFLGKQRELSI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
              GD +     GAYGA  S  YNSR    E++V+G Q ++IR R T QEL  L+S
Sbjct: 359 AE-GDYIAQCSAGAYGASMSSNYNSRARTAEVLVDGDQSYLIRRRETLQELWALES 413


>gi|119475311|ref|ZP_01615664.1| diaminopimelate decarboxylase [marine gamma proteobacterium
           HTCC2143]
 gi|119451514|gb|EAW32747.1| diaminopimelate decarboxylase [marine gamma proteobacterium
           HTCC2143]
          Length = 415

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 190/416 (45%), Positives = 262/416 (62%), Gaps = 3/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF+Y  G L AEN+ L  +A    TP Y YS   +E+ +L++  A  G   M+CYA+K
Sbjct: 1   MDAFQYHNGQLQAENIPLAVIAERFGTPTYVYSRGYLEQQFLSYQRALAGRQHMICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LG+G DIVS GEL R LAA     ++VFSGV KT  E+  AL++GI+
Sbjct: 61  ANSNIAVLNVLARLGAGFDIVSGGELERVLAAGGDPAKVVFSGVAKTPAEMRQALEAGIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ESESEL  L Q A  LG  A I+ RVNPD++ANTH  ISTG KE+KFGI I +  +
Sbjct: 121 CFNLESESELGVLQQVAADLGVSASISIRVNPDVDANTHPYISTGLKENKFGIDIDRAPA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A  L  + I GVD HIGSQ+     F  A   L  L   L ++G +I H+D+GGGL
Sbjct: 181 VYRRARDLSHINIIGVDCHIGSQLVDTTPFLDALDRLLKLIDTLANDGIHISHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y +D +PPS ++Y   +  + G+    +  EPGR + A+ G+L+TKV  +K + +K 
Sbjct: 241 GVCY-TDEQPPSPAEYIEKVLTHIGDRDITLAFEPGRSICANAGVLLTKVEYLKCNPEKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F ++D AMND +RP LY A+ +I  +  P  +      DIVGP+CETGDF+  +R++ L 
Sbjct: 300 FAVIDAAMNDMIRPALYQAWMDIKAVC-PRKNEPTKTWDIVGPVCETGDFLGKDRQLEL- 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           R GDLL +   GAYG   S  YNSR+   E+MV+G   H+IR R T  +L++ +++
Sbjct: 358 REGDLLSVSSAGAYGFTMSSNYNSRVRAAEVMVDGDDVHLIRARETVADLMQGEAL 413


>gi|46143532|ref|ZP_00204500.1| COG0019: Diaminopimelate decarboxylase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208989|ref|YP_001054214.1| diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae L20]
 gi|126097781|gb|ABN74609.1| diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
          Length = 416

 Score =  367 bits (941), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 190/417 (45%), Positives = 272/417 (65%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y    L AE+VS+  + +   TP Y YS   +E+++  F  AF     ++C+A+K
Sbjct: 1   MNHFNYKNQQLFAEDVSVSDIINQYGTPAYIYSRATLERHWHAFDKAFGAHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN A++  +A LGSG DIVS+GEL R LAA     ++VFSGV K+  EI  AL+ GI 
Sbjct: 61  SNSNIALLNVMARLGSGFDIVSQGELERVLAAGGEPSKVVFSGVAKSHSEIQRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ES +EL  +N+ A  LGK API+ RVNPD++A+TH  ISTG KE+KFG+ + Q   
Sbjct: 121 CFNIESIAELHRINEVAGQLGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVTQARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A TLP VKI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  + H+D+GGGL
Sbjct: 181 VYRLAKTLPNVKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGIELHHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y+ +  PP  ++YA +L+ +  G    +IILEPGR + A+ GILVTKV  +K + D+
Sbjct: 241 GVPYNGE-EPPHPTEYAKALLEKLKGYADLEIILEPGRAITANAGILVTKVEYLKANEDR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY+AY  I   V+ +  R     D+VGPICET DF+  +R++A+
Sbjct: 300 NFAIVDTGMNDMIRPALYEAYMRITE-VDQSLSREKAVYDVVGPICETSDFLGKDRELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            + GDL+ +   GAYGA  S TYNSR    EIMV+G Q ++I+ R +F +L  L+ +
Sbjct: 359 EQ-GDLIAMRSAGAYGAAMSSTYNSRPQAVEIMVDGDQAYLIKARASFADLWRLEKL 414


>gi|68249326|ref|YP_248438.1| diaminopimelate decarboxylase [Haemophilus influenzae 86-028NP]
 gi|68057525|gb|AAX87778.1| diaminopimelate decarboxylase [Haemophilus influenzae 86-028NP]
          Length = 415

 Score =  367 bits (941), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 190/416 (45%), Positives = 272/416 (65%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L+AE++ +++LA    TP Y YS   +E+++  F +AF     ++C+A+K
Sbjct: 1   MNFFQYKHNKLYAEDMPVQQLAEQFGTPLYVYSRATLERHWHAFDSAFGKRPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN  V+  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+ +EI  AL+ GI 
Sbjct: 61  SCSNIGVLNIMAKLGSGFDIVSQGELERVLAAGGDASKVVFSGVAKSREEIMRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SELK +NQ A  +GK API+ RVNPD++A+TH  ISTG KE+KFG+ +++   
Sbjct: 121 CFNVESVSELKHINQIAGEMGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVNEARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  ASTLP +KI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYKLASTLPNIKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGITLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  SDYA+ + +   N  + +IILEPGR + A+ GILV KV  +K +  +
Sbjct: 241 GVTY-TDETPPHPSDYANALLEKLKNYPELEIILEPGRAISANAGILVAKVQYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I D  MND +RP LY+AY  I  I +   +R     D+VGP+CET DF+   R++++
Sbjct: 300 NFAITDTGMNDMIRPALYEAYMNIVEI-DRTLEREKAIYDVVGPVCETSDFLGKQRELSI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
              GD +     GAYGA  S  YNSR    E++V+G Q ++IR R T QEL  L+S
Sbjct: 359 AE-GDYIAQCSAGAYGASMSSNYNSRARTAEVLVDGDQSYLIRRRETLQELWALES 413


>gi|330812549|ref|YP_004357011.1| diaminopimelate decarboxylase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380657|gb|AEA72007.1| diaminopimelate decarboxylase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 415

 Score =  367 bits (941), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 193/416 (46%), Positives = 260/416 (62%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y  G L AE V+L  +A    TP Y YS   IE  Y TF++A +GM  +VC+A+K
Sbjct: 1   MDAFNYRGGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYRTFADALEGMPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   A++IVFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSGGELERVLAAGGSADKIVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ES  EL+ L   A  LG +API+ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNIESTDELERLQIVAAELGVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIADAED 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LP +++ GVD HIGSQ+  +E F  A   L  L  +L   G  ++HID+GGG+
Sbjct: 181 VYVRAAQLPNLEVLGVDCHIGSQLTTLEPFIDALDRLLALVDRLGDCGIYLRHIDLGGGV 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP  +DY   + +        ++ EPGR++VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEEPPLVADYIKAVRERLDGRDLALMFEPGRYIVANAGVLLTQVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ ++   V P  D      DIVGPICETGDF+A  R++AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVT-AVRPR-DTAARSYDIVGPICETGDFLAKGRELAL- 356

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+G Q   +R R T  EL   +S+
Sbjct: 357 EEGDLLAVHSAGAYGFVMSSNYNTRGRCAEVLVDGDQAFEVRRRETVVELFAGESL 412


>gi|165976954|ref|YP_001652547.1| diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|303253397|ref|ZP_07339540.1| diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307246442|ref|ZP_07528515.1| Diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307248567|ref|ZP_07530582.1| Diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307255425|ref|ZP_07537232.1| Diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307259877|ref|ZP_07541591.1| Diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|165877055|gb|ABY70103.1| diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|302647742|gb|EFL77955.1| diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306852646|gb|EFM84878.1| Diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306854917|gb|EFM87105.1| Diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306861609|gb|EFM93596.1| Diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306866047|gb|EFM97921.1| Diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
          Length = 416

 Score =  367 bits (941), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 190/417 (45%), Positives = 273/417 (65%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y    L AE+VS+  + +   TP Y YS   +E+++  F  AF     ++C+A+K
Sbjct: 1   MNHFNYKNQQLFAEDVSVSDIINQHGTPAYIYSRATLERHWHAFDKAFGAHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN A++  +A LGSG DIVS+GEL R LAA     ++VFSGV K+  EI  AL+ GI 
Sbjct: 61  SNSNIALLNVMARLGSGFDIVSQGELERVLAAGGEPSKVVFSGVAKSHSEIQRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ES +EL  +N+ A  LGK API+ RVNPD++A+TH  ISTG KE+KFG+ + Q   
Sbjct: 121 CFNIESIAELHRINEVAGQLGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVTQARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A TLP VKI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  + H+D+GGGL
Sbjct: 181 VYRLAKTLPNVKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGIELHHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y+ +  PP  ++YA +L+ +  G    +IILEPGR + A+ GILVTKV  +K + D+
Sbjct: 241 GVPYNGE-EPPHPTEYAKALLEKLKGYADLEIILEPGRAITANAGILVTKVEYLKANEDR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY+AY +I   V+ +  R     D+VGPICET DF+  +R++A+
Sbjct: 300 NFAIVDTGMNDMIRPALYEAYMQITE-VDQSLSREKAVYDVVGPICETSDFLGKDRELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            + GDL+ +   GAYGA  S TYNSR    EIMV+G Q ++I+ R +F +L  L+ +
Sbjct: 359 EQ-GDLIAMRSAGAYGAAMSSTYNSRPQAVEIMVDGDQAYLIKARASFADLWRLEKL 414


>gi|291278645|ref|YP_003495480.1| diaminopimelate decarboxylase [Deferribacter desulfuricans SSM1]
 gi|290753347|dbj|BAI79724.1| diaminopimelate decarboxylase [Deferribacter desulfuricans SSM1]
          Length = 417

 Score =  366 bits (940), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 187/420 (44%), Positives = 272/420 (64%), Gaps = 3/420 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G +  E V L+K+A  V TPFY YS   +++++  F  +F+ +  ++C+A+K
Sbjct: 1   MHHFHYKDGEMFCEEVPLKKIAAEVGTPFYVYSAATLKRHFEVFDASFEEVPHIICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  L  L  G DIVS GEL RAL A +  ++IV++GVGKT +EI+ AL+S I 
Sbjct: 61  ANSNLAVLNLLGKLSCGADIVSGGELYRALKAGIDPKKIVYAGVGKTEEEIEFALKSDIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FN+ES  EL+ +N+ A  L KKA IA RVNP+++  TH  ISTG K++KFGIPI   + 
Sbjct: 121 MFNIESFQELEKINEVAGRLKKKARIALRVNPNVDPKTHPYISTGLKKNKFGIPIENAYQ 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y YA++L  +++ G   HIGSQ+ +I  F  A K++ D+ + L+S G NI+++D+GGGL
Sbjct: 181 EYEYAASLDNIEVVGAHCHIGSQLTEISPFVDATKIMVDMIKTLKSKGINIKYLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y ++  PPS  +YA  I      L   ++ EPGR +  + G+LVT+V+  K++  K 
Sbjct: 241 GIKY-NEEMPPSPKEYADKIIDVIRGLDVTLVFEPGRVIAGNAGVLVTRVLYTKETELKH 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND MRP LY ++H+I  +    G    ++ DIVGPICETGDF+A +R +   
Sbjct: 300 FKIVDAAMNDLMRPILYGSFHDIKPV--KEGHYKTVYGDIVGPICETGDFLAKDRNLPDF 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
           + GDL+ +   GAYG   S  YNSR  +PEI+VN  +++I+R R T+ +LI  +SIP  L
Sbjct: 358 QQGDLIAVMSAGAYGFTMSSNYNSRPRVPEILVNKDKYYIVRRRETYDDLIGPESIPEDL 417


>gi|110835189|ref|YP_694048.1| diaminopimelate decarboxylase [Alcanivorax borkumensis SK2]
 gi|110648300|emb|CAL17776.1| diaminopimelate decarboxylase [Alcanivorax borkumensis SK2]
          Length = 413

 Score =  366 bits (940), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 195/417 (46%), Positives = 268/417 (64%), Gaps = 7/417 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y +G L AE + +E+LA    TP Y YS  A+E++YL F  AF      VCYA+K
Sbjct: 1   MDHFQYRDGELFAEELPVEQLADRFGTPLYLYSRAALERHYLAFDEAFGDHPHQVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA +G+G DIVS GEL R L A    ++IVFSGVGKT +E+  AL++ I+
Sbjct: 61  ANSNLAVLNVLARVGAGFDIVSGGELERVLRAGGDPDKIVFSGVGKTANEMAAALKANIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN  A  L ++APIA RVNPD++A TH  ISTG K++KFG+ I +  +
Sbjct: 121 CFNVESAAELELLNLVAGELDREAPIAIRVNPDVDAQTHPYISTGLKDNKFGVDITKAPA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LY  A+ LP +KI G+D HIGSQ+ +++ F  A + +  L  QL+ +G  I H+D+GGGL
Sbjct: 181 LYQRAAELPHIKILGIDCHIGSQLTKLDPFEAALERVLKLLAQLQEHGIEIHHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y  D  PP  SDY  +L+    G L   I  EPGR + A+ GI VT+V+ +K +  K
Sbjct: 241 GVTY-DDETPPDRSDYVQALLKHIPGELPVHI--EPGRSIAANAGIFVTQVLFLKPTEHK 297

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D AMND +RP+LY A+  I  +     D  +   DIVGP+CETGDF+  +R +AL
Sbjct: 298 NFAIVDGAMNDLIRPSLYSAWQNIVPVKPHEADCRNW--DIVGPVCETGDFLGKDRALAL 355

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GDLL +   GAYG   +  YNSR    E+MV+G Q  ++R R T+ E ++L+S+
Sbjct: 356 -ETGDLLAVRSAGAYGFAMASNYNSRNRPAEVMVDGDQAFVVRQRETYDEQLKLESL 411


>gi|114049121|ref|YP_739671.1| diaminopimelate decarboxylase [Shewanella sp. MR-7]
 gi|113890563|gb|ABI44614.1| diaminopimelate decarboxylase [Shewanella sp. MR-7]
          Length = 414

 Score =  366 bits (940), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 188/412 (45%), Positives = 263/412 (63%), Gaps = 4/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y + +L+AE   +  LA    TP Y YS   +E+++  F+NA      +VCYA+K
Sbjct: 1   MDHFLYQDNTLYAEGCRVNDLAQQYGTPLYIYSRATLERHWHAFNNAVADHPHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R + A     ++VFSGVGKT+ E++ AL  GIY
Sbjct: 61  ANSNLAVLNVLARLGSGFDIVSGGELARVIEAGGDPAKVVFSGVGKTVAEMEQALNLGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LNQ A  LGK AP++ RVNPD++A TH  ISTG KE+KFGI + +   
Sbjct: 121 CFNVESSAELEQLNQVAGRLGKVAPVSLRVNPDVDAGTHPYISTGLKENKFGIAMDEAEV 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++A A  LP +++ GVD HIGSQ+ +I+ F  A   +  L  +L   G  I+H DVGGGL
Sbjct: 181 VFARAHALPHLQVKGVDCHIGSQLTEIQPFLDAMDRMLALIDRLAEQGIVIEHFDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP    YA+ +    G+ + K+I EPGR + A+ GI VT+V+ +K+++DK 
Sbjct: 241 GVTY-DDETPPHPDVYAAALLARLGDRKLKLIFEPGRAIAANAGIFVTQVLYLKENSDKR 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+  I   VNP  ++  +  DIVGP+CETGDF+  +R +A+ 
Sbjct: 300 FAIVDGAMNDLIRPALYSAWQNI-IPVNPRDEQAQVF-DIVGPVCETGDFLGKDRALAIA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
             GDLL +  +GAYG   +  YN+R    E+MV+G + +++R R    +L +
Sbjct: 358 -AGDLLVVRSSGAYGFAMASNYNTRPRAAEVMVDGDKAYLVREREKLAQLWQ 408


>gi|311693138|gb|ADP96011.1| diaminopimelate decarboxylase [marine bacterium HP15]
          Length = 416

 Score =  366 bits (940), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 188/415 (45%), Positives = 260/415 (62%), Gaps = 3/415 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G L+AE++ +  +A    TP Y YS   +E++Y  + +A      +VCYA+K
Sbjct: 1   MDHFNYRDGELYAEDIPVSAIADRFGTPAYVYSRATLERHYRAYDDALRDHPHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LG+G DIVS GEL R L A     R+VFSGVGK   E+  AL+ G+ 
Sbjct: 61  ANSNLAVLNVLARLGAGFDIVSAGELERVLRAGGDPSRVVFSGVGKQEWEMKRALEVGVR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES++EL  LN  A  LG KAPI+ RVNPD++A TH  ISTG KE+KFGI I +   
Sbjct: 121 CFNVESDTELDRLNAVAGELGVKAPISLRVNPDVDAGTHPYISTGLKENKFGIDIAEASQ 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ +P + + GVD HIGSQ+  +  F  A   +  L   L   G +I H+D+GGGL
Sbjct: 181 VYARAAGMPNLDVKGVDCHIGSQLTSVSPFLDALDRVLALIDSLADQGIHIHHLDMGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y+ + +PP  SDY   + +  G+ + ++ILEPGR + A+ GILVT+V  +K +  + 
Sbjct: 241 GVTYNQE-QPPQPSDYVKALAERLGDRKLELILEPGRSIAANAGILVTRVEFLKCTEHRN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+  I   V P  D      D+VGP+CETGDF+  +R + L 
Sbjct: 300 FAIIDAAMNDLIRPALYSAWQAI-IPVKPHQDGEEKAWDLVGPVCETGDFLGKDRHLRL- 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
           + GDLL +   GAYG V S  YN+R   PE+MV+G Q H++R R T ++ +  +S
Sbjct: 358 QAGDLLAVRSAGAYGFVMSSNYNTRNRPPELMVDGDQVHVVRRRETLEDQLAPES 412


>gi|251772324|gb|EES52892.1| diaminopimelate decarboxylase [Leptospirillum ferrodiazotrophum]
          Length = 413

 Score =  366 bits (940), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 186/416 (44%), Positives = 269/416 (64%), Gaps = 3/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           MS+F+Y  G L  EN+ +E++     +P Y YS  A+ +    +  AF    T+V YA+K
Sbjct: 1   MSSFEYRNGRLFVENLPVEEIVEKEGSPLYIYSKKALVERIRAYREAFAAHPTLVAYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           AN N A++  LA  G+G+D+VS GEL RA  A VPA++IVF+GVGK+ +EI  AL+  I 
Sbjct: 61  ANGNLAILSLLAKEGAGIDVVSGGELFRARKAGVPADKIVFAGVGKSREEIAYALKEKIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES+ EL  +++ AV+LG +AP+A RVNPD++  TH  ISTG K+ KFGIP+ +  +
Sbjct: 121 MFNVESQDELDHISEVAVALGTQAPVALRVNPDVDPKTHPYISTGMKKSKFGIPVERAVA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  ASTLPG+KI G+  HIGSQ+ +I  F  AF  L     +L   G  + H+D+GGGL
Sbjct: 181 EYQRASTLPGIKIVGIHQHIGSQLTEIAPFRDAFDRLLAFHGELSRAGIKVTHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y S+  PPS +D A+L+     +L   ++LEPGR +V + GILVT+V+  K +A K+
Sbjct: 241 GIRYRSEE-PPSPADLAALVLPRVKDLGVTLVLEPGRSIVGNAGILVTRVLYRKNTAVKS 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FVI D  MND +RP+LY A+H++  +    G+   I  D+VGPICETGDF+A +R++   
Sbjct: 300 FVIGDAGMNDLLRPSLYGAHHDLLPVKETKGE--TIKGDLVGPICETGDFLATDREMPDF 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDL+ +   GAYG   +  YN+R    EI+V+GS + ++R R +F++LI  + +
Sbjct: 358 AAGDLIAVMSAGAYGFSMASNYNARPRPAEILVDGSSYRVVRDRESFEDLIRGERV 413


>gi|226952075|ref|ZP_03822539.1| diaminopimelate decarboxylase [Acinetobacter sp. ATCC 27244]
 gi|226837167|gb|EEH69550.1| diaminopimelate decarboxylase [Acinetobacter sp. ATCC 27244]
          Length = 407

 Score =  366 bits (940), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 189/402 (47%), Positives = 260/402 (64%), Gaps = 3/402 (0%)

Query: 11  LHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKT 70
           +HAE  SL++LA    TP Y YS   +EK+YL    AFD +D  +C+A+K+NSN AV+  
Sbjct: 1   MHAEQCSLDQLAQQYGTPLYVYSKATLEKHYLDMDRAFDFIDHQICFAVKSNSNIAVLNV 60

Query: 71  LAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESEL 130
           LA LG+G DIV+ GEL R LAA     +IVFSG+GK+  +I+ AL  GI CFNVES +EL
Sbjct: 61  LAKLGAGFDIVTGGELARVLAAGGDPAKIVFSGLGKSEADIEKALTVGIACFNVESHAEL 120

Query: 131 KTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPG 190
             + + A  LGKKAPI+ RVNPD++A TH  ISTG KE+KFGIP   + + Y YA++L  
Sbjct: 121 DRIQKVAAKLGKKAPISLRVNPDVDAKTHPYISTGLKENKFGIPSDAVDATYQYAASLSN 180

Query: 191 VKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRP 250
           ++I G+D HIGSQ+ + + F  A   +  + +QL+  G N++HID+GGGLG+ Y  D  P
Sbjct: 181 LEIVGIDCHIGSQLTETKPFVDALDRVILMIEQLKKLGINLKHIDIGGGLGVCY-KDETP 239

Query: 251 PSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMND 310
           P+ ++YA+ +      L  K+ +EPGR + A+ G L+TKV  +K +  + F I+D AMND
Sbjct: 240 PTVAEYANSMRPALEKLGLKVYMEPGRSISANAGTLLTKVDLLKPTNHRNFAIIDAAMND 299

Query: 311 FMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEK 370
            +RP LY+A+ +I   VNP  D      D+VG ICETGDF+   R +AL +  D+L +  
Sbjct: 300 LIRPALYEAWMDIQS-VNPNSDVEVKTWDLVGAICETGDFLGKERNLAL-QENDVLAVLG 357

Query: 371 TGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
            GAYG V S  YNSR    E+MVNG Q ++IR R T + L E
Sbjct: 358 AGAYGFVMSSNYNSRGRAAEVMVNGDQAYLIRERETIESLWE 399


>gi|145632076|ref|ZP_01787811.1| diaminopimelate decarboxylase [Haemophilus influenzae 3655]
 gi|144986983|gb|EDJ93513.1| diaminopimelate decarboxylase [Haemophilus influenzae 3655]
          Length = 415

 Score =  366 bits (940), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 190/416 (45%), Positives = 271/416 (65%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L+AE++ +++LA    TP Y YS   +E+++  F +AF     ++C+A+K
Sbjct: 1   MNFFQYKHNKLYAEDIPVQQLAEQFGTPLYVYSRATLERHWHAFDSAFGKRPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN  V+  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+ +EI  AL+ GI 
Sbjct: 61  SCSNIGVLNIMAKLGSGFDIVSQGELERVLAAGGDASKVVFSGVAKSREEIMRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SELK +NQ A  +GK API+ RVNPD++A+TH  ISTG KE+KFG+ + +   
Sbjct: 121 CFNVESVSELKHINQIAGEMGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVDEARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  ASTLP +KI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYKLASTLPNIKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGITLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  SDYA+ + +   N  + +IILEPGR + A+ GILV KV  +K +  +
Sbjct: 241 GVTY-TDETPPHPSDYANALLEKLKNYPELEIILEPGRAISANAGILVAKVQYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I D  MND +RP LY+AY  I  I +   +R     D+VGP+CET DF+   R++++
Sbjct: 300 NFAITDTGMNDMIRPALYEAYMNIIEI-DRTLEREKAIYDVVGPVCETSDFLGKQRELSI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
              GD +     GAYGA  S  YNSR    E++V+G Q ++IR R T QEL  L+S
Sbjct: 359 AE-GDYIAQCSAGAYGASMSSNYNSRARTAEVLVDGDQSYLIRRRETLQELWALES 413


>gi|113968735|ref|YP_732528.1| diaminopimelate decarboxylase [Shewanella sp. MR-4]
 gi|113883419|gb|ABI37471.1| diaminopimelate decarboxylase [Shewanella sp. MR-4]
          Length = 414

 Score =  366 bits (939), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 188/412 (45%), Positives = 263/412 (63%), Gaps = 4/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y + +L+AE   +  LA    TP Y YS   +E+++  F+NA      +VCYA+K
Sbjct: 1   MDHFLYQDNTLYAEGCRVNDLAQQYGTPLYIYSRATLERHWHAFNNAVADHPHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R + A     ++VFSGVGKT+ E++ AL  GIY
Sbjct: 61  ANSNLAVLNVLARLGSGFDIVSGGELARVIEAGGDPAKVVFSGVGKTVAEMEQALNLGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LNQ A  LGK AP++ RVNPD++A TH  ISTG KE+KFGI + +   
Sbjct: 121 CFNVESSAELEQLNQVAGRLGKIAPVSLRVNPDVDAGTHPYISTGLKENKFGIAMDEAEV 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++A A  LP +++ GVD HIGSQ+ +I+ F  A   +  L  +L   G  I+H DVGGGL
Sbjct: 181 VFARAHALPHLQVKGVDCHIGSQLTEIQPFLDAMDRMLALIDRLAEQGIVIEHFDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP    YA+ +    G+ + K+I EPGR + A+ GI VT+V+ +K+++DK 
Sbjct: 241 GVTY-DDETPPHPDVYAAALLARLGDRKLKLIFEPGRAIAANAGIFVTQVLYLKENSDKR 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+  I   VNP  ++  +  DIVGP+CETGDF+  +R +A+ 
Sbjct: 300 FAIVDGAMNDLIRPALYSAWQNI-IPVNPRDEQAQVF-DIVGPVCETGDFLGKDRALAIA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
             GDLL +  +GAYG   +  YN+R    E+MV+G + +++R R    +L +
Sbjct: 358 -AGDLLVVRSSGAYGFAMASNYNTRPRAAEVMVDGDKAYLVREREKLAQLWQ 408


>gi|307250800|ref|ZP_07532729.1| Diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306857159|gb|EFM89286.1| Diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 416

 Score =  366 bits (939), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 190/417 (45%), Positives = 273/417 (65%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y    L AE+VS+  + +   TP Y YS   +E+++  F  AF     ++C+A+K
Sbjct: 1   MNHFNYKNQQLFAEDVSVSDIINQHGTPAYIYSRATLERHWHAFDKAFGSHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN A++  +A LGSG DIVS+GEL R LAA     ++VFSGV K+  EI  AL+ GI 
Sbjct: 61  SNSNIALLNVMARLGSGFDIVSQGELERVLAAGGKPSKVVFSGVAKSHSEIQRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ES +EL  +N+ A  LGK API+ RVNPD++A+TH  ISTG KE+KFG+ + Q   
Sbjct: 121 CFNIESIAELHRINEVAGQLGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVTQARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A TLP VKI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  + H+D+GGGL
Sbjct: 181 VYRLAKTLPNVKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGIELHHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y+ +  PP  ++YA +L+ +  G    +IILEPGR + A+ GILVTKV  +K + D+
Sbjct: 241 GVPYNGE-EPPHPTEYAKALLEKLKGYADLEIILEPGRAITANAGILVTKVEYLKANEDR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY+AY +I   V+ +  R     D+VGPICET DF+  +R++A+
Sbjct: 300 NFAIVDTGMNDMIRPALYEAYMQITE-VDQSLSREKAVYDVVGPICETSDFLGKDRELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            + GDL+ +   GAYGA  S TYNSR    EIMV+G Q ++I+ R +F +L  L+ +
Sbjct: 359 EQ-GDLIAMRSAGAYGAAMSSTYNSRPQAVEIMVDGDQAYLIKARASFADLWRLEKL 414


>gi|33594789|ref|NP_882432.1| diaminopimelate decarboxylase [Bordetella parapertussis 12822]
 gi|33599061|ref|NP_886621.1| diaminopimelate decarboxylase [Bordetella bronchiseptica RB50]
 gi|33564865|emb|CAE39809.1| diaminopimelate decarboxylase [Bordetella parapertussis]
 gi|33575107|emb|CAE30570.1| diaminopimelate decarboxylase [Bordetella bronchiseptica RB50]
          Length = 429

 Score =  366 bits (939), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 188/418 (44%), Positives = 269/418 (64%), Gaps = 13/418 (3%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
           F+Y  G LHAE+V L+ LA  + TP Y YS  A+   + T+ +A      +VC+ +KANS
Sbjct: 16  FRYQNGVLHAEDVPLDSLAAQLGTPLYVYSRAALRSAWETYRDAIGERPVLVCFGMKANS 75

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFN 123
           N AV+K  A LG+G DIVS GEL R LA      ++VFSGVGK   E+  AL++ + CFN
Sbjct: 76  NLAVLKEFARLGAGFDIVSGGELARVLAVGGDPAKVVFSGVGKQAWEMRAALEADVKCFN 135

Query: 124 VESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA 183
           VESE+EL+ L+  AVS+G++A ++ RVNPD++A TH  ISTG KE+KFGI I    + Y 
Sbjct: 136 VESEAELERLSDVAVSMGRRARVSLRVNPDVDAQTHPYISTGLKENKFGIAIESAPAAYR 195

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIA 243
            A+ LPGV++ GVD HIGSQ+  I  +  A + L DL +QL  NG  I+H+D+GGGLGI 
Sbjct: 196 LAARLPGVEVVGVDCHIGSQLTDISPYFDALEKLLDLIEQLAENGIAIKHLDLGGGLGIR 255

Query: 244 YHSDHRPPSSSDYASLIHQYFGNLQCK------IILEPGRFLVADVGILVTKVISIKKSA 297
           Y +D  PPS     +L+ + F  +  +      I+LEPGR LV + G+L+T V  +K + 
Sbjct: 256 Y-TDEIPPSPK---ALLDRVFERINARGLGHLHIVLEPGRSLVGNAGVLLTTVQYLKHAE 311

Query: 298 DKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKI 357
            + F I+D AMND +RP LY+AYH +   V P  D+  I  D+VGP+CE+ D++A  R +
Sbjct: 312 ARNFAIVDAAMNDLLRPALYEAYHGVQ-PVTPRADK-RIEYDVVGPVCESADWLARGRAL 369

Query: 358 ALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
           A+ + GD+L +E  GAY  V +  YN+R+   E+MV+G++ +I+R R T + L + +S
Sbjct: 370 AI-QAGDVLAVESAGAYSMVMASNYNTRVRAAEVMVDGNRHYIVRQRETLESLYQGES 426


>gi|315635221|ref|ZP_07890498.1| diaminopimelate decarboxylase [Aggregatibacter segnis ATCC 33393]
 gi|315475967|gb|EFU66722.1| diaminopimelate decarboxylase [Aggregatibacter segnis ATCC 33393]
          Length = 416

 Score =  366 bits (939), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 190/417 (45%), Positives = 265/417 (63%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y    L AEN+ +++LA    TP Y YS   +E+++  F+NAF     +VC+A+K
Sbjct: 1   MDFFQYKNNQLMAENLPVKQLAEQFGTPLYVYSRATLERHWHAFNNAFGEHPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +N N A++  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+  EI  AL+  I 
Sbjct: 61  SNPNIAILNIMAKLGSGFDIVSQGELERVLAAGGDAAKVVFSGVAKSRQEIARALEVNIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE+EL  +NQ A  +GK API+ RVNPD++A+TH  ISTG KE+KFG+ + Q   
Sbjct: 121 CFNVESEAELLRINQIAGEMGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVEQARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+TLP +KI G+D HIGSQ+ +++ F  A   L  L +QL  +G +++H+D+GGGL
Sbjct: 181 VYKLAATLPNIKIVGMDCHIGSQLTELQPFLDAVDRLIVLMEQLNQDGIHLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  ++YA  + +      + +II+EPGR + A+ GILVTKV  +K +  +
Sbjct: 241 GVTY-TDETPPHPTEYAKALWEKLSAFSELEIIVEPGRAITANAGILVTKVEYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I D  MND +RP LY AY  I  I         I+ D+VGPICET DF+   RK+A+
Sbjct: 300 NFAIADAGMNDMIRPALYQAYMNILEIDRTLAREEKIY-DVVGPICETSDFLGKQRKLAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GD L     GAYGA  S  YNSR    E+MV+G + ++IR R    EL +L+S+
Sbjct: 359 AE-GDYLAQRSAGAYGASMSSNYNSRPRTAEVMVDGDKAYLIRRREALNELWQLESL 414


>gi|145638478|ref|ZP_01794088.1| diaminopimelate decarboxylase [Haemophilus influenzae PittII]
 gi|145272807|gb|EDK12714.1| diaminopimelate decarboxylase [Haemophilus influenzae PittII]
 gi|309751609|gb|ADO81593.1| Diaminopimelate decarboxylase [Haemophilus influenzae R2866]
 gi|309973776|gb|ADO96977.1| Diaminopimelate decarboxylase [Haemophilus influenzae R2846]
          Length = 415

 Score =  366 bits (939), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 190/416 (45%), Positives = 271/416 (65%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L+AE++ +++LA    TP Y YS   +E+++  F +AF     ++C+A+K
Sbjct: 1   MNFFQYKHNKLYAEDIPVQQLAEQFGTPLYVYSRATLERHWHAFDSAFGKRPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN  V+  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+ +EI  AL+ GI 
Sbjct: 61  SCSNIGVLNIMAKLGSGFDIVSQGELERVLAAGGDASKVVFSGVAKSREEIMRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SELK +NQ A  +GK API+ RVNPD++A+TH  ISTG KE+KFG+ +++   
Sbjct: 121 CFNVESVSELKHINQIAGEMGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVNEARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  ASTLP +KI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYKLASTLPNIKITGMDCHIGSQLTELQPFLDAADRLIVLMEQLKEDGITLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  SDYA+ + +   N  + +IILEPGR + A+ GILV KV  +K +  +
Sbjct: 241 GVTY-TDETPPHPSDYANALLEKLKNYPELEIILEPGRAISANAGILVAKVQYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I D  MND +RP LY+AY  I  I         I+ D+VGP+CET DF+   R++++
Sbjct: 300 NFAITDTGMNDMIRPALYEAYMNIIEIDRTLAREKAIY-DVVGPVCETSDFLGKQRELSI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
              GD +     GAYGA  S  YNSR    E++V+G Q ++IR R T QEL  L+S
Sbjct: 359 AE-GDYIAQCSAGAYGASMSSNYNSRPRTAEVLVDGDQSYLIRRRETLQELWVLES 413


>gi|197124574|ref|YP_002136525.1| diaminopimelate decarboxylase [Anaeromyxobacter sp. K]
 gi|196174423|gb|ACG75396.1| diaminopimelate decarboxylase [Anaeromyxobacter sp. K]
          Length = 427

 Score =  365 bits (938), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 185/431 (42%), Positives = 257/431 (59%), Gaps = 9/431 (2%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+   G LHAE V +E+LA    TP Y YST  + +++     +  G+D +VCYA+K
Sbjct: 1   MNHFQRKRGVLHAEAVPVEELARAYGTPLYVYSTATLTRHWKVLHRSLAGLDHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+   A LGSG DIVS GEL R L A     ++VFSGVGK  DEI  AL+SG+ 
Sbjct: 61  ANSNLAVLSLFARLGSGFDIVSGGELYRVLKAGGHPGKVVFSGVGKRDDEIAFALESGVK 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
             NVES  EL  ++  A  +G +AP+A RVNPD++  TH  ISTG  E+KFG+ + +   
Sbjct: 121 VLNVESAPELARVSIVARRMGLRAPVALRVNPDVDPKTHPYISTGLSENKFGVSVDEARR 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LYA A+  P +++ GV  HIGSQI  +  F  A   +  L + L   G  + H+DVGGGL
Sbjct: 181 LYALAAQDPALEVRGVACHIGSQITTVRPFLDAIARVLSLVKDLGKQGIRLGHVDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y +D  PP   +Y   I +       +++LEPGR LV + G+LVT+V+ +K+S  K 
Sbjct: 241 GITY-ADEEPPHPDEYGRAIKKALSRFDGEVMLEPGRVLVGNAGVLVTRVLHVKESGRKV 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FV++D AMND +RP+ YDA+HEI     P  D   I  D+VGP+CE+ DF+A  R++  P
Sbjct: 300 FVVVDAAMNDLVRPSYYDAHHEIEAAGAPRKDADEIVCDVVGPVCESSDFLARKRRMPRP 359

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
             GDLL +   GAYG   S  YNSR    E++V+G    + R R T+ +L+         
Sbjct: 360 VRGDLLVVRSAGAYGFAMSSNYNSRPRAAEVLVDGDGARLARRRETYADLVR-------- 411

Query: 421 QKTPKQSSENY 431
            +TP+  +E +
Sbjct: 412 GETPEPEAERF 422


>gi|294671408|ref|ZP_06736257.1| hypothetical protein NEIELOOT_03116 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291306885|gb|EFE48128.1| hypothetical protein NEIELOOT_03116 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 406

 Score =  365 bits (938), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 186/406 (45%), Positives = 260/406 (64%), Gaps = 12/406 (2%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           SLH EN+S  +LA    TP Y YS   ++  +  +  AF  +  ++CYA+KAN N +VI+
Sbjct: 2   SLHCENISYTELAERFGTPLYVYSQAELDSAFARYQTAFAALAPLICYAVKANGNLSVIR 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A++ +FSGVGK+  EI+ AL+SGI CFNVES  E
Sbjct: 62  RFAELGSGFDIVSGGELARVLAAGGRADKTIFSGVGKSAAEIEFALKSGIKCFNVESLPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           L  +N+ A  L   AP++ R+NPD++A TH  ISTG K +KFGI +      Y +A++LP
Sbjct: 122 LDRINEIAGRLKTAAPVSLRINPDVDAQTHPYISTGLKANKFGIAMEDAERAYLHAASLP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            + I G+D HIGSQ+ ++E   +A + L  L  +L ++G  +QHID+GGG+GI Y ++  
Sbjct: 182 HLNIIGIDCHIGSQLIKLEPLVEACERLLPLIDKLAAHGIGLQHIDLGGGVGIVYQNEET 241

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
           P  ++ YA+ + +  G    K+ILEPGR LV + G L+T+V  +K++ DK FV++D AMN
Sbjct: 242 PDLAA-YAAAVQKLLGGRSLKLILEPGRSLVGNAGALLTRVEFVKQNGDKNFVVVDAAMN 300

Query: 310 DFMRPTLYDAYHEIN----YIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDL 365
           D MRP LY AYH I      I  P        ADIVGPICETGDF+A +R I+  R GDL
Sbjct: 301 DLMRPALYQAYHHIENAEPSISAP------FAADIVGPICETGDFLAKDRMIS-ARAGDL 353

Query: 366 LYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELI 411
           L +   GAY +  +G YN+R    E+++NGS+  I+R R T +E++
Sbjct: 354 LVVRSAGAYASSMAGNYNTRPRAAEVLINGSEAKIVRHRETLEEML 399


>gi|28899758|ref|NP_799363.1| diaminopimelate decarboxylase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153838760|ref|ZP_01991427.1| diaminopimelate decarboxylase [Vibrio parahaemolyticus AQ3810]
 gi|260365174|ref|ZP_05777739.1| diaminopimelate decarboxylase [Vibrio parahaemolyticus K5030]
 gi|260878126|ref|ZP_05890481.1| diaminopimelate decarboxylase [Vibrio parahaemolyticus AN-5034]
 gi|260895817|ref|ZP_05904313.1| diaminopimelate decarboxylase [Vibrio parahaemolyticus Peru-466]
 gi|260900850|ref|ZP_05909245.1| diaminopimelate decarboxylase [Vibrio parahaemolyticus AQ4037]
 gi|28808010|dbj|BAC61247.1| diaminopimelate decarboxylase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149747846|gb|EDM58730.1| diaminopimelate decarboxylase [Vibrio parahaemolyticus AQ3810]
 gi|308087170|gb|EFO36865.1| diaminopimelate decarboxylase [Vibrio parahaemolyticus Peru-466]
 gi|308092764|gb|EFO42459.1| diaminopimelate decarboxylase [Vibrio parahaemolyticus AN-5034]
 gi|308110594|gb|EFO48134.1| diaminopimelate decarboxylase [Vibrio parahaemolyticus AQ4037]
 gi|308111029|gb|EFO48569.1| diaminopimelate decarboxylase [Vibrio parahaemolyticus K5030]
 gi|328472415|gb|EGF43281.1| diaminopimelate decarboxylase [Vibrio parahaemolyticus 10329]
          Length = 417

 Score =  365 bits (938), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 195/418 (46%), Positives = 263/418 (62%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE+V L+ LA    TP Y YS   +E+++  F +A      +VCYA+
Sbjct: 1   MDYFNYQDDGQLWAEDVPLQALAEQYGTPLYVYSRATLERHWKAFDSAVGQHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+  LA LGSG DIVS GEL R +AA   A+++VFSGVGKT  E+  AL+ GI
Sbjct: 61  KANSNLGVLNALARLGSGFDIVSGGELERVIAAGGDAKKVVFSGVGKTPAEMKRALELGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG  API+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNKVAGELGVIAPISLRINPDVDAKTHPYISTGLRDNKFGIAFDRAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y +A +LP + + G+D HIGSQ+  I+ F  A   L  L   L++ G NI+H+DVGGG
Sbjct: 181 EVYQFAQSLPNLNVQGIDCHIGSQLTSIDPFIDATDRLLALIDDLKAQGINIRHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  SDYA  +     N Q  ++I EPGR + A+ GIL+T+V  +K +  
Sbjct: 241 LGVVYR-DELPPQPSDYAKALLGRLENHQDLELIFEPGRAIAANAGILLTRVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I   V+P       + D+VGPICETGDF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDI-VPVSPRNGEPQTY-DLVGPICETGDFLGKDRALV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L + GDLL +   GAYG V S  YN+R    E+MV+G+Q H++R R     L +L+ I
Sbjct: 358 L-QEGDLLAVRSAGAYGFVMSSNYNTRTRAAEVMVDGNQSHLVRQREELTSLWQLEQI 414


>gi|220919297|ref|YP_002494601.1| diaminopimelate decarboxylase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219957151|gb|ACL67535.1| diaminopimelate decarboxylase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 427

 Score =  365 bits (938), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 185/431 (42%), Positives = 257/431 (59%), Gaps = 9/431 (2%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+   G LHAE V +E+LA    TP Y YST  + +++     +  G+D +VCYA+K
Sbjct: 1   MNHFQRKRGVLHAEAVPVEELARAYGTPLYVYSTATLTRHWKVLHRSLAGLDHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+   A LGSG DIVS GEL R L A     ++VFSGVGK  DE+  AL+SG+ 
Sbjct: 61  ANSNLAVLSLFARLGSGFDIVSGGELYRVLKAGGHPGKVVFSGVGKRDDEVAFALESGVK 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
             NVES  EL  ++  A  +G +AP+A RVNPD++  TH  ISTG  E+KFG+ + +   
Sbjct: 121 VLNVESAPELARISIVARRMGLRAPVALRVNPDVDPKTHPYISTGLSENKFGVSVDEARR 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LYA A+  P +++ GV  HIGSQI  +  F  A   +  L + L   G  + H+DVGGGL
Sbjct: 181 LYALAAQDPALEVRGVACHIGSQITTVRPFLDAIARVLSLVKDLGKQGIRLGHVDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y +D  PP   +Y   I +       +++LEPGR LV + G+LVT+V+ +K+S  K 
Sbjct: 241 GITY-ADEEPPHPDEYGRAIKKALSRFDGEVMLEPGRVLVGNAGVLVTRVLHVKESGRKV 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FV++D AMND +RP+ YDA+HEI     P  D   I  D+VGPICE+ DF+A  R++  P
Sbjct: 300 FVVVDAAMNDLVRPSYYDAHHEIEPAGAPRKDAEEIVCDVVGPICESSDFLARKRRMPRP 359

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
             GDLL +   GAYG   S  YNSR    E++V+G    + R R T+ +L+         
Sbjct: 360 VRGDLLVVRSAGAYGFAMSSNYNSRPRAAEVLVDGDGARLARRRETYADLVR-------- 411

Query: 421 QKTPKQSSENY 431
            +TP+  +E +
Sbjct: 412 GETPEPEAERF 422


>gi|91227530|ref|ZP_01261867.1| diaminopimelate decarboxylase [Vibrio alginolyticus 12G01]
 gi|91188554|gb|EAS74846.1| diaminopimelate decarboxylase [Vibrio alginolyticus 12G01]
          Length = 417

 Score =  365 bits (938), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 195/418 (46%), Positives = 262/418 (62%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE+V L+ LA    TP Y YS   +E+++  F +A      +VCYA+
Sbjct: 1   MDYFNYQDDGQLWAEDVPLQALAEQYGTPLYVYSRATLERHWKAFDSAVGQHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA LGSG DIVS GEL R +AA    +++VFSGVGKT  E+  AL+ GI
Sbjct: 61  KANSNLGVLNTLARLGSGFDIVSGGELERVIAAGGDPKKVVFSGVGKTPAEMKRALELGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG  API+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNKVAGELGVIAPISLRINPDVDAKTHPYISTGLRDNKFGIAFDRAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y +A +LP + + G+D HIGSQ+  I+ F  A   L  L   L++ G NI+H+DVGGG
Sbjct: 181 DVYKFAQSLPNLNVQGIDCHIGSQLTNIDPFIDATDRLLALIDDLKAQGINIRHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  SDYA  +     N Q  ++I EPGR + A+ GIL+T+V  +K +  
Sbjct: 241 LGVVYR-DELPPQPSDYAKALLGRLENHQDLELIFEPGRAIAANAGILLTRVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I   V+P       + D+VGPICETGDF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDI-VPVSPRKGEAQTY-DLVGPICETGDFLGKDRALV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L + GDLL +   GAYG V S  YN+R    E+MV+G Q H++R R     L +L+ I
Sbjct: 358 L-QEGDLLAVRSAGAYGFVMSSNYNTRTRAAEVMVDGKQSHLVRQREELTSLWQLEQI 414


>gi|293390767|ref|ZP_06635101.1| diaminopimelate decarboxylase [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951301|gb|EFE01420.1| diaminopimelate decarboxylase [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 416

 Score =  365 bits (937), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 189/417 (45%), Positives = 264/417 (63%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y    L  EN+ +++LA    TP Y YS  A+E+++  F NAF     +VC+A+K
Sbjct: 1   MDFFQYQYDRLMVENLPVKQLAEEFGTPLYVYSKAALERHWYAFENAFGNHPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +N N A++  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+  EI  AL+ GI 
Sbjct: 61  SNPNIAILNIMARLGSGFDIVSQGELERVLAAGGEAHKVVFSGVAKSRREIARALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE+EL  +NQ A  +GK API+ RVNPD++A+TH  ISTG KE+KFG+ + Q   
Sbjct: 121 CFNVESEAELLRINQVAGDIGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVEQARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+TLP ++I G+D HIGSQ+ +++ F  A   L  L +QL+ +   ++H+D+GGGL
Sbjct: 181 VYKLATTLPNIEIVGMDCHIGSQLTELQPFLDAADRLIMLMEQLKQDSIQLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  ++YA  + +      + +II+EPGR + A+ GILVTKV  +K +  +
Sbjct: 241 GVTY-TDETPPHPTEYAKALWEKLSAFNELEIIVEPGRAITANAGILVTKVEYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY AY  I  I         I+ D+VGPICET DF+   RK+A+
Sbjct: 300 NFAIVDAGMNDMIRPALYQAYMNILEIDRTLAREEKIY-DVVGPICETSDFLGKQRKLAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GD L     GAYGA  S  YNSR    E+MV+G   ++IR R    EL +L+S+
Sbjct: 359 AE-GDYLAQRSAGAYGASMSSNYNSRPRTAEVMVDGDNAYLIRRREALNELWQLESL 414


>gi|223042044|ref|ZP_03612221.1| diaminopimelate decarboxylase [Actinobacillus minor 202]
 gi|223017161|gb|EEF15596.1| diaminopimelate decarboxylase [Actinobacillus minor 202]
          Length = 416

 Score =  365 bits (937), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 190/415 (45%), Positives = 271/415 (65%), Gaps = 4/415 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L AE++++  +     TP Y YS   +E+++  F NAF     ++C+A+K
Sbjct: 1   MNHFEYKNQQLFAEDIAVSDIVKEYGTPAYIYSRATLERHWHAFDNAFGDHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN A++  +A LGSG DIVS+GEL R L A   A ++VFSGV K+  EI  AL+ GI 
Sbjct: 61  SNSNIALLNIMARLGSGFDIVSQGELERVLVAGGDASKVVFSGVAKSHTEIARALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SEL  +N+ A  LGK API+ RVNPD++A+TH  ISTG KE+KFG+ + Q   
Sbjct: 121 CFNVESISELHRINEVAGQLGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVQQARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS LP VKI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  + H+D+GGGL
Sbjct: 181 VYRLASRLPNVKITGMDCHIGSQLTELQPFLDATDRLIILMEQLKEDGILLHHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ YH +  PP  ++YA  + +   + Q  +IILEPGR + A+ GILVTKV  +K + D+
Sbjct: 241 GVPYHGE-EPPHPTEYAKALLEKLKDYQDLEIILEPGRAITANAGILVTKVEYLKTNEDR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY+AY E+   V+ +  R     D+VGPICET DF+   R++A+
Sbjct: 300 RFAIVDTGMNDMIRPALYEAYMELTE-VDRSLPREKAVYDVVGPICETSDFLGKERELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELD 414
              GDL+ +   GAYGA  S TYNSR    EIMV+G+  ++I+ R +F++L  L+
Sbjct: 359 AE-GDLVAMRSAGAYGATMSSTYNSRPQAVEIMVDGANCYLIKERASFEDLWRLE 412


>gi|303250943|ref|ZP_07337133.1| diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|302650215|gb|EFL80381.1| diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 416

 Score =  365 bits (937), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 189/417 (45%), Positives = 272/417 (65%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y    L AE+VS+  + +   TP Y YS   +E+++  F  AF     ++C+A+K
Sbjct: 1   MNHFNYKNQQLFAEDVSVSDIINQYGTPAYIYSRATLERHWHAFDKAFGAHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN A++  +  LGSG DIVS+GEL R LAA     ++VFSGV K+  EI  AL+ GI 
Sbjct: 61  SNSNIALLNVMVRLGSGFDIVSQGELERVLAAGGEPSKVVFSGVAKSHSEIQRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ES +EL  +N+ A  LGK API+ RVNPD++A+TH  ISTG KE+KFG+ + Q   
Sbjct: 121 CFNIESIAELHRINEVAGQLGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVTQARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A TLP VKI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  + H+D+GGGL
Sbjct: 181 VYRLAKTLPNVKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGIELHHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y+ +  PP  ++YA +L+ +  G    +IILEPGR + A+ GILVTKV  +K + D+
Sbjct: 241 GVPYNGE-EPPHPTEYAKALLEKLKGYADLEIILEPGRAITANAGILVTKVEYLKANEDR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY+AY +I   V+ +  R     D+VGPICET DF+  +R++A+
Sbjct: 300 NFAIVDTGMNDMIRPALYEAYMQITE-VDQSLSREKAVYDVVGPICETSDFLGKDRELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            + GDL+ +   GAYGA  S TYNSR    EIMV+G Q ++I+ R +F +L  L+ +
Sbjct: 359 EQ-GDLIAMRSAGAYGAAMSSTYNSRPQAVEIMVDGDQAYLIKARASFADLWRLEKL 414


>gi|59713092|ref|YP_205868.1| diaminopimelate decarboxylase, PLP-binding [Vibrio fischeri ES114]
 gi|59481193|gb|AAW86980.1| diaminopimelate decarboxylase, PLP-binding [Vibrio fischeri ES114]
          Length = 417

 Score =  365 bits (937), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 193/418 (46%), Positives = 260/418 (62%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE + + +LA    TP Y YS   +E+++  F N+      +VCYA+
Sbjct: 1   MDYFNYKDDGQLWAEELPITQLAEQFGTPLYVYSRATLERHWKAFDNSVGNHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+  LA LGSG DIVS+GEL R +AA     ++VFSGVGKT DE+  AL+  I
Sbjct: 61  KANSNIGVLNALARLGSGFDIVSQGELERVVAAGGDPTKVVFSGVGKTADEMRRALELKI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN  A  +G  API+ R+NPD++A TH  ISTG +++KFGI      
Sbjct: 121 KCFNVESEPELERLNAVAAEMGVIAPISLRINPDVDAKTHPYISTGLRDNKFGIAFDHAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y +A +LP + + G+D HIGSQ+  IE F  A   L  L   L++ G NI+H+DVGGG
Sbjct: 181 EVYKFAQSLPNLDVQGIDCHIGSQLTDIEPFIDATDRLLALIDDLKAQGVNIRHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYAS-LIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  S+YA+ L+ +   +   ++I EPGR + A+ GILVTKV  +K +  
Sbjct: 241 LGVVYR-DELPPQPSEYATALLGRLAEHQDLELIFEPGRAIAANAGILVTKVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I  +V   GD  +   D+VGPICETGDF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDIVPVVPREGDAQNY--DLVGPICETGDFLGKDRALV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L    DLL +  +GAYG V S  YN+R    EIMV+G   H++R R     L EL++I
Sbjct: 358 L-EANDLLAVRSSGAYGFVMSSNYNTRCRAAEIMVDGGDVHLVRKREELSSLWELEAI 414


>gi|240947851|ref|ZP_04752291.1| Diaminopimelate decarboxylase [Actinobacillus minor NM305]
 gi|240297813|gb|EER48249.1| Diaminopimelate decarboxylase [Actinobacillus minor NM305]
          Length = 416

 Score =  365 bits (937), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 189/415 (45%), Positives = 271/415 (65%), Gaps = 4/415 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L AE++++  +     TP Y YS   +E+++  F NAF     ++C+A+K
Sbjct: 1   MNHFEYKNQQLFAEDIAVSDIVKEHGTPAYIYSRATLERHWHAFDNAFGDHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN A++  +A LGSG DIVS+GEL R LAA     ++VFSGV K+  EI  AL+ GI 
Sbjct: 61  SNSNIALLNIMARLGSGFDIVSQGELERVLAAGGDPSKVVFSGVAKSHAEIARALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SEL  +N+ A  LGK API+ RVNPD++A+TH  ISTG KE+KFG+ + Q   
Sbjct: 121 CFNVESISELHRINEVAGQLGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVQQARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS LP VKI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  + H+D+GGGL
Sbjct: 181 VYRLASHLPNVKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGIRLHHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ YH +  PP  ++YA  + +   + Q  +IILEPGR + A+ GILVTKV  +K + D+
Sbjct: 241 GVPYHGE-EPPHPTEYAKALLEKLKDYQDLEIILEPGRAITANAGILVTKVEYLKTNEDR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY+AY E+   V+ +  R     D+VGPICET DF+   R++A+
Sbjct: 300 RFAIVDTGMNDMIRPALYEAYMELTE-VDRSLSREKAVYDVVGPICETSDFLGKQRELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELD 414
              GDL+ +   GAYGA  S TYNSR    EIMV+ + +++I+ R +F++L  L+
Sbjct: 359 AE-GDLIAMRSAGAYGATMSSTYNSRPQAVEIMVDSANYYLIKARASFEDLWRLE 412


>gi|190150854|ref|YP_001969379.1| diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|307264204|ref|ZP_07545795.1| Diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|189915985|gb|ACE62237.1| Diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|306870450|gb|EFN02203.1| Diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 416

 Score =  365 bits (937), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 189/417 (45%), Positives = 273/417 (65%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y    L AE+VS+  + +   TP Y YS   +E+++  F  AF     ++C+A+K
Sbjct: 1   MNHFNYKNQQLFAEDVSVSDIINQHGTPAYIYSRATLERHWHAFDKAFGAHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN A++  +A LGSG DIVS+GEL R LAA     ++VFSGV K+  EI  AL+ GI 
Sbjct: 61  SNSNIALLNVMARLGSGFDIVSQGELERVLAAGGEPSKVVFSGVAKSHSEIQRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ES +EL  +N+ A  LGK API+ RVNPD++A+TH  ISTG KE+KFG+ + Q   
Sbjct: 121 CFNIESIAELHRINEVAGQLGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVTQARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A +LP VKI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  + H+D+GGGL
Sbjct: 181 VYRLAKSLPNVKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGIELHHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y+ +  PP  ++YA +L+ +  G    +IILEPGR + A+ GILVTKV  +K + D+
Sbjct: 241 GVPYNGE-EPPHPTEYAKALLEKLKGYADLEIILEPGRAITANAGILVTKVEYLKANEDR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY+AY +I   V+ +  R     D+VGPICET DF+  +R++A+
Sbjct: 300 NFAIVDTGMNDMIRPALYEAYMQITE-VDQSLSREKAVYDVVGPICETSDFLGKDRELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            + GDL+ +   GAYGA  S TYNSR    EIMV+G Q ++I+ R +F +L  L+ +
Sbjct: 359 EQ-GDLIAMRSAGAYGAAMSSTYNSRPQAVEIMVDGDQAYLIKARASFADLWRLEKL 414


>gi|197336405|ref|YP_002157271.1| diaminopimelate decarboxylase [Vibrio fischeri MJ11]
 gi|197317895|gb|ACH67342.1| diaminopimelate decarboxylase [Vibrio fischeri MJ11]
          Length = 417

 Score =  365 bits (936), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 193/418 (46%), Positives = 261/418 (62%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE + + +LA    TP Y YS   +E+++  F N+      +VCYA+
Sbjct: 1   MDYFNYKDDGQLWAEELPITQLAEQFGTPLYVYSRATLERHWKAFDNSVGNHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+  LA LGSG DIVS+GEL R +AA     ++VFSGVGKT DE+  AL+  I
Sbjct: 61  KANSNIGVLNALARLGSGFDIVSQGELERVVAAGGDPTKVVFSGVGKTADEMRRALELKI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN  A  +G  API+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNAVAAEMGVIAPISLRINPDVDAKTHPYISTGLRDNKFGIAFDRAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y +A +LP + + G+D HIGSQ+  IE F  A   L  L   L++ G NI+H+DVGGG
Sbjct: 181 EVYKFAQSLPNLDVQGIDCHIGSQLTDIEPFIDATDRLLALIDDLKAQGVNIRHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYAS-LIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  S+YA+ L+ +   +   ++I EPGR + A+ GILVTKV  +K +  
Sbjct: 241 LGVVYR-DELPPQPSEYATALLGRLAEHQDLELIFEPGRAIAANAGILVTKVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I  +V   GD  +   D+VGPICETGDF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDIVPVVPHEGDAQNY--DLVGPICETGDFLGKDRALV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L    DLL +  +GAYG V S  YN+R    EIMV+G   H++R R     L EL++I
Sbjct: 358 L-EANDLLAVRSSGAYGFVMSSNYNTRCRAAEIMVDGGDAHLVRKREELSSLWELEAI 414


>gi|262373159|ref|ZP_06066438.1| diaminopimelate decarboxylase [Acinetobacter junii SH205]
 gi|262313184|gb|EEY94269.1| diaminopimelate decarboxylase [Acinetobacter junii SH205]
          Length = 416

 Score =  365 bits (936), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 188/410 (45%), Positives = 263/410 (64%), Gaps = 3/410 (0%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           +F    G LHAE  SL++LA    TP Y YS   +EK+YL    AFD +D  +C+A+K+N
Sbjct: 2   SFTRINGVLHAEQCSLDQLALQFGTPLYVYSKATLEKHYLDMDRAFDFIDHQICFAVKSN 61

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+  LA LG+G DIV+ GEL R LAA     +IVFSG+GK+  +I+ AL  GI CF
Sbjct: 62  SNLAVLNVLAKLGAGFDIVTGGELARVLAAGGNPAKIVFSGLGKSEADIEKALDVGIACF 121

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES +EL  + + A  LGKKAPI+ RVNPD++A TH  ISTG KE+KFGIP   ++  Y
Sbjct: 122 NVESYAELDRIQKVAAKLGKKAPISLRVNPDVDAKTHPYISTGLKENKFGIPSDTVYETY 181

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
            YA++LP ++I G+D HIGSQ+ + + F  A   +  + ++L+  G N++HID+GGGLG+
Sbjct: 182 QYAASLPNLEIVGIDCHIGSQLTETKPFVDALDRVVLMIEELKKLGINLKHIDIGGGLGV 241

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y  D  PP+ ++YA+ +      L  K+ +EPGR + A+ G L+TKV  +K +  + F 
Sbjct: 242 RY-KDETPPTVAEYANAMRPVLEKLGLKVYMEPGRSISANAGALLTKVDLLKPTNHRNFA 300

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND +RP LY+A+ +I  +  P  D      D+VG ICETGDF+   R +AL + 
Sbjct: 301 IIDAAMNDLIRPALYEAWMDIQSVA-PHSDVEVKTWDLVGAICETGDFLGKQRDLAL-QE 358

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
            D+L +   GAYG V S  YN+R    E+MV+G Q ++IR R T + L E
Sbjct: 359 NDVLAVLGAGAYGFVMSSNYNTRGRAAEVMVSGDQAYLIRERETIESLWE 408


>gi|145634864|ref|ZP_01790572.1| diaminopimelate decarboxylase [Haemophilus influenzae PittAA]
 gi|145268030|gb|EDK08026.1| diaminopimelate decarboxylase [Haemophilus influenzae PittAA]
          Length = 415

 Score =  365 bits (936), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 190/416 (45%), Positives = 271/416 (65%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L+AE++ +++LA    TP Y YS   +E+++  F +AF     ++C+A+K
Sbjct: 1   MNFFQYKHNKLYAEDIPVQQLAEQFGTPLYVYSRATLERHWHAFDSAFGKRPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN  V+  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+ +EI  AL+ GI 
Sbjct: 61  SCSNIGVLNIMAKLGSGFDIVSQGELERVLAAGGDASKVVFSGVAKSREEIMRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SELK +NQ A  +GK API+ RVNPD++A+TH  ISTG KE+KFG+ + +   
Sbjct: 121 CFNVESVSELKHINQIAGEMGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVDEARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  ASTLP +KI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYKLASTLPNIKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGITLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  SDYA+ + +   N  + +IILEPGR + A+ GILV KV  +K +  +
Sbjct: 241 GVTY-TDETPPHPSDYANALLEKLKNYPELEIILEPGRAISANAGILVAKVQYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I D  MND +RP LY+AY  I  I +   +R     D+VGP+CET DF+   R++++
Sbjct: 300 NFAITDTGMNDMIRPALYEAYMNIIEI-DRTLEREKAIYDVVGPVCETSDFLGKQRELSI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
              GD +     GAYGA  S  YNSR    E++V+G Q ++IR R T QEL  L+S
Sbjct: 359 AE-GDYIAQCSAGAYGASMSSNYNSRPRTAEVLVDGDQSYLIRRRETLQELWALES 413


>gi|218778271|ref|YP_002429589.1| diaminopimelate decarboxylase [Desulfatibacillum alkenivorans
           AK-01]
 gi|218759655|gb|ACL02121.1| diaminopimelate decarboxylase [Desulfatibacillum alkenivorans
           AK-01]
          Length = 417

 Score =  365 bits (936), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 184/420 (43%), Positives = 266/420 (63%), Gaps = 3/420 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y   +L+ E+V +  +A  + TP + YS   + +++  F  AF  +D ++CY+ K
Sbjct: 1   MHHFQYQNNALYCEDVPVADIAANLGTPLFIYSHATLTRHFQAFDKAFGDVDHIICYSAK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           AN+N A++K  A +G+GLD+VS GEL R L A +PA +I ++GVGKT DEIDLAL SGI 
Sbjct: 61  ANTNGAILKMFADMGTGLDVVSGGELHRGLKAGIPANKIAYAGVGKTQDEIDLALNSGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL+ +N RA +LGKKAPI+ RVNP+++A TH  ISTG K++KFGI    +  
Sbjct: 121 MFNVESFEELQAINARAKALGKKAPISLRVNPNVDAKTHPYISTGMKKNKFGIAKEAVVE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A  L   ++ G+D HIGSQI Q+  F +A + ++ L  +L+  G  I ++DVGGGL
Sbjct: 181 AYKAAHELDSTEVVGIDFHIGSQITQVGPFVEAMESVKSLAAELKGMGIGINYLDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  +   P   +YA  I +   +    ++LEPGR +V + GI+VT+ + +K+ A K 
Sbjct: 241 GINYDDEEP-PEPDEYAKAICKVIADFPITVVLEPGRAMVGNAGIMVTRFLYLKEGATKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F+I+D  MND +RP++Y A+H I  +    GD L    D+VGPICE+ DF+A +R+I   
Sbjct: 300 FIIVDAGMNDLIRPSIYGAFHLIQPVNKREGDPL--TGDVVGPICESTDFLAKDREIGAV 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
            PGDLL +   GAYG   S  YNSR    E+MV G+ F +IR R  +++L   + IP +L
Sbjct: 358 VPGDLLAVMSAGAYGFAMSSNYNSRPRACEVMVKGNAFEVIRQRENYEDLTRGEVIPTFL 417


>gi|226946776|ref|YP_002801849.1| diaminopimelate decarboxylase [Azotobacter vinelandii DJ]
 gi|226721703|gb|ACO80874.1| diaminopimelate decarboxylase [Azotobacter vinelandii DJ]
          Length = 415

 Score =  365 bits (936), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 188/416 (45%), Positives = 269/416 (64%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G+L AE V+L  +A    TP Y YS   IE+ Y  +++A  GM  +VC+A+K
Sbjct: 1   MEPFIYRDGTLFAEGVALSAIAARFGTPTYVYSRAHIEERYRAYADALAGMPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LG+G DIVS GEL R LAA     R+VFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLAVLNLLARLGAGFDIVSRGELERVLAAGGDPARVVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES+ EL+ L + A  LG KAP++ RVNPD++A TH  ISTG KE+KFGI I Q   
Sbjct: 121 CFNVESDVELERLQEVAAELGVKAPVSLRVNPDVDAQTHPYISTGLKENKFGIDIEQAEE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LP +++ G+D HIGSQ+  +  F      L  L  +L + G  I+H+D+GGGL
Sbjct: 181 VYARAAELPNLEVLGIDCHIGSQLTTLSPFLDTLDRLLLLVDRLAARGIVIRHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D +PP+  DY + + +        ++ EPGR +VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEQPPAPGDYIAAVRERIEGRALALVFEPGRSIVANAGVLLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F ++D AMND +RP LY A+ ++   V P G  +  + D+VGP+CETGDF+A +R++AL 
Sbjct: 300 FAVIDAAMNDLIRPALYQAWMDV-VPVTPHGGEVCSY-DLVGPVCETGDFLAKDRELALV 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+G + H+IR R T ++L   +S+
Sbjct: 358 E-GDLLAVRSAGAYGFVMSSNYNTRGRAAEVLVDGERMHLIRRRETIEDLYAGESL 412


>gi|297172094|gb|ADI23076.1| diaminopimelate decarboxylase [uncultured gamma proteobacterium
           HF0770_07M15]
          Length = 432

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 190/434 (43%), Positives = 269/434 (61%), Gaps = 19/434 (4%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y  G LH E VS+  LA    TP Y YS+  +  ++   SNA   +D ++C+A+K
Sbjct: 1   MHDFRYVNGQLHCEGVSIASLAKQHGTPLYVYSSKTLTDHFTKLSNALAPLDHLICFAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN  V++TLA LGSG D VS GE++RA+AA    ++ VF+GVGKT DEI  AL+ GIY
Sbjct: 61  SNSNLGVLRTLADLGSGFDTVSGGEIQRAIAAGGNPKKCVFAGVGKTADEIAFALRKGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE+EL+ +N+ A  L K APIA RVNP+++A THKKI+TG  E+KFGI I +I +
Sbjct: 121 CFNVESEAELERINRIAGKLKKIAPIAIRVNPNVDAKTHKKITTGTYENKFGIAIEKIPA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LYA  + L  +++ GV MHIGSQ+ Q++ F  A + +  L  +L++  H I+ I +GGGL
Sbjct: 181 LYARGAKLKHIRLRGVQMHIGSQLTQVKPFADAVRKIAPLAAKLKAK-HGIEFISIGGGL 239

Query: 241 GIAYHSDHRPPSSSD---------------YASLIHQYFGNLQCKIILEPGRFLVADVGI 285
           GI Y  D     ++D               YA+ +      L  K++LEPGRF+  + GI
Sbjct: 240 GIMYE-DALVSGNADWWKRKEAKNILTPAKYAATLVPLLQPLGLKVLLEPGRFISGNAGI 298

Query: 286 LVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPIC 345
           LVT+V  +K++  K F I+D AMND +RP  Y++YHEI  +         ++ D+VG IC
Sbjct: 299 LVTRVEYVKRTGKKYFAIVDAAMNDLLRPAFYESYHEIVPVKQSKAR--PVNTDVVGGIC 356

Query: 346 ETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRM 405
           ETGD    +R I     GDL+ I   GAYG V +GTYN+R L  E++V G +  I+R R 
Sbjct: 357 ETGDTFCKDRPIPRVAEGDLVAILSAGAYGFVMAGTYNTRPLPAEVLVKGKKSAIVRKRQ 416

Query: 406 TFQELIELDSIPAW 419
             +E+ E +++  W
Sbjct: 417 KVKEIWEDETVAPW 430


>gi|332969020|gb|EGK08060.1| diaminopimelate decarboxylase [Kingella kingae ATCC 23330]
          Length = 408

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 186/413 (45%), Positives = 259/413 (62%), Gaps = 10/413 (2%)

Query: 13  AENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLA 72
            ENVS E+LA+   TP Y YS  A+ + Y  +  AF+   +++CYA+KANSN ++I+  A
Sbjct: 4   CENVSFEQLANQFGTPLYVYSENALTQAYRAYEQAFESSKSLICYAIKANSNLSIIQHFA 63

Query: 73  HLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKT 132
            LGSG D VS GE+ R LAA   A +I+FSGVGK++ E++ AL +GI CFNVES  EL  
Sbjct: 64  KLGSGFDTVSGGEIARVLAAGGAANKIIFSGVGKSVAEMEFALNAGIKCFNVESLPELDR 123

Query: 133 LNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVK 192
           LN+ A  LGK AP++ R+NPD++A TH  ISTG KE+KFGI +      Y +AS+L  + 
Sbjct: 124 LNEVAARLGKIAPVSLRINPDVDAKTHPYISTGLKENKFGIAMADAERAYQHASSLQHLN 183

Query: 193 ISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPS 252
           + G+D HIGSQ+  +    +A + +  L  +L + G  +QHID+GGG+GI Y  D + P 
Sbjct: 184 VVGIDCHIGSQLTDLSPLVEACERMLLLVDKLAAQGIVLQHIDLGGGVGIVY-KDEQTPD 242

Query: 253 SSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFM 312
            ++YA  + +        ++LEPGR LV + G L+T+V  IK+  +K FVI+D AMND M
Sbjct: 243 LAEYAQAVQKLLAGRDLGLVLEPGRSLVGNAGTLLTRVEFIKQGEEKNFVIVDAAMNDLM 302

Query: 313 RPTLYDAYHEINYIVNPAGDRLH--IHADIVGPICETGDFIALNRKIALPRPGDLLYIEK 370
           RP LY AYH I      A D+    + AD+VGPICETGDF+A NR+I +   GD+L +  
Sbjct: 303 RPALYQAYHHI----ENASDKKQPAMFADVVGPICETGDFLAQNREI-VAEQGDVLLVRS 357

Query: 371 TGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWLQKT 423
            GAYGA  +  YN+R    E++V G    +IR R T  +L+ L+     LQ T
Sbjct: 358 AGAYGASMASNYNTRCRAVEVLVQGDNVRVIRQRETLDDLLRLEQ--TCLQNT 408


>gi|307257594|ref|ZP_07539354.1| Diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306863897|gb|EFM95820.1| Diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
          Length = 416

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 189/417 (45%), Positives = 272/417 (65%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y    L AE+VS+  + +   TP Y YS   +E+++  F  AF     ++C+A+K
Sbjct: 1   MNHFNYKNQQLFAEDVSVSDIINQHGTPAYIYSRATLERHWHAFDKAFGAHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN A++  +  LGSG DIVS+GEL R LAA     ++VFSGV K+  EI  AL+ GI 
Sbjct: 61  SNSNIALLNVMVRLGSGFDIVSQGELERVLAAGGEPSKVVFSGVAKSHSEIQRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ES +EL  +N+ A  LGK API+ RVNPD++A+TH  ISTG KE+KFG+ + Q   
Sbjct: 121 CFNIESIAELHRINEVAGQLGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVTQARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A TLP VKI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  + H+D+GGGL
Sbjct: 181 VYRLAKTLPNVKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGIELHHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y+ +  PP  ++YA +L+ +  G    +IILEPGR + A+ GILVTKV  +K + D+
Sbjct: 241 GVPYNGE-EPPHPTEYAKALLEKLKGYADLEIILEPGRAITANAGILVTKVEYLKANEDR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY+AY +I   V+ +  R     D+VGPICET DF+  +R++A+
Sbjct: 300 NFAIVDTGMNDMIRPALYEAYMQITE-VDQSLSREKAVYDVVGPICETSDFLGKDRELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            + GDL+ +   GAYGA  S TYNSR    EIMV+G Q ++I+ R +F +L  L+ +
Sbjct: 359 EQ-GDLIAMRSAGAYGAAMSSTYNSRPQAVEIMVDGDQAYLIKARASFADLWRLEKL 414


>gi|171910232|ref|ZP_02925702.1| diaminopimelate decarboxylase [Verrucomicrobium spinosum DSM 4136]
          Length = 433

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 189/427 (44%), Positives = 264/427 (61%), Gaps = 18/427 (4%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M +F+Y +G LH ENV LE L+    TP Y YS   I  +Y     A D +D ++CYA+K
Sbjct: 1   MHSFRYIQGRLHCENVDLESLSAKHGTPLYVYSKETITDHYKRLDGALDRLDHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN A+++T+A LG G DIVS GEL R + A   A +  F+GVGKT  EI+ ALQ GIY
Sbjct: 61  ANSNLAILQTIADLGGGFDIVSGGELYRVIQAGGRASQCTFAGVGKTRAEIEYALQQGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FN ESE+EL+ +N+ A +LGKKAP+A RVNP+++A THK ISTGK E+KFG+   +I  
Sbjct: 121 SFNAESEAELRQINEVAGTLGKKAPVALRVNPNVDAKTHKYISTGKSENKFGVDFDRILD 180

Query: 181 LY-AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            Y A A+    + I G+ MHIGSQ+  I+ F +A K +  L ++L+   H+I+   +GGG
Sbjct: 181 AYAAIATECEHLDIRGLQMHIGSQLTSIDPFVEAAKKVAPLVEKLKER-HHIKFFSIGGG 239

Query: 240 LGIAYHSD---------------HRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVG 284
           LGI Y                   RP +   YA  +      L+ +I+LEPGRF+V + G
Sbjct: 240 LGIVYRESLDSGDQTWWGEKEEAERPLTIQSYADALVPILEPLKLRILLEPGRFMVGNAG 299

Query: 285 ILVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPI 344
            L++KV+ +KK   K FVI+D  MND +RP LY+ +H+I  +    G  L    D+VGPI
Sbjct: 300 ALLSKVLYLKKGNAKKFVIVDAGMNDLIRPALYEGWHQITPLHKAEGAELE-KVDVVGPI 358

Query: 345 CETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPR 404
           CETGDF+A +R++   + GD L +   GAYG   +  YNSR L  EI+V+G++ H++R R
Sbjct: 359 CETGDFLAQDRELPPVQAGDTLAVLSAGAYGFTMASNYNSRPLAAEILVDGAEAHLVRER 418

Query: 405 MTFQELI 411
            T  +L+
Sbjct: 419 QTLDDLV 425


>gi|260774852|ref|ZP_05883754.1| diaminopimelate decarboxylase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609277|gb|EEX35432.1| diaminopimelate decarboxylase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 417

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 196/418 (46%), Positives = 262/418 (62%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE+V L  LA    TP Y YS    E+++  F  +      +VCYA+
Sbjct: 1   MDYFNYQDDGQLWAEDVPLTDLAEQFGTPLYVYSRATFERHWNAFDKSVGEHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA LGSG DIVS GEL R +AA   A ++VFSGVGKT  E+  AL+ GI
Sbjct: 61  KANSNLGVLNTLARLGSGFDIVSGGELERVIAAGGEASKVVFSGVGKTAPEMKRALELGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG KAPI+ R+NPD++ANTH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNKVAGELGVKAPISLRINPDVDANTHPYISTGLRDNKFGIAFDRAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           ++Y +A  L  + I G+D HIGSQ+  IE F  A   L  L   L++ G NI+H+DVGGG
Sbjct: 181 AVYQFAQGLKNLTIKGIDCHIGSQLTDIEPFIDATDRLLALIDDLKAQGINIEHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  S+YA  +     N Q  ++I EPGR + A+ G+L+TKV  +K +  
Sbjct: 241 LGVVYR-DELPPEPSEYAKALLGRLENHQDLELIFEPGRAIAANAGVLLTKVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I   VNP  +   +  D+VGPICETGDF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDI-VPVNPR-EGEPVTYDLVGPICETGDFLGKDRALV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L +  DLL +   GAYG V S  YN+R  + E+MV+G++ H++R R     L  L++I
Sbjct: 358 L-QENDLLAVRSAGAYGFVMSSNYNTRTRVAEVMVDGNKAHLVRQREELSSLWALENI 414


>gi|86160486|ref|YP_467271.1| diaminopimelate decarboxylase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85776997|gb|ABC83834.1| diaminopimelate decarboxylase [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 427

 Score =  364 bits (934), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 187/431 (43%), Positives = 256/431 (59%), Gaps = 9/431 (2%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F    G LHAE V +E+LA    TP Y YST  + +++     +  G+D +VCYA+K
Sbjct: 1   MNHFLRKRGVLHAEAVPVEQLAEAYGTPLYVYSTATLTRHWKVLHRSLAGLDHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+   A LGSG DIVS GEL R L A     ++VFSGVGK  DEI  AL+SG+ 
Sbjct: 61  ANSNLAVLSLFARLGSGFDIVSGGELYRVLKAGGHPGKVVFSGVGKRDDEIAFALESGVK 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
             NVES  EL  ++  A  +G +APIA RVNPD++  TH  ISTG  E+KFG+ + +   
Sbjct: 121 VLNVESAPELARVSIVARRMGVRAPIALRVNPDVDPKTHPYISTGLSENKFGVSVDEARR 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LYA A+  P +++ GV  HIGSQI  +  F  A   +  L + L   G  + H+DVGGGL
Sbjct: 181 LYALAAQDPALELRGVACHIGSQITTVRPFLDAIARVLALVKDLGKQGIRLGHVDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y +D  PP   +Y   I +       +++LEPGR LV + G+LVT+V+ +K+S  K 
Sbjct: 241 GITY-ADEEPPHPDEYGRAIKKALSRFDGEVMLEPGRVLVGNAGVLVTRVLHVKESGRKV 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FV++D AMND +RP+ YDA+HEI     P  D   I  D+VGPICE+ DF+A  R++  P
Sbjct: 300 FVVVDAAMNDLVRPSYYDAHHEIEPAGAPRKDAEEIVCDVVGPICESSDFLARKRRMPRP 359

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
             GDLL +   GAYG   S  YNSR    E++V+G    + R R T+ +L+         
Sbjct: 360 VRGDLLVVRSAGAYGFAMSSNYNSRPRAAEVLVDGDGARLARRRETYADLVR-------- 411

Query: 421 QKTPKQSSENY 431
            +TP+  +E +
Sbjct: 412 GETPEPEAERF 422


>gi|16272667|ref|NP_438885.1| diaminopimelate decarboxylase [Haemophilus influenzae Rd KW20]
 gi|260579819|ref|ZP_05847649.1| diaminopimelate decarboxylase [Haemophilus influenzae RdAW]
 gi|1169235|sp|P44316|DCDA_HAEIN RecName: Full=Diaminopimelate decarboxylase; Short=DAP
           decarboxylase
 gi|1573731|gb|AAC22385.1| diaminopimelate decarboxylase (lysA) [Haemophilus influenzae Rd
           KW20]
 gi|260093103|gb|EEW77036.1| diaminopimelate decarboxylase [Haemophilus influenzae RdAW]
          Length = 415

 Score =  364 bits (934), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 189/416 (45%), Positives = 271/416 (65%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L+AE++ +++LA    TP Y YS   +E+++  F +AF     ++C+A+K
Sbjct: 1   MNFFQYKHNKLYAEDMPVQQLAEQFGTPLYVYSRATLERHWHAFDSAFGNRPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN  V+  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+ +EI  AL+  I 
Sbjct: 61  SCSNIGVLNIMAKLGSGFDIVSQGELERVLAAGGDASKVVFSGVAKSREEIMRALEVRIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SELK +NQ A  +GK API+ RVNPD++A+TH  ISTG KE+KFG+ +++   
Sbjct: 121 CFNVESVSELKHINQIAGEMGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVNEARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  ASTLP +KI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYKLASTLPNIKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGITLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  SDYA+ + +   N  + +IILEPGR + A+ GILV KV  +K +  +
Sbjct: 241 GVTY-TDETPPHPSDYANALLEKLKNYPELEIILEPGRAISANAGILVAKVQYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I D  MND +RP LY+AY  I  I +   +R     D+VGP+CET DF+   R++++
Sbjct: 300 NFAITDTGMNDMIRPALYEAYMNIVEI-DRTLEREKAIYDVVGPVCETSDFLGKQRELSI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
              GD +     GAYGA  S  YNSR    E++V+G Q ++IR R T QEL  L+S
Sbjct: 359 AE-GDYIAQCSAGAYGASMSSNYNSRARTAEVLVDGDQSYLIRRRETLQELWALES 413


>gi|117918847|ref|YP_868039.1| diaminopimelate decarboxylase [Shewanella sp. ANA-3]
 gi|117611179|gb|ABK46633.1| diaminopimelate decarboxylase [Shewanella sp. ANA-3]
          Length = 414

 Score =  364 bits (934), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 187/412 (45%), Positives = 262/412 (63%), Gaps = 4/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y + +L+AE   +  LA    TP Y YS   +E+++  F+NA      +VCYA+K
Sbjct: 1   MDHFLYQDNTLYAEGCRVNDLAQQYGTPLYIYSRATLERHWHAFNNAVADHPHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R + A     ++VFSGVGKT+ E++ AL  GIY
Sbjct: 61  ANSNLAVLNVLARLGSGFDIVSGGELARVIEAGGDPAKVVFSGVGKTVAEMEQALNLGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN  A  LGK AP++ RVNPD++A TH  ISTG KE+KFGI + +   
Sbjct: 121 CFNVESSAELEQLNDVAGRLGKVAPVSLRVNPDVDAGTHPYISTGLKENKFGIAMDEAEV 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++A A  LP +++ GVD HIGSQ+ +I+ F  A   +  L  +L   G  I+H DVGGGL
Sbjct: 181 VFARAHALPHLQVKGVDCHIGSQLTEIQPFLDAMDRMLALIDRLADQGIVIEHFDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP    YA+ +    G+ + K+I EPGR + A+ GI VT+V+ +K+++DK 
Sbjct: 241 GVTY-DDETPPHPDVYAAALLARLGDRKLKLIFEPGRAIAANAGIFVTQVLYLKENSDKR 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+  I   VNP  ++  +  DIVGP+CETGDF+  +R +A+ 
Sbjct: 300 FAIVDGAMNDLIRPALYSAWQNI-IPVNPRDEQAQVF-DIVGPVCETGDFLGKDRALAIA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
             GDLL +  +GAYG   +  YN+R    E+MV+G + +++R R    +L +
Sbjct: 358 -AGDLLVVRSSGAYGFAMASNYNTRPRAAEVMVDGDKAYLVREREKLAQLWQ 408


>gi|229844596|ref|ZP_04464735.1| diaminopimelate decarboxylase [Haemophilus influenzae 6P18H1]
 gi|229812310|gb|EEP48000.1| diaminopimelate decarboxylase [Haemophilus influenzae 6P18H1]
          Length = 415

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 189/416 (45%), Positives = 270/416 (64%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L+AE++ +++LA    TP Y YS   +E+++  F +AF     ++C+A+K
Sbjct: 1   MNFFQYKHNKLYAEDIPVQQLAEQFGTPLYVYSRATLERHWHAFDSAFGKRPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN  V+  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+ +EI  AL+ GI 
Sbjct: 61  SCSNIGVLNIMAKLGSGFDIVSQGELERVLAAGGDASKVVFSGVAKSREEIMRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SELK +NQ A  +GK API+ RVNPD++A+TH  ISTG KE+KFG+ + +   
Sbjct: 121 CFNVESVSELKHINQIAGEMGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVDEARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  ASTLP +KI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYKLASTLPNIKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGITLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  SDYA+ + +   N  + +IILEPGR + A+ GILV KV  +K +  +
Sbjct: 241 GVTY-TDETPPHPSDYANALLEKLKNYPELEIILEPGRAISANAGILVAKVQYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I D  MND +RP LY+AY  I  I +   +R     D+VGP+CET DF+   R++++
Sbjct: 300 NFAITDTGMNDMIRPALYEAYMNIIEI-DRTLEREKAIYDVVGPVCETSDFLGKQRELSI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
              GD +      AYGA  S  YNSR    E++V+G Q ++IR R T QEL  L+S
Sbjct: 359 AE-GDYIAQCSAAAYGASMSSNYNSRARTAEVLVDGDQSYLIRRRETLQELWALES 413


>gi|260753687|ref|YP_003226580.1| diaminopimelate decarboxylase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258553050|gb|ACV75996.1| diaminopimelate decarboxylase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 421

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 189/424 (44%), Positives = 262/424 (61%), Gaps = 7/424 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGM---DTMVCY 57
           M  F    G+L  E++ L ++A    TP Y YS + + +    F+ A DG      +V +
Sbjct: 1   MIPFSLKNGTLCVEDIPLPEIAAQYGTPCYVYSHSYLTERARRFTKALDGAGKGKALVAF 60

Query: 58  ALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQS 117
           A+KAN +QA++ + A  G G D+VS GE+ RA+ A +P ERIVFSGVGKT +E+  AL+ 
Sbjct: 61  AVKANPSQAILASFAKEGLGADVVSAGEIHRAVHAGIPPERIVFSGVGKTAEEMRYALEI 120

Query: 118 GIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQ 177
           GI  FN+ES SE++ L + A SLGKKA +A R+NPD++ +TH KI+TGK + KFGI    
Sbjct: 121 GIGQFNIESVSEIEMLAEVATSLGKKAAVALRINPDVDPHTHAKIATGKADTKFGIAAED 180

Query: 178 IHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVG 237
             S Y   ++ P +KI G+  HIGSQI  +  F  A + + ++   L   GH I+  D+G
Sbjct: 181 ALSAYEKLASYPSLKIQGIASHIGSQITDLAPFEAAAERIYEIITALEKAGHTIETADLG 240

Query: 238 GGLGIAYHSDH-RPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKS 296
           GGLG+ Y  D   PPS   Y  +I +      C++I EPGR L+A+ GIL++KVI +K+S
Sbjct: 241 GGLGVRYKDDQPEPPSIEAYGEMIKRVTKGWNCRLIFEPGRSLIANAGILLSKVIRVKES 300

Query: 297 ADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRK 356
               FVILD AMND +RPTLYDAYHEI   V P+       ADIVGP+CETGD  A NR 
Sbjct: 301 KTARFVILDAAMNDLVRPTLYDAYHEIK-AVTPSVQAY--QADIVGPVCETGDIFAGNRS 357

Query: 357 IALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           I   +P DL+ I   GAYGA  +  YNSR L+ E+MV+G++  +IR R + ++L+  +  
Sbjct: 358 IPAVKPDDLVAIMSAGAYGATMASAYNSRPLVAEVMVSGNKSALIRKRQSVEDLMRDEQK 417

Query: 417 PAWL 420
             WL
Sbjct: 418 VEWL 421


>gi|319897770|ref|YP_004135967.1| diaminopimelate decarboxylase, plp-binding [Haemophilus influenzae
           F3031]
 gi|317433276|emb|CBY81651.1| diaminopimelate decarboxylase, PLP-binding [Haemophilus influenzae
           F3031]
          Length = 415

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 189/415 (45%), Positives = 270/415 (65%), Gaps = 4/415 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L+AE++ +++LA    TP Y YS   +E+++  F +AF     ++C+A+K
Sbjct: 1   MNFFQYKHNKLYAEDIPIQQLAEQFGTPLYVYSRATLERHWHAFDSAFGKRPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN  V+  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+ +EI  AL+ GI 
Sbjct: 61  SCSNIGVLNIMAKLGSGFDIVSQGELERVLAAGGDASKVVFSGVAKSREEIMRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SELK +NQ A  +GK API+ RVNPD++A+TH  ISTG KE+KFG+ +++   
Sbjct: 121 CFNVESVSELKHINQIAGEMGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVNEARK 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  ASTLP +KI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYNLASTLPNIKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGITLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  SDYA +L+ +     + +IILEPGR + A+ GILV KV  +K +  +
Sbjct: 241 GVTY-TDETPPHPSDYANALLEKLKDYPELEIILEPGRAISANAGILVAKVQYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I D  MND +RP LY+AY  I  I         I+ D+VGP+CET DF+   R++++
Sbjct: 300 NFAITDTGMNDMIRPALYEAYMNIVEIDRTLAREKAIY-DVVGPVCETSDFLGKQRELSI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELD 414
              GD +     GAYGA  S  YNSR    E++V+G Q ++IR R T QEL  L+
Sbjct: 359 AE-GDYIAQCSAGAYGASMSSNYNSRARTAEVLVDGDQSYLIRRRETLQELWALE 412


>gi|254230109|ref|ZP_04923505.1| diaminopimelate decarboxylase [Vibrio sp. Ex25]
 gi|262392884|ref|YP_003284738.1| diaminopimelate decarboxylase [Vibrio sp. Ex25]
 gi|151937354|gb|EDN56216.1| diaminopimelate decarboxylase [Vibrio sp. Ex25]
 gi|262336478|gb|ACY50273.1| diaminopimelate decarboxylase [Vibrio sp. Ex25]
          Length = 417

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 194/418 (46%), Positives = 261/418 (62%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE+V L+ LA    TP Y YS   +E+++  F +A      +VCYA+
Sbjct: 1   MDYFNYQDDGQLWAEDVPLQALAEQYGTPLYVYSRATLERHWKAFDSAVGQHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+  LA LGSG DIVS GEL R +AA    +++VFSGVGKT  E+  AL+ GI
Sbjct: 61  KANSNLGVLNALARLGSGFDIVSGGELERVIAAGGDPKKVVFSGVGKTPAEMKRALELGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG  API+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNKVAGELGVIAPISLRINPDVDAKTHPYISTGLRDNKFGIAFDRAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y +A +LP + + G+D HIGSQ+  I+ F  A   L  L   L++ G NI+H+DVGGG
Sbjct: 181 DVYKFAQSLPNLNVQGIDCHIGSQLTNIDPFIDATDRLLALIDDLKAQGINIRHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  SDYA  +     N Q  ++I EPGR + A+ GIL+T+V  +K +  
Sbjct: 241 LGVVYR-DELPPQPSDYAKALLGRLENHQDLELIFEPGRAIAANAGILLTRVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I   V+P       + D+VGPICETGDF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDI-VPVSPRTGEAQTY-DLVGPICETGDFLGKDRALV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L + GDLL +   GAYG V S  YN+R    E+MV+G Q H++R R     L +L+ I
Sbjct: 358 L-QEGDLLAVRSAGAYGFVMSSNYNTRTRAAEVMVDGKQSHLVRQREELTSLWQLEQI 414


>gi|323495294|ref|ZP_08100375.1| diaminopimelate decarboxylase [Vibrio brasiliensis LMG 20546]
 gi|323310471|gb|EGA63654.1| diaminopimelate decarboxylase [Vibrio brasiliensis LMG 20546]
          Length = 417

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 192/418 (45%), Positives = 261/418 (62%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE+V+L +LA    TP Y YS   +E+++  F  +      +VCYA+
Sbjct: 1   MDYFNYQDDGQLWAEDVALTELAQQFGTPLYVYSRATLERHWHAFDKSVGEHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+  LA LGSG DIVS GEL R +AA     ++VFSGVGKT  E+  AL+ GI
Sbjct: 61  KANSNLGVLNALARLGSGFDIVSGGELERVIAAGGEPSKVVFSGVGKTEAEMKRALELGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LGKKAPI+ R+NPD++ANTH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNKVAGELGKKAPISLRINPDVDANTHPYISTGLRDNKFGIAFERAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           ++Y +A +L  + + G+D HIGSQ+  IE F  A   L  L   L+S G  I+H+DVGGG
Sbjct: 181 AVYKFAQSLEHLDVRGIDCHIGSQLTDIEPFIDATDRLLALIDDLKSQGVTIEHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  SDYA  +     N Q  ++I EPGR + A+ G+L+TKV  +K +  
Sbjct: 241 LGVVYR-DELPPEPSDYAKALLGRLENHQDLELIFEPGRAIAANAGVLLTKVEFLKPTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I  +    G+   +  D+VGPICETGDF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDIVPVCPREGE--PVTYDLVGPICETGDFLGKDRALV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +    DLL +   GAYG V S  YN+R    E+MV+G+Q H++R R     L  L+++
Sbjct: 358 I-EENDLLAVRSAGAYGFVMSSNYNTRSRAAEVMVDGNQAHLVRQREELSSLWALENV 414


>gi|145630464|ref|ZP_01786244.1| diaminopimelate decarboxylase [Haemophilus influenzae R3021]
 gi|144983854|gb|EDJ91296.1| diaminopimelate decarboxylase [Haemophilus influenzae R3021]
          Length = 415

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 188/416 (45%), Positives = 271/416 (65%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L+AE++ +++LA    TP Y YS   +E+++  F +AF     ++C+A+K
Sbjct: 1   MNFFQYKNNKLYAEDIPVQQLAEQFDTPLYVYSRATLERHWHAFDSAFGKRPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN  V+  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+ +EI  AL+ GI 
Sbjct: 61  SCSNIGVLNIMAKLGSGFDIVSQGELERVLAAGGDASKVVFSGVAKSREEIMRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SELK +NQ A  +GK API+ RVNPD++A+TH  ISTG KE+KFG+ +++   
Sbjct: 121 CFNVESVSELKHINQIAGEMGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVNEARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  ASTLP +KI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYKLASTLPNIKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGITLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  SDYA+ + +   N  + +IILEPGR + A+ GILV KV  +K +  +
Sbjct: 241 GVTY-TDETPPHPSDYANALLEKLKNYPELEIILEPGRAISANAGILVAKVQYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I D  MND +RP LY+AY  I  I +   +R     D+VGP+CET DF+   R++++
Sbjct: 300 NFAITDTGMNDMIRPALYEAYMNIVEI-DRTLEREKAIYDVVGPVCETSDFLGKQRELSI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
              GD +     GAYGA  S  YNSR    E++V+  + ++IR R T QEL  L+S
Sbjct: 359 AE-GDYIAQCSAGAYGASMSSNYNSRARTAEVLVDRDKSYLIRRRETLQELWALES 413


>gi|332289594|ref|YP_004420446.1| bifunctional aspartate kinase/diaminopimelate decarboxylase protein
           [Gallibacterium anatis UMN179]
 gi|330432490|gb|AEC17549.1| bifunctional aspartate kinase/diaminopimelate decarboxylase protein
           [Gallibacterium anatis UMN179]
          Length = 417

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 190/411 (46%), Positives = 262/411 (63%), Gaps = 4/411 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L AE +S+++LA    TP Y YS   +E+++  F +A  G   ++C+A+K
Sbjct: 1   MDYFNYKNDQLMAEEISVKQLAQQFGTPLYVYSRATLERHWHAFDSALQGHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +N N A++  LA LGSG DIVS+GEL R LAA   A ++VFSGV K+  EI+ AL+ GI 
Sbjct: 61  SNPNIALLNLLAKLGSGFDIVSQGELERVLAAGGEANKVVFSGVAKSHTEIERALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE+EL  +NQ A  LGKKAPI+ RVNPD++A TH  ISTG K++KFG+ + +   
Sbjct: 121 CFNVESEAELLRINQVAEKLGKKAPISLRVNPDVDAKTHPYISTGLKKNKFGVSVERARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A TLP ++I G+D HIGSQ+ +++ F  +   L  L +QLR +G  +QH+D+GGGL
Sbjct: 181 VYRLAKTLPHIQIVGMDCHIGSQLTELQPFLDSADRLLVLLEQLRQDGIELQHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y SD  PP  ++YAS +   F    + +IILEPGR + A+ GILVTKV  +K + D 
Sbjct: 241 GVRY-SDETPPHPTEYASALLAKFKQYPELEIILEPGRAISANAGILVTKVEYLKSNEDF 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY AY EI    +   DR     D+VGPICET DF+   R +A+
Sbjct: 300 NFAIVDAGMNDMIRPALYQAYMEI-IEADRTLDRERKVYDVVGPICETSDFLGKGRSLAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
              GD +     GAYGA  +  YNS     E++V+G + H+I+ R  F+EL
Sbjct: 359 A-AGDFIVQRSAGAYGASMASNYNSHPRAAEVLVDGDKAHLIKRRERFEEL 408


>gi|153003227|ref|YP_001377552.1| diaminopimelate decarboxylase [Anaeromyxobacter sp. Fw109-5]
 gi|152026800|gb|ABS24568.1| diaminopimelate decarboxylase [Anaeromyxobacter sp. Fw109-5]
          Length = 422

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 178/412 (43%), Positives = 255/412 (61%), Gaps = 1/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+  +G LHAE + LE+LA    TP Y YST  + +++     +  G+  +VCYA+K
Sbjct: 1   MNHFQRKKGVLHAEAIPLERLAERYGTPLYVYSTATLTRHWKVLHRSLAGIRHVVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           AN+N A++   A LGSG DIVS GEL R L A     ++VFSGVGK  DEI  AL+SG+ 
Sbjct: 61  ANANLALLARFAKLGSGFDIVSAGELYRVLKAGGDPRKVVFSGVGKRDDEIAFALESGVR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
             NVES  EL  ++  A  +G +APIA RVNPD++  TH  ISTG +E+KFG+ + +   
Sbjct: 121 VLNVESAGELARISIVARRMGVRAPIALRVNPDVDPKTHPYISTGLRENKFGVSVDEARR 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LY  A+    + + G+  HIGSQI  ++ F  A   +  L ++L   G  + H+DVGGGL
Sbjct: 181 LYPLAAKDEALHVMGIASHIGSQITTVKPFLDAIDRVLSLARELEKQGIPLAHLDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  D  PP   +Y + I +     + +++LEPGR LV + G+LVT+V+ +K+S  KT
Sbjct: 241 GIRY-KDEDPPHPDEYGAAIRKALARWKGEVLLEPGRVLVGNAGVLVTRVLHVKRSGRKT 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FV++D AMND +RP +YDA+H+I  +  P      + AD+VGPICE+ DF+A  R++  P
Sbjct: 300 FVVVDAAMNDLVRPAIYDAHHDIEPVGPPREGEREVVADVVGPICESSDFLARKRRMPEP 359

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
            PGDLL +   GAYG   S  YN+R    E++V+G Q  + R R T+ +L+ 
Sbjct: 360 VPGDLLAVRSAGAYGFSMSSNYNARPRAAEVLVDGDQALLARRRETYADLVR 411


>gi|297539787|ref|YP_003675556.1| diaminopimelate decarboxylase [Methylotenera sp. 301]
 gi|297259134|gb|ADI30979.1| diaminopimelate decarboxylase [Methylotenera sp. 301]
          Length = 416

 Score =  363 bits (931), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 187/414 (45%), Positives = 255/414 (61%), Gaps = 2/414 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M++F     + H EN++L  +A    TP Y YS +A+ + + +FS  F   D +VC+A+K
Sbjct: 1   MNSFTLKNNTFHVENIALTSIADEFNTPCYVYSKSALTQAFESFSAGFKDCDHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           AN + A++   A LG+G DIVS GEL R LAA    ++IVFSGVGKT  E+  AL + I+
Sbjct: 61  ANPSLAILNLFAKLGAGFDIVSGGELARVLAAGGDPKKIVFSGVGKTEAEMQAALNADIF 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SEL+ LN  A  +GK API+ RVNP+++A TH  ISTG K +KFG+       
Sbjct: 121 CFNVESASELQRLNDVASFMGKVAPISLRVNPNVDAKTHPYISTGLKNNKFGVAYEDALD 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ +  + I GVD HIGSQI ++  F  AF  +  L   L  NG  IQHID GGG+
Sbjct: 181 IYLQAAKMSNIAIHGVDCHIGSQITELSPFLDAFDRVLALVDALAENGIVIQHIDAGGGI 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y SD  PP  + +A+ +    G+   K++ EPGR LV + G+L+TKV  +K +  K 
Sbjct: 241 GICY-SDETPPEFTVFATAMRAKLGSRNVKLVFEPGRALVGNAGVLLTKVEYLKHTESKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND MRP LYDAYH+I  +     D   +  +IVGP+CE+GDF+  +R +AL 
Sbjct: 300 FAIVDAAMNDLMRPALYDAYHDIKAVQPRQDDTEALTYEIVGPVCESGDFLGHDRTLALV 359

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELD 414
             GD+L I   GAYG   S  YN+R    E+MV+G Q H+IR R    +L  L+
Sbjct: 360 E-GDILAIMSAGAYGMSMSSNYNTRPRAAEVMVDGDQCHLIRKREQIADLFALE 412


>gi|261250031|ref|ZP_05942608.1| diaminopimelate decarboxylase [Vibrio orientalis CIP 102891]
 gi|260939535|gb|EEX95520.1| diaminopimelate decarboxylase [Vibrio orientalis CIP 102891]
          Length = 417

 Score =  363 bits (931), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 192/418 (45%), Positives = 261/418 (62%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE+VSL +LA    TP Y YS   +E+++  F  +      +VCYA+
Sbjct: 1   MDYFNYQDDGQLWAEDVSLTELAQQFGTPLYVYSRATLERHWNAFDKSVGEHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+  LA LGSG DIVS GEL R +AA   A ++VFSGVGKT  E+  AL+ GI
Sbjct: 61  KANSNLGVLNALARLGSGFDIVSGGELERVIAAGGDAAKVVFSGVGKTEAEMKRALELGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG KAPI+ R+NPD++ANTH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNKVAGELGVKAPISLRINPDVDANTHPYISTGLRDNKFGIAFDRAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           ++Y +A +L  + + G+D HIGSQ+  IE F  A   L  L   L++ G  I+H+DVGGG
Sbjct: 181 AVYKFAQSLDNLDVRGIDCHIGSQLTDIEPFIDATDRLLALIDDLKAQGVTIEHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  S+YA  +     N Q  ++I EPGR + A+ G+L+TKV  +K +  
Sbjct: 241 LGVVYR-DELPPQPSEYAKALLGRLENHQDLELIFEPGRAIAANAGVLLTKVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I  ++   G+   +  D+VGPICETGDF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDIVPVIPREGE--AVAYDLVGPICETGDFLGKDRALV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L    DLL +   GAYG V S  YN+R    E+MV+G Q H++R R     L  L+++
Sbjct: 358 L-EENDLLAVRSAGAYGFVMSSNYNTRSRAAEVMVDGKQAHLVRQREELSSLWALENV 414


>gi|237809856|ref|YP_002894296.1| diaminopimelate decarboxylase [Tolumonas auensis DSM 9187]
 gi|237502117|gb|ACQ94710.1| diaminopimelate decarboxylase [Tolumonas auensis DSM 9187]
          Length = 416

 Score =  363 bits (931), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 192/417 (46%), Positives = 264/417 (63%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y E G L AE  ++ +L     TP Y YS   IE+++  F  A   +  ++CYA+
Sbjct: 1   MDFFNYREDGELLAEQCAVSELVAQYGTPLYIYSRATIERHWKAFDAAAGDVPHLICYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KAN N A++  LA LGSG DIVS GEL R +AA   A+++VFSGVGKT +E+  AL   I
Sbjct: 61  KANGNLAILNLLARLGSGFDIVSGGELARVIAAGGDAKKVVFSGVGKTEEEMRYALGQDI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LNQ A S+GK A I+ R+NPDI+A TH  ISTG K++KFGIPI +  
Sbjct: 121 LCFNVESEPELERLNQVAGSMGKVARISIRINPDIDAGTHPYISTGLKQNKFGIPIERAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y YA++LP ++I+GVD HIGSQ+ +I  F +A   L  L  +L + G  I H+DVGGG
Sbjct: 181 EVYRYAASLPNLQITGVDCHIGSQLTEISPFLEAVDKLLALIDELSAAGIKIHHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           LG+ Y+ D  PP  S+YA  + Q   +    ++ EPGR ++A+ GIL TKV  +K   D+
Sbjct: 241 LGVNYN-DETPPHPSEYALALKQKLQDRDLTLMFEPGRAIMANAGILATKVEYLKAGEDR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D AMND +RP+LY A+  I   VN +  R   H D+VGPICETGDF+  +R++A+
Sbjct: 300 HFAIVDAAMNDLIRPSLYSAWMNI-IPVNRSLPRDAHHYDVVGPICETGDFLGKDRELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             PGD L +   GAYG   +  YN+R    E++V+G Q H++R R     L + + +
Sbjct: 359 A-PGDYLVVRSAGAYGFSMASNYNARSRAAEVLVDGEQPHLVREREPLASLWQFEHL 414


>gi|2499347|sp|O05321|DCDA_PSEFL RecName: Full=Diaminopimelate decarboxylase; Short=DAP
           decarboxylase
 gi|1929094|emb|CAA72943.1| LysA protein [Pseudomonas fluorescens]
          Length = 416

 Score =  363 bits (931), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 193/417 (46%), Positives = 260/417 (62%), Gaps = 5/417 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y  G L AE V+L  +A    TP Y YS   IE  Y TF++A +GM  +VC+A+K
Sbjct: 1   MDAFNYRGGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYRTFADALEGMPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   A++IVFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSGGELERVLAAGGSADKIVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKT-LNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
           CFN+ES  EL + L   A  LG +API+ RVNPD++A TH  ISTG KE+KFGI I    
Sbjct: 121 CFNIESTDELGSRLQIVAAELGVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIADAE 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y  A+ LP +++ GVD HIGSQ+  +E F  A   L  L  +L   G  ++HID+GGG
Sbjct: 181 DVYVRAAQLPNLEVLGVDCHIGSQLTTLEPFIDALDRLLALVDRLGDCGIYLRHIDLGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           +G+ Y  D  PP  +DY   + +        ++ EPGR++VA+ G+L+T+V  +K +  K
Sbjct: 241 VGVRYR-DEEPPLVADYIKAVRERLDGRDLALMFEPGRYIVANAGVLLTQVEYLKHTEHK 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D AMND +RP LY A+ ++   V P  D      DIVGPICETGDF+A  R++AL
Sbjct: 300 DFAIVDAAMNDLIRPALYQAWMDVT-AVRPR-DTAARSYDIVGPICETGDFLAKGRELAL 357

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GDLL +   GAYG V S  YN+R    E++V+G Q   +R R T  EL   +S+
Sbjct: 358 -EEGDLLAVHSAGAYGFVMSSNYNTRGRCAEVLVDGDQAFEVRRRETVAELFAGESL 413


>gi|74316244|ref|YP_313984.1| diaminopimelate decarboxylase [Thiobacillus denitrificans ATCC
           25259]
 gi|74055739|gb|AAZ96179.1| diaminopimelate decarboxylase [Thiobacillus denitrificans ATCC
           25259]
          Length = 414

 Score =  363 bits (931), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 186/412 (45%), Positives = 261/412 (63%), Gaps = 6/412 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+A    +G LH E V+L+ LA    TP Y YS  A+E  Y  +  AF     ++CYA+K
Sbjct: 1   MNAPHRIDGRLHLEGVALDTLAERCGTPLYVYSRAALEAAYRAYEEAFAATPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANS+ A++   A +G+G DIVS GEL R L+A     ++VFSGVGK +DE+  AL++GI 
Sbjct: 61  ANSSLALLNLFARMGAGFDIVSGGELARVLSAQGDPRKVVFSGVGKRVDEMRAALEAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SEL  LN+ A  LGK AP++FRVNPD++  TH  ISTG KE+KFG+PI +  +
Sbjct: 121 CFNVESTSELHRLNRVAGELGKVAPVSFRVNPDVDPKTHPYISTGLKENKFGVPIAEAPA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LY  A+ LP ++++G+D HIGSQ+  +     A   +  L   L + G  ++HID+GGG+
Sbjct: 181 LYRTAAALPHIRVTGIDCHIGSQLLDLSPLADAADRVFALVDALAAEGIALEHIDLGGGV 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI+Y  +   P  + Y  ++ + F   +  +I+EPGR LV + G+L+ +V  +K  ADK 
Sbjct: 241 GISYRGET-APDLAGYGRVLAERFAGRRETLIVEPGRSLVGNAGLLLARVEYLKLGADKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEI-NYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           F I+D AMND MRP LY+AYHEI   I  P   R +   D+VGPICETGDF+   R+++L
Sbjct: 300 FAIVDAAMNDLMRPALYEAYHEIVEVIARPLPKRRY---DVVGPICETGDFLGSARELSL 356

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELI 411
              GDL+ +  +GAYG   S  YNSR    EI+V+  + H+IR R T + L+
Sbjct: 357 DE-GDLVALLSSGAYGMSMSSNYNSRPRAAEILVDKKEIHLIRERETQEGLM 407


>gi|317050250|ref|YP_004111366.1| diaminopimelate decarboxylase [Desulfurispirillum indicum S5]
 gi|316945334|gb|ADU64810.1| diaminopimelate decarboxylase [Desulfurispirillum indicum S5]
          Length = 414

 Score =  362 bits (930), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 180/416 (43%), Positives = 262/416 (62%), Gaps = 3/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G LH E V L ++A  V TP Y YS   +E++   F+ AF  ++ M+C+A+K
Sbjct: 1   MDFFTYHNGELHCEEVPLSRIAQEVGTPVYVYSQRTLERHAQVFTQAFANLNAMICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN  +++ LA  G G DIVS GEL RAL A +P E+I+F+GVGK  DE++ AL   I+
Sbjct: 61  SNSNIHILRVLAEQGIGADIVSGGELYRALKAGIPREKILFAGVGKKADEMEYALSEDIF 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL  L   A  L K A +A RVNPD++A TH  ISTG KE+KFGIP+     
Sbjct: 121 MFNVESMEELDLLQATAKRLNKTASVALRVNPDVDARTHPYISTGLKENKFGIPMESALE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y YA +L  +++ G+  HIGSQ+  IE F  AF ++++L ++L S    I++ID+GGGL
Sbjct: 181 SYRYAHSLSCIRVRGIHCHIGSQLTAIEPFVDAFVIIKNLVRELLSENIPIEYIDMGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  + +PP  ++ A+ I  +   + C++ILEPGR +  + G  +T+V+  K +  + 
Sbjct: 241 GITYDQE-KPPLPTELAAAIAPHLKEVPCRLILEPGRAIAGNTGAFLTRVLFTKDNGSRK 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F+I+D AMND  RP+LY ++H+I   V   G+   +  DIVGP+CE+GDF A NR +   
Sbjct: 300 FLIVDGAMNDLARPSLYGSFHDIRPAVVREGNTEVV--DIVGPVCESGDFFAKNRPLPPC 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            PGD+L +   GAYG   S  YNSR    E++V+G ++ +IR R T+++L  L+ +
Sbjct: 358 HPGDILSLMSAGAYGFTMSSNYNSRPRAAEVLVSGDRYRVIRQRETYEDLTRLEEL 413


>gi|33594517|ref|NP_882161.1| diaminopimelate decarboxylase [Bordetella pertussis Tohama I]
 gi|33564593|emb|CAE43910.1| diaminopimelate decarboxylase [Bordetella pertussis Tohama I]
 gi|332383928|gb|AEE68775.1| diaminopimelate decarboxylase [Bordetella pertussis CS]
          Length = 429

 Score =  362 bits (930), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 186/418 (44%), Positives = 267/418 (63%), Gaps = 13/418 (3%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
           F+Y  G LHAE+V L+ LA  + TP Y YS  A+   + T+ +A      +VC+ +K NS
Sbjct: 16  FRYQNGVLHAEDVPLDSLAAQLGTPLYVYSRAALRSAWETYRDAIGERPVLVCFGMKTNS 75

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFN 123
           N AV+K  A LG+G DIVS GEL R LA      ++VFSGVGK   E+  AL++ + CFN
Sbjct: 76  NLAVLKEFARLGAGFDIVSGGELARVLAVGGDPAKVVFSGVGKQAWEMRAALEADVKCFN 135

Query: 124 VESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA 183
           VESE+EL+ L+  AVS+G++A ++ RVNPD++A TH  ISTG KE+KFGI I    + Y 
Sbjct: 136 VESEAELERLSDVAVSMGRRARVSLRVNPDVDAQTHPYISTGLKENKFGIAIESAPAAYR 195

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIA 243
            A+ LPGV++ GVD HIGSQ+  I  +  A + L DL +QL  NG  I+H+D+GGGLGI 
Sbjct: 196 LAARLPGVEVVGVDCHIGSQLTDISPYFDALEKLLDLIEQLAENGIAIKHLDLGGGLGIR 255

Query: 244 YHSDHRPPSSSDYASLIHQYFGNLQCK------IILEPGRFLVADVGILVTKVISIKKSA 297
           Y +D  PPS     +L+ + F  +  +      I+LEPGR L  + G+L+T V  +K + 
Sbjct: 256 Y-TDEIPPSPK---ALLDRVFERINARGLGHLHIVLEPGRSLAGNAGVLLTTVQYLKHAE 311

Query: 298 DKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKI 357
            + F I+D AMND +RP LY+AYH +   V P  D+  I  D+VGP+CE+ D++A  R +
Sbjct: 312 ARNFAIVDAAMNDLLRPALYEAYHGVQ-PVTPRADK-RIEYDVVGPVCESADWLARGRAL 369

Query: 358 ALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
           A+ + GD+L +E  GAY  V +  YN+R+   E+MV+G++ +I+R R T + L + +S
Sbjct: 370 AI-QAGDVLAVESAGAYSMVMASNYNTRVRAAEVMVDGNRHYIVRQRETLESLYQGES 426


>gi|301155478|emb|CBW14944.1| diaminopimelate decarboxylase, PLP-binding [Haemophilus
           parainfluenzae T3T1]
          Length = 416

 Score =  362 bits (930), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 189/417 (45%), Positives = 267/417 (64%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y    L+ E++ +++LA    TP Y YS   +E+++  F +A      ++CYA+K
Sbjct: 1   MDFFQYKNEQLYVEDLPVKQLAEEFGTPLYIYSRATLERHWHAFDSALGDHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  ++  +A LGSG DIVS+GEL R L A   A ++VFSGV K+  EI  AL+ GI 
Sbjct: 61  ANSNIGILNVMAKLGSGFDIVSQGELERVLEAGGEASKVVFSGVAKSRAEIMRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL  +NQ A  +GK API+ RVNPD++A+TH  ISTG KE+KFG+ + +   
Sbjct: 121 CFNVESVAELHHINQIAGEMGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVDEARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+TLP V+I+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYKLAATLPHVRITGMDCHIGSQLTELQPFLDATDRLIRLIEQLQEDGITLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDY-ASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  SDY A+L+++  G    +IILEPGR + A+ GILV KV  +K +  +
Sbjct: 241 GVTY-TDETPPHPSDYAAALLNKLKGYENLEIILEPGRAIAANAGILVAKVQYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I D  MND +RP LY+AY  I  I    G    I+ D+VGP+CET DF+   R++A+
Sbjct: 300 NFAITDTGMNDMIRPALYEAYMNIIEIDRTLGREKAIY-DVVGPVCETSDFLGKQRELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GD +     GAYGA  S  YNSR    E++V+G + H+IR R  F EL  L+SI
Sbjct: 359 AE-GDYIAQRSAGAYGASMSSNYNSRPRTAEVLVDGDKAHLIRRRENFSELWALESI 414


>gi|255320350|ref|ZP_05361534.1| diaminopimelate decarboxylase [Acinetobacter radioresistens SK82]
 gi|262379367|ref|ZP_06072523.1| diaminopimelate decarboxylase [Acinetobacter radioresistens SH164]
 gi|255302545|gb|EET81778.1| diaminopimelate decarboxylase [Acinetobacter radioresistens SK82]
 gi|262298824|gb|EEY86737.1| diaminopimelate decarboxylase [Acinetobacter radioresistens SH164]
          Length = 416

 Score =  362 bits (930), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 188/410 (45%), Positives = 257/410 (62%), Gaps = 3/410 (0%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           +F    G LHAE  SL++LA    TP Y YS  A EK+Y     AF+ +D  +C+A+K+N
Sbjct: 2   SFTRINGVLHAEQCSLKQLAQQFGTPLYVYSKQAFEKHYTDMDRAFNFIDHQICFAVKSN 61

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+  LA LG+G DIV+ GEL R LAA     ++VFSG+GKT  +I+ AL  GI CF
Sbjct: 62  SNLAVLGVLAKLGAGFDIVTGGELARVLAAGGDPAKVVFSGLGKTEIDIEKALNVGIACF 121

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES +EL  + + A  LG+KAP++ RVNPD++A TH  ISTG KE+KFGIP   +   Y
Sbjct: 122 NVESHAELDRIQKVAKKLGQKAPVSLRVNPDVDAKTHPYISTGLKENKFGIPSDSVFETY 181

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
            YA++LP + I G+D HIGSQ+ + + F  A + +  + +QL   G  ++HID+GGGLG+
Sbjct: 182 QYAASLPNLNIVGIDCHIGSQLTETKPFVDALERVMLMIEQLNELGIQLKHIDIGGGLGV 241

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y  D  PP+  +YA  +      L  K+ +EPGR + A+ GIL+T+V  +K +  + F 
Sbjct: 242 TY-KDEVPPTVQEYADALKPALQKLGLKVYMEPGRSISANAGILLTRVDLLKPTNHRNFA 300

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND +RP LY+A+ +I   V P  D      DIVG ICETGDF+   RK+AL   
Sbjct: 301 IIDAAMNDLIRPALYEAWMDIQ-PVEPHQDIQEKEWDIVGAICETGDFLGKERKLALAE- 358

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
            DLL +   GAYG V S  YN+R    E+MVN  Q +++R R T + L E
Sbjct: 359 NDLLAVLGAGAYGFVMSSNYNTRARAAEVMVNNHQAYLVRERETIESLWE 408


>gi|222054228|ref|YP_002536590.1| diaminopimelate decarboxylase [Geobacter sp. FRC-32]
 gi|221563517|gb|ACM19489.1| diaminopimelate decarboxylase [Geobacter sp. FRC-32]
          Length = 417

 Score =  362 bits (930), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 185/421 (43%), Positives = 270/421 (64%), Gaps = 5/421 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y    L+AE+V+++ +   + +PFY YS   +E+++     AF  +   +CY++K
Sbjct: 1   MHHFQYKGHDLYAEDVAIKDIVAKIGSPFYVYSQATLERHFRAMDEAFATVSHTICYSMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+K   +LG G+DIVS GEL RAL A     ++V+SGVGK  DEI+ AL +GI 
Sbjct: 61  ANSNLAVVKNFVNLGGGVDIVSGGELYRALKAGASPSKVVYSGVGKKDDEIEYALNTGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE EL  +++ A  +G+KA IA RVNPD++  TH  I+TG K  KFGI I +   
Sbjct: 121 MFNVESEQELTRISEIANRMGRKAGIAIRVNPDVDPQTHPYITTGLKNAKFGITIDRAIE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A  LPG++I G+D HIGSQ+ ++  F  A K L+++  +L+  G ++ + D+GGGL
Sbjct: 181 EYRRAKGLPGIEILGIDCHIGSQLTKVSPFVDAIKKLKNVIGKLKEMGISLTYFDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y+ D  PP  +DY S I +   +L   +I EPGR LV + GILV K + IK   +K 
Sbjct: 241 GIQYN-DEAPPLPADYGSEIIKETKDLGMHLIFEPGRNLVGNAGILVAKTLYIKHRDEKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIV-NPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           F+++D  MND  RP LY ++H I  +V N  G    I ADIVGPICE+GDF+A +R++ +
Sbjct: 300 FIVIDAGMNDLARPALYGSFHGIKPVVKNQDGT---ITADIVGPICESGDFLAKDREVPM 356

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + GDL+     GAYG   S +YNSR  + E+MV G++F +IR R T ++L++ + +P++
Sbjct: 357 FKQGDLMAFMSAGAYGFAMSSSYNSRPRVAEVMVKGNKFEVIRERETVEDLMKGEKVPSF 416

Query: 420 L 420
           L
Sbjct: 417 L 417


>gi|262369521|ref|ZP_06062849.1| diaminopimelate decarboxylase [Acinetobacter johnsonii SH046]
 gi|262315589|gb|EEY96628.1| diaminopimelate decarboxylase [Acinetobacter johnsonii SH046]
          Length = 416

 Score =  362 bits (930), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 188/410 (45%), Positives = 257/410 (62%), Gaps = 3/410 (0%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           +F    G LHAE  SL++LA    TP Y YS    EK++     AFD +D  +C+A+K+N
Sbjct: 2   SFTRNHGVLHAEQCSLQQLAQQFGTPLYVYSKATFEKHFTEMDRAFDFIDHQICFAVKSN 61

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+  LA LG+G DIV+ GEL R L A   A +IVFSG+GKT  ++  AL+ GI CF
Sbjct: 62  SNIAVLNVLAKLGAGFDIVTGGELARVLKAGGDASKIVFSGLGKTEIDVQKALEVGIACF 121

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES +EL  + + A  LGKKAPI+ RVNPD++A TH  ISTG KE+KFGIP   +   Y
Sbjct: 122 NVESHAELDRIQKVAAKLGKKAPISLRVNPDVDAKTHPYISTGLKENKFGIPSDTVFETY 181

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
            YA+TLP + I G+D HIGSQ+ + + F  A   +  +  QL++ G  ++HID+GGGLG+
Sbjct: 182 QYAATLPNLDIIGIDCHIGSQLTETQPFVDALDRVIVMIDQLKTMGIQLKHIDIGGGLGV 241

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y  D  PP+  +YA+ +      L  K+ +EPGR + A+ G+L+TKV  +K +  + F 
Sbjct: 242 TY-KDEVPPTVFEYANAMKPALEKLGLKVYMEPGRSISANAGVLLTKVDLLKPTIHRNFA 300

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND +RP LY+A+ +I   V P  D      D+VG ICETGDF+   R +AL + 
Sbjct: 301 IIDAAMNDLIRPALYEAWMDIQP-VTPRSDVEAKEWDVVGAICETGDFLGKERLLAL-KE 358

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
            D+L +   GAYG V S  YNSR    E+MV+G   H+IR R T + L +
Sbjct: 359 NDVLAVLGAGAYGFVMSSNYNSRGRAAEVMVDGENAHLIRERETIESLWD 408


>gi|209693748|ref|YP_002261676.1| diaminopimelate decarboxylase [Aliivibrio salmonicida LFI1238]
 gi|208007699|emb|CAQ77810.1| diaminopimelate decarboxylase [Aliivibrio salmonicida LFI1238]
          Length = 417

 Score =  362 bits (930), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 194/418 (46%), Positives = 258/418 (61%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE   + +LA    TP Y YS   +E+++  F ++      +VCYA+
Sbjct: 1   MDYFNYKDDGQLWAEERPITQLAEQYGTPLYVYSRATLERHWNAFDSSVGEQPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+  LA LGSG DIVS+GEL R +AA     ++VFSGVGKT  E+  AL+  I
Sbjct: 61  KANSNIGVLNALACLGSGFDIVSQGELERVVAAGGDPTKVVFSGVGKTAKEMRRALELNI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN  A  +G  API+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNAVAEEMGVIAPISLRINPDVDAKTHPYISTGLRDNKFGIAFDRAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y +A TLP + I G+D HIGSQ+  I  F  A   L  L   L++ G NI+H+DVGGG
Sbjct: 181 EVYKFAQTLPNLNIQGIDCHIGSQLTDITPFIDATDRLLALIDDLKAQGVNIRHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYAS-LIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  S+YA+ L+ +  G    ++I EPGR + A+ GILVTKV  +K +  
Sbjct: 241 LGVVYR-DELPPQPSEYATALLSRLTGREDLELIFEPGRAIAANAGILVTKVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I  +V   G+      D+VGPICETGDF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDIVPVVPREGEAQSY--DLVGPICETGDFLGKDRDLV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L    DLL +  +GAYG V S  YN+R    EIMV+G Q H++R R     L EL+SI
Sbjct: 358 L-EANDLLAVRSSGAYGFVMSSNYNTRTRAAEIMVDGDQVHLVRKREELSSLWELESI 414


>gi|187476584|ref|YP_784608.1| diaminopimelate decarboxylase [Bordetella avium 197N]
 gi|115421170|emb|CAJ47654.1| diaminopimelate decarboxylase [Bordetella avium 197N]
          Length = 429

 Score =  362 bits (930), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 188/419 (44%), Positives = 271/419 (64%), Gaps = 15/419 (3%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
           F Y  G LHAE+V+L+ LA  + TP Y YS  A+   Y ++  A      +VCY +KANS
Sbjct: 16  FHYKHGVLHAEDVALDILAAKLGTPLYVYSRAALRAAYDSYRLAIGERPVLVCYGMKANS 75

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFN 123
           N AV+K  A +G+G DIVS GEL+R LA      +IVFSGVGK   E+  AL++G+ CFN
Sbjct: 76  NLAVLKEFARMGAGFDIVSGGELKRVLAVGGDPAKIVFSGVGKQAWEMREALEAGVKCFN 135

Query: 124 VESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA 183
           VES +EL  L++ A + GK A ++ RVNPD++A TH  ISTG KE+KFGI I +  + Y 
Sbjct: 136 VESTAELHRLSKVAQATGKVARVSLRVNPDVDAQTHPYISTGLKENKFGIAIEEALAAYQ 195

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIA 243
            A++LPG+++ GVD HIGSQ+  I  +  A   L DL  ++   G  I+H+D+GGGLGI 
Sbjct: 196 TAASLPGLQVVGVDCHIGSQLTDISPYFDALDKLLDLIDRMAETGIRIEHLDLGGGLGIR 255

Query: 244 YHSDHRPPSSSDYASLIHQYFGNLQCK------IILEPGRFLVADVGILVTKVISIKKSA 297
           Y +D  PPS     +L+ + F  LQ +      ++LEPGR LV + G+L+T V  +K + 
Sbjct: 256 Y-TDEVPPSPK---ALLDEVFNRLQARGYGHLHLVLEPGRSLVGNAGLLLTTVQFLKHND 311

Query: 298 DKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGD-RLHIHADIVGPICETGDFIALNRK 356
            + F I+D AMND +RPTLY AYH +  +V  AG+ R++   D+VGP+CE+GD++A  R 
Sbjct: 312 ARNFAIVDAAMNDLLRPTLYQAYHGVRPVVPRAGEARVY---DVVGPVCESGDWLAKERA 368

Query: 357 IALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
           +A+ +  D+L +E  GAYG V +G YN+R    E+MV+G+Q+H++R R +  +L+  +S
Sbjct: 369 LAIEQD-DVLALESAGAYGMVMAGNYNTRARAAEVMVDGAQYHVVRQRESLDDLLRGES 426


>gi|114319371|ref|YP_741054.1| diaminopimelate decarboxylase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114225765|gb|ABI55564.1| diaminopimelate decarboxylase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 415

 Score =  362 bits (929), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 187/410 (45%), Positives = 253/410 (61%), Gaps = 3/410 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF   +G L AE V LE +A  V TP Y YS  AIE  +  F  A       VCYA+K
Sbjct: 1   MQAFTLQDGRLCAEAVPLEDIAEQVGTPTYVYSKAAIESAWRGFDQALGDHPHQVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV++ LA LGSG DIVS GEL R LAA     R+VFSGVGKT DE+  AL+ GI 
Sbjct: 61  ANSNLAVLQLLARLGSGFDIVSGGELERVLAAGGDPRRVVFSGVGKTADEMRRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL  LN+ A  L   AP++ RVNPD++A TH  ISTG +E+KFGI I +  +
Sbjct: 121 CFNVESTAELSRLNRVAGELRLTAPVSLRVNPDVDARTHPYISTGLRENKFGIDIREAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+    + + GVD HIGSQ+  +     A + +  L  +L + G  I+H+DVGGGL
Sbjct: 181 IYRQAANAAHLSVEGVDFHIGSQLTDLSPIADALERVLALVDRLAAEGITIRHLDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  D  PP++ DYA ++         ++++EPGR +V + G+L+T+V  +K  +++ 
Sbjct: 241 GIRYR-DETPPAAEDYARVLLDGLQGRDLELLMEPGRAVVGNAGVLITRVQYLKDGSEQR 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F ++D AMND +RP+LYD +H I   V P  D   +  DIVGP+CETGDF+   R++AL 
Sbjct: 300 FAVVDAAMNDLLRPSLYDGWHAITP-VRPRADTDTLPWDIVGPVCETGDFLGKQRELALA 358

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
             GDLL +   GAYG V +  YN+R    E++V G   H++R R   + L
Sbjct: 359 E-GDLLAVHSAGAYGFVMASNYNTRPRPAEVLVAGGCHHLVREREPLRAL 407


>gi|261867422|ref|YP_003255344.1| diaminopimelate decarboxylase [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412754|gb|ACX82125.1| diaminopimelate decarboxylase [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 416

 Score =  362 bits (929), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 188/417 (45%), Positives = 262/417 (62%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y    L  EN+ +++LA    TP Y YS  A+E ++  F NAF     +VC+A+K
Sbjct: 1   MDFFQYQYDRLMVENLPVKQLAEEFGTPLYVYSKAALEHHWYAFENAFGNHPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +N N A++  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+  EI  AL+ GI 
Sbjct: 61  SNPNIAILNIMARLGSGFDIVSQGELERVLAAGGEAHKVVFSGVAKSRREIARALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ESE+EL  +NQ A  +GK API+ RVNPD++A+TH  ISTG KE+KFG+ + Q   
Sbjct: 121 CFNIESEAELLRINQVAGDIGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVEQARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+TLP ++I G+D HIGSQ+ +++ F  A   L  L +QL+ +   ++H+D+GGGL
Sbjct: 181 VYKLATTLPNIEIVGMDCHIGSQLTELQPFLDAADRLIMLMEQLKQDSIQLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  ++YA  + +      + +II+EPGR + A+ GILVTKV  +K +  +
Sbjct: 241 GVTY-TDETPPHPTEYAKALWEKLSAFNELEIIVEPGRAITANAGILVTKVEYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY AY  I  I         I+ D+VGPICET DF+   RK+A+
Sbjct: 300 NFAIVDAGMNDMIRPALYQAYMNILEIDRTLAREEKIY-DVVGPICETSDFLGKQRKLAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GD L     GAYGA  S  YNSR    E+MV+G   ++IR R    EL  L+S+
Sbjct: 359 AE-GDYLAQRSAGAYGASMSSNYNSRPRTAEVMVDGDNAYLIRRREALNELWRLESL 414


>gi|27364546|ref|NP_760074.1| diaminopimelate decarboxylase [Vibrio vulnificus CMCP6]
 gi|320154948|ref|YP_004187327.1| diaminopimelate decarboxylase [Vibrio vulnificus MO6-24/O]
 gi|27360665|gb|AAO09601.1| diaminopimelate decarboxylase [Vibrio vulnificus CMCP6]
 gi|319930260|gb|ADV85124.1| diaminopimelate decarboxylase [Vibrio vulnificus MO6-24/O]
          Length = 417

 Score =  362 bits (929), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 193/418 (46%), Positives = 261/418 (62%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE VSL  LA    TP Y YS   +E+++  F  + +G   +VCYA+
Sbjct: 1   MDYFNYQDDGQLWAEEVSLTSLAEQYGTPLYVYSRATLERHWHAFDRSVEGHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA LGSG DIVS GEL R LAA     ++VFSGVGKT  E+  AL+  I
Sbjct: 61  KANSNLGVLNTLARLGSGFDIVSGGELERVLAAGGDPRKVVFSGVGKTEAEMRRALELNI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG KAPI+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNRVAGELGVKAPISLRINPDVDAQTHPYISTGLRDNKFGIAFDRAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           ++Y +A +L  + + G+D HIGSQ+  IE F  A   L  L   L+  G NI+H+DVGGG
Sbjct: 181 AVYQFAQSLANLNVQGIDCHIGSQLTAIEPFIDATDRLLALIDDLKEQGINIRHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y ++  PP  S+YA  +     N Q  ++I EPGR + A+ G+L+TKV  +K +  
Sbjct: 241 LGVVYRNE-LPPQPSEYAKALLGRLENHQDLELIFEPGRAIAANAGVLLTKVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I  +    G+   +  D+VGPICETGDF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDIVPVQPRQGE--AVTYDLVGPICETGDFLGKDRSLV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L    DLL +   GAYG V S  YN+R+   E+MV+G Q +++R R   + L EL+ I
Sbjct: 358 LAE-NDLLAVRSAGAYGFVMSSNYNTRVRAAEVMVDGKQHYLVRQREELRSLWELEHI 414


>gi|289207307|ref|YP_003459373.1| diaminopimelate decarboxylase [Thioalkalivibrio sp. K90mix]
 gi|288942938|gb|ADC70637.1| diaminopimelate decarboxylase [Thioalkalivibrio sp. K90mix]
          Length = 434

 Score =  362 bits (929), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 188/416 (45%), Positives = 256/416 (61%), Gaps = 3/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y   +LHAE V+L+ LA +V TP Y YS   +E++Y  FS A  G    VC+A+K
Sbjct: 1   MDYFDYHGNTLHAEGVALDHLAQLVGTPAYVYSRATLERHYRAFSEALIGTPHQVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANS   V+  LA LG+G DIVS GEL R L A     ++VFSGVGKT  E+  AL+ GI+
Sbjct: 61  ANSALGVLNVLARLGAGFDIVSGGELERVLRAGGDPAKVVFSGVGKTAAEMRRALKVGIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L   A  +G  AP++ RVNPD++A TH  I+TG +E+KFG+ I +  +
Sbjct: 121 CFNVESAPELERLESIAAEMGVTAPVSIRVNPDVDAETHPYIATGLRENKFGVAIEEAPA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LYA       ++ +GVD HIGSQ+ +I+ F  A K +  L  QL ++G  ++HIDVGGGL
Sbjct: 181 LYARVRDSQHLEATGVDFHIGSQLTRIDPFTDALKRVLTLVDQLAADGIELEHIDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP    +AS + +  G    K++LEPGR + A+ G+ +T+V  +K +    
Sbjct: 241 GVRYR-DETPPEPDAWASALRKVMGERSLKVLLEPGRAIAANAGVFLTRVEYLKHTEAHD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ EI  +V         + DIVGP+CETGDF+   R++AL 
Sbjct: 300 FAIVDGAMNDLLRPALYGAWQEIIPVVQRRETAARTY-DIVGPVCETGDFLGRERELALA 358

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GD+L +   GAYG V +G YNSR   PEIMV+G  F II  R     L+  +S+
Sbjct: 359 -AGDVLAVRSAGAYGYVMAGNYNSRPRPPEIMVDGDHFQIINRREQVDHLMMRESM 413


>gi|332187942|ref|ZP_08389675.1| diaminopimelate decarboxylase [Sphingomonas sp. S17]
 gi|332012103|gb|EGI54175.1| diaminopimelate decarboxylase [Sphingomonas sp. S17]
          Length = 420

 Score =  362 bits (929), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 177/423 (41%), Positives = 257/423 (60%), Gaps = 4/423 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTM-VCYAL 59
           M  F +  G LH E+V + ++A  V TP Y YS +   ++   F      +  + + YA+
Sbjct: 1   MDHFHFSNGELHVEDVPVARIAAEVGTPVYIYSASTFRRHAQVFREGLSALPRVHLAYAI 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KAN N AV++ LA  G G D+VS GE+RRALAA + AE IVFSGVGKT  E+  AL++GI
Sbjct: 61  KANPNLAVLRVLADEGYGADVVSVGEMRRALAAGMKAEDIVFSGVGKTRAELIAALEAGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
             FN+E E E   L + A   G  AP   RVNPD++A TH KISTG+KE+KFG+PI Q  
Sbjct: 121 GQFNLELEEEGAVLAELAHERGLVAPATLRVNPDVDAGTHAKISTGRKENKFGVPIDQAL 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            ++   + LPG+ + GV  HIGSQ+  +     A+K + +L  +LR  GH +  +D+GGG
Sbjct: 181 GMFDRLAGLPGIDLKGVACHIGSQLGDLAPLEAAYKRVGELVAELRGAGHRVTRVDLGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           LG+ Y      P+ + Y  ++ +   +   +++ EPGR +  + G+L T+V+ +K     
Sbjct: 241 LGVPYKPGDVMPAPAAYGEMVARVTKDWDVELMFEPGRVIAGNAGVLATEVVWVKPGVAN 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            +VI+D AMND  RP LYDAYH+    V P G+ +   A+I GP+CETGD  A+NR+I +
Sbjct: 301 PYVIVDAAMNDLARPALYDAYHDF-VAVKPTGETM--MANIAGPVCETGDTFAMNREIDV 357

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + GDL      GAYGA  + TYNSR L+PE+MV G +F ++  R+  + +I  + +P W
Sbjct: 358 VKSGDLAVFRTAGAYGATMASTYNSRPLVPEVMVEGDRFAVVADRIAAETIIAAERVPEW 417

Query: 420 LQK 422
           L+K
Sbjct: 418 LKK 420


>gi|307262007|ref|ZP_07543662.1| Diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306868290|gb|EFN00112.1| Diaminopimelate decarboxylase [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 416

 Score =  362 bits (928), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 188/417 (45%), Positives = 271/417 (64%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y    L AE+VS+  + +   TP Y YS   +E+++  F  AF     ++C+A+K
Sbjct: 1   MNHFNYKNQQLFAEDVSVSDIINQHGTPAYIYSRATLERHWHAFDKAFGAHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN A++  +  LGSG DIVS+GEL R LAA     ++VFSGV K+  EI  AL+ GI 
Sbjct: 61  SNSNIALLNVMVRLGSGFDIVSQGELERVLAAGGEPSKVVFSGVAKSHSEIQRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ES +EL  +N+ A   GK API+ RVNPD++A+TH  ISTG KE+KFG+ + Q   
Sbjct: 121 CFNIESIAELHRINEVAGQSGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVTQARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A TLP VKI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  + H+D+GGGL
Sbjct: 181 VYRLAKTLPNVKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGIELHHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y+ +  PP  ++YA +L+ +  G    +IILEPGR + A+ GILVTKV  +K + D+
Sbjct: 241 GVPYNGE-EPPHPTEYAKALLEKLKGYADLEIILEPGRAITANAGILVTKVEYLKANEDR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY+AY +I   V+ +  R     D+VGPICET DF+  +R++A+
Sbjct: 300 NFAIVDTGMNDMIRPALYEAYMQITE-VDQSLSREKAVYDVVGPICETSDFLGKDRELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            + GDL+ +   GAYGA  S TYNSR    EIMV+G Q ++I+ R +F +L  L+ +
Sbjct: 359 EQ-GDLIAMRSAGAYGAAMSSTYNSRPQAVEIMVDGDQAYLIKARASFADLWRLEKL 414


>gi|301169445|emb|CBW29045.1| diaminopimelate decarboxylase, PLP-binding [Haemophilus influenzae
           10810]
          Length = 415

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 188/416 (45%), Positives = 271/416 (65%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L+AE++ +++LA    TP Y YS   +E+++  F +AF     ++C+A+K
Sbjct: 1   MNFFQYKHNKLYAEDMPVQQLAEQFGTPLYVYSRATLERHWHAFDSAFGKHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN  V+  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+ +EI  AL+ GI 
Sbjct: 61  SCSNIGVLNIMAKLGSGFDIVSQGELERVLAAGGDASKVVFSGVAKSREEIMRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SELK +NQ A  +GK API+ RVNPD++A+TH  ISTG KE+KFG+ +++   
Sbjct: 121 CFNVESVSELKHINQIAGEMGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVNEARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  ASTLP +KI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYKLASTLPNIKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGITLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  SDYA+ + +   N  + +IILEPGR + A+ GILV KV  +K +  +
Sbjct: 241 GVTY-TDETPPHPSDYANALLEKLKNYPELEIILEPGRAISANAGILVAKVQYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I D  MND +RP LY+AY  I  I +   +R     D+VGP+CET DF+   R++++
Sbjct: 300 NFAITDTGMNDMIRPALYEAYMNIVEI-DRTLEREKAIYDVVGPVCETSDFLGKQRELSI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
              GD +     GAYGA  S  YNSR    E++V+  + ++IR R T QEL  L+S
Sbjct: 359 AE-GDYIAQCSAGAYGASMSSNYNSRARTAEVLVDRDKSYLIRRRETLQELWALES 413


>gi|311109535|ref|YP_003982388.1| diaminopimelate decarboxylase [Achromobacter xylosoxidans A8]
 gi|310764224|gb|ADP19673.1| diaminopimelate decarboxylase 2 [Achromobacter xylosoxidans A8]
          Length = 430

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 190/417 (45%), Positives = 267/417 (64%), Gaps = 11/417 (2%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
           F++    L+AE+V L+ LA  + TP Y YS  A++  + ++ NA      +VCY +KANS
Sbjct: 17  FQFRNNVLYAEDVPLDHLAEKLGTPLYVYSRAALKAAWESYRNAVGQHPVLVCYGMKANS 76

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFN 123
           N AV+K  A LG+G DIVS GEL+RALAA     RIVFSGVGK   E+  AL + + CFN
Sbjct: 77  NLAVLKEFARLGAGFDIVSGGELKRALAAGADPSRIVFSGVGKQAWEMRAALAAQVKCFN 136

Query: 124 VESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA 183
           VESE+EL+ L++ A  +G +AP++ RVNPD++A TH  ISTG KE+KFGI I     +Y 
Sbjct: 137 VESEAELRRLSEVAHGMGLRAPVSLRVNPDVDAQTHPYISTGLKENKFGIAIESALDVYR 196

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIA 243
            A +LPG+ I GVD HIGSQ+  I  +  A + L DL ++L   G  I H+D+GGGLGI 
Sbjct: 197 SAQSLPGLDIVGVDCHIGSQLTDISPYFDALEKLLDLIEKLDQAGIRIAHLDLGGGLGIR 256

Query: 244 YHSDHRPPS-----SSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           Y +D  PPS        +  L  + FG+LQ  ++LEPGR LV + G+L+T+V  +K S  
Sbjct: 257 Y-TDEIPPSPQVLLDRVFERLNARGFGHLQ--LVLEPGRSLVGNAGVLLTRVQYLKHSEA 313

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           + F I+D AMND +RP LY+A+H +  +   AGD      DIVGP+CE+ D++A  RK+A
Sbjct: 314 RNFAIVDAAMNDLLRPALYEAFHGVRPVHPRAGDATLY--DIVGPVCESADWLAKQRKLA 371

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
           + + GDLL +E TGAY    +  YN+R    E MV+G +++++R R T  +L+  +S
Sbjct: 372 IEQ-GDLLAVESTGAYSMAMASNYNARPRAAEAMVDGDKYYVVRQRETLDDLLRGES 427


>gi|296284457|ref|ZP_06862455.1| diaminopimelate decarboxylase [Citromicrobium bathyomarinum JL354]
          Length = 419

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 174/421 (41%), Positives = 258/421 (61%), Gaps = 4/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDT-MVCYAL 59
           M  FK  +G LHAE+V L  +A  V TP Y YS   +E++   F      +D  ++ +A+
Sbjct: 1   MDHFKLTDGILHAEDVPLPTIAQEVGTPVYVYSRATLERHARVFREGLGELDNPLILFAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KAN N AV++ L   G G D+VS GELRRALAA +  ++IVFSGVGKT  E++L L +GI
Sbjct: 61  KANPNLAVLRVLQREGFGADVVSGGELRRALAAGMTPDKIVFSGVGKTRAELELGLDTGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
             FN+ES  E + L + A + G+KA  A R+NPD++A TH+KISTGK ++KFG+P+H   
Sbjct: 121 AQFNIESREEGRELAELAAARGEKARCALRINPDVDAGTHEKISTGKADNKFGVPLHHAA 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
             +A    LPG+ + G+ +HIGSQ+  +     AF  +  L  QLR  GH I  +D+GGG
Sbjct: 181 EAFAELGALPGLALEGLAIHIGSQLADLAPLETAFGKIGTLLGQLREAGHTITRVDLGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           LG+ Y +    PS +DY +++ +   +   +++ EPGR +  + G+L+T+V+ +K+  + 
Sbjct: 241 LGVPYRTGESFPSPADYGAMVARVTRDWGVQLVFEPGRVIAGNAGVLLTRVVRVKRGLNN 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND  RP LY A+H+   +   A     + A+IVGPICETGD  A NR    
Sbjct: 301 PFVIVDAAMNDLARPALYGAWHDFEPV---AQTEERMTANIVGPICETGDTFATNRDCPA 357

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL      GAYGA  + +YNSR  +PE++V+GS + ++  R+    +++ + +P W
Sbjct: 358 LVAGDLAVFRTAGAYGATMASSYNSRGFVPEVLVSGSDYAVVADRIDAGAIMDAERVPEW 417

Query: 420 L 420
           L
Sbjct: 418 L 418


>gi|167625818|ref|YP_001676112.1| diaminopimelate decarboxylase [Shewanella halifaxensis HAW-EB4]
 gi|167355840|gb|ABZ78453.1| diaminopimelate decarboxylase [Shewanella halifaxensis HAW-EB4]
          Length = 414

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 184/416 (44%), Positives = 266/416 (63%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L+AE   + +LA    TP Y YS   +E+++  F NA      ++CYA+K
Sbjct: 1   MDHFLYQADELYAEQCQVAELAKQHGTPLYIYSRATLERHWHAFDNAVSDHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R + A     ++VFSGVGKT++E+++AL  GIY
Sbjct: 61  ANSNIAVLNVLARLGSGFDIVSGGELSRVIEAGGDPAKVVFSGVGKTVEEMEMALNLGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN  A+ LGK AP++ RVNPD++A TH  ISTG KE+KFGI +    +
Sbjct: 121 CFNVESAAELEQLNLVALRLGKVAPVSLRVNPDVDAGTHPYISTGLKENKFGIAMEGAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++  A+ LPG+++ GVD HIGSQ+ +I+ F  A   +  L  +L   G  I+H DVGGGL
Sbjct: 181 IFTRANELPGLEVKGVDCHIGSQLTEIKPFLDAMDRMLALIDRLAEQGIEIKHFDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  +  PP    YA+ + +       K+I EPGR + A+ GI VT+V+ +K+++DK 
Sbjct: 241 GVTY-DEEVPPQPDVYAAALLERLDGRDLKLIFEPGRAIAANAGIFVTQVLYLKENSDKR 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F ++D AMND +RP+LY A+ +I  ++  AG+ +  + D+VGP+CETGDF+  +R++ + 
Sbjct: 300 FALVDGAMNDLIRPSLYSAWQKIIPVIERAGE-MQTY-DVVGPVCETGDFLGKDRELNI- 356

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GD L I  +GAYG   S  YNSR    E+MV+G + ++IR R    +L + + I
Sbjct: 357 LAGDYLAIRSSGAYGFTMSSNYNSRPRAAELMVDGDKAYVIREREKLAQLWQGEQI 412


>gi|71905849|ref|YP_283436.1| diaminopimelate decarboxylase [Dechloromonas aromatica RCB]
 gi|71845470|gb|AAZ44966.1| diaminopimelate decarboxylase [Dechloromonas aromatica RCB]
          Length = 420

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 183/420 (43%), Positives = 262/420 (62%), Gaps = 7/420 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDG----MDTMVC 56
           M+ F    G LHAE+V+L  +A    TP Y YS  A+E +   F +   G       +VC
Sbjct: 1   MTHFALNNGVLHAESVALPAIADQFGTPAYVYSRAALEASLREFHDVLGGHVAGQGALVC 60

Query: 57  YALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQ 116
           YA+KANSN A++   A LG+G DIVS GEL+R LAA    +++VFSGVGKT DE+ LAL 
Sbjct: 61  YAVKANSNLAILNVFARLGAGFDIVSGGELQRVLAAGADPKKVVFSGVGKTADEMKLALD 120

Query: 117 SGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIH 176
            GI+CFNVES +EL+ LN+ A   GKKAPI+ RVNP+++  TH  ISTG K  KFG+   
Sbjct: 121 VGIFCFNVESAAELERLNEVASQCGKKAPISLRVNPNVDPKTHPYISTGLKGAKFGVAYD 180

Query: 177 QIHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDV 236
               LY  A+ LP ++++G+D HIGSQ+     F +A   +  L  Q+ + G +I H+D+
Sbjct: 181 NALDLYRRAAALPSIEVTGIDCHIGSQLLDPSPFVEALDRILALVDQMAAEGIHIHHLDL 240

Query: 237 GGGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKS 296
           GGGLGI Y+++   P+ + Y + +         +++LEPGR LV + G+L+T++  +K+ 
Sbjct: 241 GGGLGIKYNAEQAQPTVASYLTPLLDKLAGRGLQVVLEPGRRLVGNAGLLLTRIEYLKQG 300

Query: 297 ADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRK 356
             K F I+D AMND MRP LY+A+H+IN +V  +G  +    D+VGP+CETGDF+   R 
Sbjct: 301 EAKNFAIIDAAMNDLMRPALYEAWHDINPVVPRSG--VATEYDVVGPVCETGDFLGQARP 358

Query: 357 IALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           + +   GDLL +   GAYG   +  YN+R    E+MV+G + H+IR R T ++L   +SI
Sbjct: 359 LVV-EAGDLLAVMSAGAYGMAMASNYNTRPRAVEVMVDGDKIHVIRQRETVEQLYAGESI 417


>gi|170719432|ref|YP_001747120.1| diaminopimelate decarboxylase [Pseudomonas putida W619]
 gi|169757435|gb|ACA70751.1| diaminopimelate decarboxylase [Pseudomonas putida W619]
          Length = 415

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 189/417 (45%), Positives = 269/417 (64%), Gaps = 6/417 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+AF Y +G L AE V+L  +A    TP Y YS   IE  Y ++++A  G++ +VC+A+K
Sbjct: 1   MNAFNYRDGGLFAEGVALSAIAERFGTPTYVYSRAHIEAQYRSYTDALQGVEHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA +G+G DIVS GEL R LAA   A+R+VFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARMGAGFDIVSGGELERVLAAGGRADRVVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L   A  +GK AP++ RVNPD++A TH  ISTG KE+KFGI I    +
Sbjct: 121 CFNVESTDELERLQVVAAEMGKVAPVSLRVNPDVDAGTHPYISTGLKENKFGIAIADAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LP +++ GVD HIGSQ+  +E F  A   L DL  +L   G +++H+D+GGG+
Sbjct: 181 IYVRAAQLPNLEVVGVDCHIGSQLTTVEPFLDALDRLLDLVDRLADCGIHLRHLDLGGGV 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP  +DY   I +  G+    ++ EPGR++VA+ G L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEEPPLVADYIKAIRERVGDRDLALVFEPGRYIVANAGALLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGD-RLHIHADIVGPICETGDFIALNRKIAL 359
           F I+D AMND +RP LY A+  ++ +    G+ R +   D+VGPICETGDF+A +R++ L
Sbjct: 300 FAIIDAAMNDLIRPALYQAWMGVSAVTPREGEGRAY---DLVGPICETGDFLAKDRQLNL 356

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GDLL ++  GAYG V S  YN+R    EI+V+G Q   +R R T  EL   +S+
Sbjct: 357 AE-GDLLAVQSAGAYGFVMSSNYNTRGRCAEILVDGDQAFEVRRRETIAELYAGESL 412


>gi|37678270|ref|NP_932879.1| diaminopimelate decarboxylase [Vibrio vulnificus YJ016]
 gi|37197009|dbj|BAC92850.1| diaminopimelate decarboxylase [Vibrio vulnificus YJ016]
          Length = 417

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 193/418 (46%), Positives = 260/418 (62%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE VSL  LA    TP Y YS   +E+++  F  + +G   +VCYA+
Sbjct: 1   MDYFNYQDDGQLWAEEVSLTSLAEQYGTPLYVYSRATLERHWHAFDRSVEGHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA LGSG DIVS GEL R LAA     ++VFSGVGKT  E+  AL+  I
Sbjct: 61  KANSNLGVLNTLARLGSGFDIVSGGELERVLAAGGDPRKVVFSGVGKTEAEMRRALELNI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG KAPI+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNRVAGELGVKAPISLRINPDVDAQTHPYISTGLRDNKFGIAFDRAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           ++Y +A +L  + + G+D HIGSQ+  IE F  A   L  L   L+  G NI+H+DVGGG
Sbjct: 181 AVYQFAQSLANLNVQGIDCHIGSQLTAIEPFIDATDRLLALIDDLKEQGINIRHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y ++  PP  S+YA  +     N Q  ++I EPGR + A+ G+L+TKV  +K +  
Sbjct: 241 LGVVYRNE-LPPQPSEYAKALLGRLENHQDLELIFEPGRAIAANAGVLLTKVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I  +    G+   +  D+VGPICETGDF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDIVPVQPRQGE--AVTYDLVGPICETGDFLGKDRSLV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L    DLL +   GAYG V S  YN+R    E+MV+G Q +++R R   + L EL+ I
Sbjct: 358 LAE-NDLLAVRSAGAYGFVMSSNYNTRARAAEVMVDGKQHYLVRQREELRSLWELEHI 414


>gi|292493805|ref|YP_003529244.1| diaminopimelate decarboxylase [Nitrosococcus halophilus Nc4]
 gi|291582400|gb|ADE16857.1| diaminopimelate decarboxylase [Nitrosococcus halophilus Nc4]
          Length = 416

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 192/416 (46%), Positives = 257/416 (61%), Gaps = 3/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y + +L AE V L ++A    TP Y YS   IE  +  F  AF      +CYA+K
Sbjct: 1   MDHFHYHDNTLWAEEVPLPEIASRFGTPCYVYSRAMIEHQWRAFDQAFQDYPHRLCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R LAA     ++VFSGVGK  DE+  AL +GI 
Sbjct: 61  ANSNLAVLNILARLGSGFDIVSVGELERVLAAGGDPGQVVFSGVGKRADEMHRALTAGIA 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE+EL  LN  A  LG++AP++ RVNPD++A TH  I+TG +E+KFGI I Q   
Sbjct: 121 CFNVESEAELAHLNDIAGKLGRQAPVSLRVNPDVDARTHPYIATGLRENKFGIEIDQALE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA+A TLP + I GVD HIGSQ+  +  F  A + +  L  QL   G  ++HID+GGGL
Sbjct: 181 VYAHAVTLPYIDILGVDCHIGSQLTSLSPFLAASERVLALVDQLAERGIEVRHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  D  PPS   YA+ + +       ++ +EPGR +V + G+L+T+V  +K +  K 
Sbjct: 241 GITYR-DEAPPSPQQYATALREKLVGRNLEVWIEPGRAIVGNGGVLLTRVEYLKHTPHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LYDA+ EI  +      + H+  D+VGP+CETGDF+   R +A+ 
Sbjct: 300 FAIVDAAMNDLLRPALYDAWQEIIPVTISTDGKSHLF-DVVGPVCETGDFLGKQRHLAIG 358

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             G+LL     GAYG   S  YNSR    E+MV+GS+ +++R R T + L   +SI
Sbjct: 359 -VGELLVARAAGAYGFTMSSNYNSRPRAAEVMVDGSKAYLVRERETVESLYAGESI 413


>gi|251793705|ref|YP_003008435.1| diaminopimelate decarboxylase [Aggregatibacter aphrophilus NJ8700]
 gi|247535102|gb|ACS98348.1| diaminopimelate decarboxylase [Aggregatibacter aphrophilus NJ8700]
          Length = 416

 Score =  361 bits (926), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 187/417 (44%), Positives = 263/417 (63%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y    L AEN+ +++LA    TP Y YS   +E+++  F  AF     +VCYA+K
Sbjct: 1   MDFFQYQHHQLMAENLPVKQLAEQFGTPLYIYSKATLERHWYAFDKAFGEHPHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +N N A++  +A LGSG DIVS+GEL R L A     ++VFSGV K+  EI  AL+ GI 
Sbjct: 61  SNPNIAILNVMAKLGSGFDIVSQGELERVLVAGGNPAKVVFSGVAKSEPEITRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE+EL  +N+ A  LGK API+ RVNPD++A+TH  ISTG KE+KFG+ + Q   
Sbjct: 121 CFNVESEAELLRINEVARRLGKTAPISLRVNPDVDAHTHPYISTGLKENKFGVSVEQARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+TLP ++I G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYKLAATLPNIEIVGMDCHIGSQLTELQPFLDAVDRLIVLMEQLKQDGIALKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  ++YA  + +      + +II+EPGR + A+ GILVTKV  +K +  +
Sbjct: 241 GVTY-TDETPPHPTEYAKALWEKLNAFSELEIIVEPGRAITANAGILVTKVEYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY AY  I  I         I+ D+VGPICET DF+   RK+A+
Sbjct: 300 NFAIVDAGMNDMIRPALYQAYMNILEIDRTLAREEKIY-DVVGPICETSDFLGKQRKLAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            + GD L     GAYGA  S  YNS     E+MV+G + ++IR R    EL +L+S+
Sbjct: 359 AQ-GDYLAQRSAGAYGASMSSNYNSHPRTAEVMVDGDKAYLIRRREVLNELWQLESL 414


>gi|192360548|ref|YP_001983745.1| diaminopimelate decarboxylase [Cellvibrio japonicus Ueda107]
 gi|190686713|gb|ACE84391.1| diaminopimelate decarboxylase [Cellvibrio japonicus Ueda107]
          Length = 415

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 188/418 (44%), Positives = 264/418 (63%), Gaps = 8/418 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F    G L+AE++ L  +A    TP Y YS  A  + YL+++ A      M+CYA+K
Sbjct: 1   MQYFTERNGELYAEDLPLRDVAERFGTPCYVYSRAAFTQQYLSYAQALGSHPGMICYAIK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN A++  LA LG+G DIVS GEL R L A     RIVFSGVGK++ E+  AL  GI+
Sbjct: 61  ANSNLAILNMLAKLGAGFDIVSGGELERVLYAGGNPSRIVFSGVGKSVQEMARALDVGIF 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE+EL+ L Q A   GK A ++ RVNPD++ANTH  ISTG KE+KFGI I +  +
Sbjct: 121 CFNVESEAELELLAQVAADKGKVANVSLRVNPDVDANTHPYISTGLKENKFGIAIERAPA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ LP + I G+D HIGSQ+ Q+  F  A + L  L  +L + G +I H+D+GGGL
Sbjct: 181 VYARAAQLPSLAIKGLDCHIGSQLTQLTPFLDALERLLLLIDELAAKGIHISHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP  ++Y + I    G+    ++ EPGR + A+ G+L+T+V+ +K +  K 
Sbjct: 241 GVTYR-DETPPPVAEYMAAIKAKLGDRPLALMFEPGRSISANAGVLLTQVMFLKPTEHKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHA--DIVGPICETGDFIALNRKIA 358
           F ++D AMND +RP+LY A+ +I     P   R       D+VGPICETGDF+   R++A
Sbjct: 300 FAVIDAAMNDNIRPSLYQAWQDI----RPLQQRGQAPKTWDLVGPICETGDFLGKGRELA 355

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +  PGDLL +   GAYG   S  YN+R    E++V+G Q H++R R TF++LI  +++
Sbjct: 356 I-EPGDLLAVMSAGAYGFSMSSNYNTRGRAAEVVVDGDQMHLVRARETFEDLIRGEAL 412


>gi|145637736|ref|ZP_01793388.1| diaminopimelate decarboxylase [Haemophilus influenzae PittHH]
 gi|145269085|gb|EDK09036.1| diaminopimelate decarboxylase [Haemophilus influenzae PittHH]
          Length = 415

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 188/416 (45%), Positives = 270/416 (64%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L+AE++ +++LA    TP Y YS   +E+++  F +AF     ++C+A+K
Sbjct: 1   MNFFQYKHNKLYAEDMPVQQLAEQFGTPLYVYSRATLERHWHAFDSAFGKHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN  V+  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+ +EI  AL+ GI 
Sbjct: 61  SCSNIGVLNIMAKLGSGFDIVSQGELERVLAAGGDASKVVFSGVAKSREEIMRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SELK +NQ A  +GK API+ RVNPD++A+TH  ISTG KE+KFG+ + +   
Sbjct: 121 CFNVESVSELKHINQIAGEMGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVDEARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  ASTLP +KI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYKLASTLPNIKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGITLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  SDYA+ + +   N  + +IILEPGR + A+ GILV KV  +K +  +
Sbjct: 241 GVTY-TDETPPHPSDYANALLEKLKNYPELEIILEPGRAISANAGILVAKVQYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I D  MND +RP LY+AY  I  I +   +R     D+VGP+CET DF+   R++++
Sbjct: 300 NFAITDTGMNDMIRPALYEAYMNIVEI-DRTLEREKTIYDVVGPVCETSDFLGKQRELSI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
              GD +     GAYGA  S  YNSR    E++V+  + ++IR R T QEL  L+S
Sbjct: 359 AE-GDYIAQCSAGAYGASMSSNYNSRARTAEVLVDRDKSYLIRRRETLQELWALES 413


>gi|269103729|ref|ZP_06156426.1| diaminopimelate decarboxylase [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163627|gb|EEZ42123.1| diaminopimelate decarboxylase [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 417

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 194/418 (46%), Positives = 260/418 (62%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE VS + LA    TP Y YS   +E+++  F  A      ++CYA+
Sbjct: 1   MDYFNYQQDGQLWAEQVSAQSLAAQYGTPLYVYSRATLERHWQAFDRAVASHPHLICYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN AV+  LA LGSG DIVS GEL R +AA     ++VFSGVGKT+ E+  AL  GI
Sbjct: 61  KANSNLAVLNVLAKLGSGFDIVSLGELERVIAAGGDPSKVVFSGVGKTVAEMTRALSLGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LNQ A  LG  API+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNQVAAELGVIAPISLRINPDVDAKTHPYISTGLRDNKFGITFERAL 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y  A  LP + + G+D HIGSQ+ +I  F  A   L  L   L   G  I H+DVGGG
Sbjct: 181 DVYRLAHRLPNLNVVGMDCHIGSQLTEITPFIDAVDRLLSLIDTLADEGITIAHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  + +PP  SDYA +L+ +     + ++I EPGR + A+ GIL+T+V  +K S  
Sbjct: 241 LGVTYDQE-QPPEPSDYAIALLERLNQYPELELIFEPGRAIAANAGILLTRVEYLKHSEY 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND +RPTLY A+  I    +P    +  + DIVGPICETGDFI  +R++A
Sbjct: 300 KNFAIVDAAMNDLIRPTLYSAWQAI-IPASPRQGEMQTY-DIVGPICETGDFIGRDRQLA 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L  P DLL +   GAYG V +  YN+R    E+MV+G Q +++R R T Q+L + +S+
Sbjct: 358 L-EPNDLLAVRSAGAYGFVMASNYNTRARAAEVMVDGEQSYLVRQRETLQQLWQGESL 414


>gi|170718155|ref|YP_001785183.1| diaminopimelate decarboxylase [Haemophilus somnus 2336]
 gi|168826284|gb|ACA31655.1| diaminopimelate decarboxylase [Haemophilus somnus 2336]
          Length = 417

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 188/417 (45%), Positives = 264/417 (63%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G L AENVS++K+A    TP Y YS   +E+++  F NA      ++C+A+K
Sbjct: 1   MDFFLYKDGHLMAENVSVKKIAEQFGTPAYIYSRATLERHWHAFDNALGDHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +N N A++  +A LGSG DIVS+GEL R L A    +++VFSGV K+  EI  AL+ GI 
Sbjct: 61  SNPNIAILNIMARLGSGFDIVSQGELERVLFAGGDPKKVVFSGVAKSEQEIARALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL  +NQ A  +GK A I+ RVNPD++A+TH  ISTG KE+KFG+ + Q   
Sbjct: 121 CFNVESAAELTKINQVARKMGKIASISLRVNPDVDAHTHPYISTGLKENKFGVSVEQARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS L  +KI G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYRQASQLENIKIVGIDCHIGSQLTELQPFLDATDRLIVLMEQLKKDGITLEHVDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y SD + P  S+YA+ + +   N Q  +IILEPGR + A+ GIL+T+V  IK +  +
Sbjct: 241 GVTY-SDEKAPHPSEYATALLEKLKNYQNLEIILEPGRAITANAGILLTRVEYIKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY AY  I  +         ++ D+VGPICET DF+   R +A+
Sbjct: 300 HFAIVDTGMNDMIRPALYQAYMNIIEVDRTLSRETKVY-DVVGPICETSDFLGKQRSLAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            + GD +     GAYGA  + TYNSR    EIMV+G Q H+I+ R  F EL  L+ +
Sbjct: 359 AQ-GDFIVQRSAGAYGASMASTYNSRPRAIEIMVDGEQVHLIKRREEFAELWHLEKL 414


>gi|254492286|ref|ZP_05105460.1| diaminopimelate decarboxylase [Methylophaga thiooxidans DMS010]
 gi|224462611|gb|EEF78886.1| diaminopimelate decarboxylase [Methylophaga thiooxydans DMS010]
          Length = 416

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 187/410 (45%), Positives = 252/410 (61%), Gaps = 3/410 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y   +LHAENVS+ ++     TP Y YS   + +++  F +AF     +VCYA+K
Sbjct: 1   MDYFQYQADTLHAENVSVTQITQQYGTPTYVYSRATLARHWKAFDDAFSNHAHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R +AA   A + VFSGVGK  +EI+ AL   I 
Sbjct: 61  ANSNLAVLNVLARLGSGFDIVSAGELARVIAAGGEAAKTVFSGVGKNREEIEYALNQNIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL  +N  A  L K AP++ RVNPD++A TH  ISTG KE+KFGI I    +
Sbjct: 121 CFNVESIPELARINDVAAMLNKVAPVSIRVNPDVDAQTHPYISTGLKENKFGIAIEDART 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A  +  + + GVD HIGSQ+  +  F  A K +  L  +L  +G  I+H+D+GGGL
Sbjct: 181 VYQSAKQMSNLNVVGVDCHIGSQLTTVSPFVDALKRVLTLIDELAEDGITIKHLDIGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  D  PP+ ++YA  +     +   +I+LEPGR +  + GIL+T+V  IK +  K 
Sbjct: 241 GIHYR-DETPPTPAEYAEALQPLLTDRDLEILLEPGRAIAGNAGILLTQVEFIKPTEAKQ 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY ++ EI  ++  + D      DIVGPICETGDF+  +R +A+ 
Sbjct: 300 FAIVDAAMNDLLRPALYQSWQEIQPVMLNS-DAEEATYDIVGPICETGDFLGKDRLLAI- 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
           + GD L I   GAYG   S  YNSR    E+MV+G Q H++R R T + L
Sbjct: 358 KQGDFLAIRSAGAYGFTMSSNYNSRPRAAEVMVDGDQVHLVRERETIESL 407


>gi|15603289|ref|NP_246363.1| hypothetical protein PM1424 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12721800|gb|AAK03508.1| LysA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 416

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 192/418 (45%), Positives = 268/418 (64%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y +  L AE V ++ +A    TP Y YS   +E+++  F+NA      ++C+A+K
Sbjct: 1   MDYFQYQQAQLMAEQVPVKHIAQQYGTPLYIYSRATLERHWHAFNNALGDHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +N N A++  +A LGSG DIVS+GEL R LAA     +IVFSGV KT  EI  AL+ GI 
Sbjct: 61  SNPNIAILNIMARLGSGFDIVSQGELERVLAAGGEPSKIVFSGVAKTETEIARALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL  +NQ A  +GK API+ RVNPD++A TH  ISTG KE+KFGI + +  +
Sbjct: 121 CFNVESVAELYRINQVAGEMGKTAPISLRVNPDVDARTHPYISTGLKENKFGISVAEARN 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LP ++I+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYQLANQLPHIQITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKQDGIQLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYAS-LIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y ++  PP  S+YAS L+ +     + +IILEPGR + A+ GILVTKV  +K + D+
Sbjct: 241 GVPY-TNENPPHPSEYASALLDKLKAYHELEIILEPGRAITANAGILVTKVEYLKHNEDR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYI-VNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
            F I+D  MND +RP LY AY  +N I V+    R     D+VGPICET DF+   R++A
Sbjct: 300 HFAIVDAGMNDMIRPALYQAY--MNIIEVDRTLTRDKAVYDVVGPICETSDFLGKQRELA 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +   GD L     GAYGA  S  YNSR    E+MV+G Q H+IR R T +EL  L+ +
Sbjct: 358 IA-AGDYLAQRSAGAYGASMSSNYNSRSRTAEVMVDGDQVHLIRRRETLEELWALERL 414


>gi|253997642|ref|YP_003049706.1| diaminopimelate decarboxylase [Methylotenera mobilis JLW8]
 gi|253984321|gb|ACT49179.1| diaminopimelate decarboxylase [Methylotenera mobilis JLW8]
          Length = 416

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 184/415 (44%), Positives = 257/415 (61%), Gaps = 4/415 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F      LHAENV+L ++     +P Y YS  A+ + +  FS  F   + +VC+A+K
Sbjct: 1   MNTFTLKNNVLHAENVALTQITENFGSPCYVYSKAALSQAFERFSAGFKDANHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +N + A++   A LG+G DIVS GEL R +AA    +++VFSGVGKT +E+  AL++GI+
Sbjct: 61  SNPSLAILNLFAKLGAGFDIVSGGELARVIAAGGDPKKVVFSGVGKTAEEMRAALEAGIF 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SEL  LN  A  +GK AP++ RVNP+++A TH  ISTG K +KFG+       
Sbjct: 121 CFNVESASELIRLNDVAAYMGKIAPVSLRVNPNVDAKTHPYISTGLKNNKFGVAYEDALD 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ +  + I GVD HIGSQI ++  F  AF  +  L   L  N   IQHID+GGG+
Sbjct: 181 IYLQAAEMSNIAIHGVDCHIGSQITELSPFLDAFDRVLALVDALAENNIQIQHIDLGGGI 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y SD  PP  + YA  + +  GN   K++ EPGR LV + G+L+TKV  +K +  K 
Sbjct: 241 GICY-SDETPPEFTAYAKAMREKLGNRDVKLVFEPGRALVGNAGVLLTKVEYLKPTESKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND MRP LYDAYH+I  +     +   ++ +IVGP+CE+GDF+  +R +AL 
Sbjct: 300 FAIVDAAMNDLMRPALYDAYHDIQAVA--PRNEAAVNYEIVGPVCESGDFLGHDRNLAL- 356

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
           + GDLL I   GAYG   S  YN+R    E+MV+G Q H+I+ R    +L   +S
Sbjct: 357 QEGDLLAIMSAGAYGMSMSSNYNTRPRAAEVMVDGDQCHLIKKRELIADLFANES 411


>gi|113461849|ref|YP_719918.1| diaminopimelate decarboxylase [Haemophilus somnus 129PT]
 gi|112823892|gb|ABI25981.1| diaminopimelate decarboxylase [Haemophilus somnus 129PT]
          Length = 417

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 188/417 (45%), Positives = 264/417 (63%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G L AENVS++K+A    TP Y YS   +E+++  F NA      ++C+A+K
Sbjct: 1   MDFFLYKDGHLMAENVSVKKIAEQFGTPAYIYSRATLERHWYAFDNALGDHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +N N A++  +A LGSG DIVS+GEL R L A    +++VFSGV K+  EI  AL+ GI 
Sbjct: 61  SNPNIAILNIMAKLGSGFDIVSQGELERVLFAGGDPKKVVFSGVAKSEQEIARALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL  +NQ A  +GK A I+ RVNPD++A+TH  ISTG KE+KFG+ + Q   
Sbjct: 121 CFNVESAAELIRINQVARKMGKIASISLRVNPDVDAHTHPYISTGLKENKFGVSVEQARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS L  +KI G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYRQASQLENIKIVGIDCHIGSQLTELQPFLDATDRLIVLMEQLKKDGITLEHVDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y SD + P  S+YA+ + +   N Q  +IILEPGR + A+ GIL+T+V  IK +  +
Sbjct: 241 GVTY-SDEKAPHPSEYATALLEKLKNYQNLEIILEPGRAITANAGILLTRVEYIKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY AY  I  +         ++ D+VGPICET DF+   R +A+
Sbjct: 300 HFAIVDTGMNDMIRPALYQAYMNIIEVDRTLSRETKVY-DVVGPICETSDFLGKQRSLAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            + GD +     GAYGA  + TYNSR    EIMV+G Q H+I+ R  F EL  L+ +
Sbjct: 359 AQ-GDFIVQRSAGAYGASMASTYNSRPRAIEIMVDGEQVHLIKRREEFAELWHLEKL 414


>gi|83643199|ref|YP_431634.1| diaminopimelate decarboxylase [Hahella chejuensis KCTC 2396]
 gi|83631242|gb|ABC27209.1| diaminopimelate decarboxylase [Hahella chejuensis KCTC 2396]
          Length = 423

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 185/410 (45%), Positives = 260/410 (63%), Gaps = 3/410 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y    L AE++S++++A    TP Y YS   +E++   +  A DG   M+CYA+K
Sbjct: 1   MDHFEYRNHQLFAEDLSVQEIAEHYGTPCYIYSRATLERHLKAYQTAMDGYPHMICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LG+G DIVS GE+ R LAA    ERIVFSGVGK   E+  AL+ G++
Sbjct: 61  ANSNLAVLNVLARLGAGFDIVSVGEMERVLAAGGKPERIVFSGVGKLEHEMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L Q A  +GKKAPI+ RVNPD++  TH  ISTG KE+KFG+ I +   
Sbjct: 121 CFNVESAPELERLQQVAADMGKKAPISIRVNPDVDPQTHPYISTGLKENKFGVSIDEALE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LY  A+  P + + G+D HIGSQ+ QI  F  A + + ++ + LR+ G  ++H+D+GGGL
Sbjct: 181 LYHSAAVSPHLDVIGIDCHIGSQLTQISPFLDALERVLNIIETLRNEGIRLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y+ +  PP  ++YA  + +        ++LEPGR + A+ G++VT+V  +K +  K 
Sbjct: 241 GVTYNQE-TPPHPNEYARAVMERLKGSGLTLVLEPGRSIAANAGLMVTRVEYLKHNGHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP+LY A+  I   V    +      DIVGP+CETGDFI   R + L 
Sbjct: 300 FAIVDAAMNDLIRPSLYGAWQNI-VPVRQHSEGKEARYDIVGPVCETGDFIGKERLLNL- 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
           +PGDLL +   GAYG V S  YNSR    E+MV+G + +++R R T +EL
Sbjct: 358 KPGDLLAVRSAGAYGFVMSSNYNSRGRAAEVMVDGDKHYLVRRRETIEEL 407


>gi|322513198|ref|ZP_08066326.1| diaminopimelate decarboxylase [Actinobacillus ureae ATCC 25976]
 gi|322121029|gb|EFX92862.1| diaminopimelate decarboxylase [Actinobacillus ureae ATCC 25976]
          Length = 416

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 188/417 (45%), Positives = 270/417 (64%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y    L AE+VS+  + +   TP Y YS   +E+++  F  AF     ++C+A+K
Sbjct: 1   MNHFNYKNQQLFAEDVSVSDIINQYGTPAYIYSRATLERHWHAFDKAFGSHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN A++  +A LGSG DIVS+GEL R LAA     ++VFSGV K+  EI  AL+ GI 
Sbjct: 61  SNSNIALLNVMARLGSGFDIVSQGELERVLAAGGDPSKVVFSGVAKSHSEIQRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ES +EL  +N+ A  LGK API+ RVNPD++A+TH  ISTG KE+KFG+ ++Q   
Sbjct: 121 CFNIESIAELHRINEVAGQLGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVNQARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A +LP VKI+G+D HIGSQ+ +++ F  A   L  L  QL+ +G  + H+D+GGGL
Sbjct: 181 VYLLAKSLPNVKITGMDCHIGSQLTELQPFLDATDRLIVLMDQLKEDGIELHHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y+ +  PP  ++YA +L+ +  G    +IILEPGR + A+ GILVTKV  +K + D+
Sbjct: 241 GVPYNGE-EPPHPTEYAKALLEKLKGYADLEIILEPGRAITANAGILVTKVEYLKANEDR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY+AY +I   V+ +  R     D+VGPICET DF+   R++A+
Sbjct: 300 NFAIVDTGMNDMIRPALYEAYMQITE-VDQSLVREKTVYDVVGPICETSDFLGKGRELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            + GDL+ +   GAYGA  S TYNSR    EIMV+    H+I+ R +F +L  L+ +
Sbjct: 359 EQ-GDLIAMRSAGAYGAAMSSTYNSRPQAVEIMVDSDLAHLIKARASFADLWRLERL 414


>gi|124516709|gb|EAY58217.1| Diaminopimelate decarboxylase [Leptospirillum rubarum]
          Length = 414

 Score =  360 bits (924), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 181/416 (43%), Positives = 259/416 (62%), Gaps = 3/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L  E+V + K+   V +P Y YS  A+ + Y ++  AF G  T++ YA+K
Sbjct: 1   MNGFEYKGHELFVEDVPVRKIVSSVDSPVYIYSEKALREAYSSYQQAFQGHRTLIAYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           AN N  ++  L  +GSG D+VS GEL RA  A +P++RIVF+GVGKT  E+  A+ +GI 
Sbjct: 61  ANGNLQILSMLGKMGSGADVVSGGELFRARRAGIPSDRIVFAGVGKTDGEMREAIDAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL  L++ A S+GK AP+A RVNPD++  TH  ISTG K+ KFGIP+ Q   
Sbjct: 121 MFNVESSMELDRLSRVASSMGKVAPVALRVNPDVDPKTHPYISTGMKKSKFGIPVDQALE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A+ LPG++I G+  HIGSQ+ +I  F  AF  +    + L+ NG  +  +DVGGGL
Sbjct: 181 EYRRAARLPGIRIVGIHQHIGSQLTEISPFRDAFDRMVAFARLLKENGIEVTWLDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  + +PP+  + A  I      L   IILEPGR +V + GILVT+V  +K+++ K 
Sbjct: 241 GIRY-GNEKPPTPREVAHEILSRLEGLNVGIILEPGRSIVGNAGILVTEVQYLKETSVKM 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I D  MND +RP+LY A+H++  +V   G       D+VGP+CETGDF+  +R++   
Sbjct: 300 FYIADAGMNDLIRPSLYGAFHDLWPVVKKTG--AGKKGDLVGPVCETGDFLVQDRELPPA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            PGDLL +   GAYG   +  YN+R    E++V+G +F +IR R T+++LI  + I
Sbjct: 358 EPGDLLAVMSAGAYGFAMASNYNARPRPAEVLVSGDRFSVIRARETYEDLIRGEGI 413


>gi|302035867|ref|YP_003796189.1| diaminopimelate decarboxylase [Candidatus Nitrospira defluvii]
 gi|300603931|emb|CBK40263.1| Diaminopimelate decarboxylase [Candidatus Nitrospira defluvii]
          Length = 420

 Score =  360 bits (924), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 181/420 (43%), Positives = 268/420 (63%), Gaps = 1/420 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y EG L+ E+V L ++A  V TP Y YS   + +++  + +AF  +  +V +A+K
Sbjct: 1   MNDFQYREGELYCEDVPLSRIAKEVGTPCYVYSHHTLVRHFRVYDSAFQNIPHIVAFAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV++ +A  GSG+DIVS GEL RAL A VP  +IVF+GVGK  +EI  AL++ I 
Sbjct: 61  ANSNLAVLRMMAKEGSGVDIVSGGELFRALKAGVPPGKIVFAGVGKKPEEIRDALKADIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES +EL+ +N  A S+G KA +A R+NPDI+  TH  ISTG K+ KFGI   +   
Sbjct: 121 MFNVESSAELQAINDVAASMGVKARVALRINPDIDPKTHPYISTGLKKSKFGIAADRAIE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            +  A+    +++ G+  HIGSQ+ Q+  F ++ K +  + Q L   G  I+++++GGGL
Sbjct: 181 EFKAAAAFSHIEVVGLHAHIGSQLTQVAPFVESLKKVLTMVQTLAEQGIPIRYLNIGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y SD  PP   D A+ I     +L+C +I+EPGR +V + G+L+TKV+  K    K 
Sbjct: 241 GITY-SDETPPEPKDLAAAIFPLVRDLKCVLIMEPGRVIVGNAGVLLTKVLYTKDGETKR 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F+I+D AMND +RP+LYDA+H+I  +            D+VGP+CE+GDF+A +R +   
Sbjct: 300 FLIVDAAMNDLIRPSLYDAHHDIKPVYENVARGAKETVDVVGPVCESGDFLAKDRAMPEM 359

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
             GDL+ +   GAYG V S  YNSR  +PE++V+  Q H+IR R ++ +L+  + IPA+L
Sbjct: 360 NAGDLMAVMSAGAYGFVMSSNYNSRPRVPEVLVHEGQIHVIRARESYDDLVHGEQIPAFL 419


>gi|148262316|ref|YP_001229022.1| diaminopimelate decarboxylase [Geobacter uraniireducens Rf4]
 gi|146395816|gb|ABQ24449.1| diaminopimelate decarboxylase [Geobacter uraniireducens Rf4]
          Length = 417

 Score =  360 bits (924), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 182/420 (43%), Positives = 267/420 (63%), Gaps = 3/420 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y    L+AE+V+++ +   V +P Y YS   +E+++     AF  +   +CY++K
Sbjct: 1   MHHFQYKGKELYAEDVAIKDIVAKVGSPVYIYSQATLERHFKAMDEAFAAVPHTICYSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+K   +LG G+DIVS GEL RAL A V  +++V+SGVGK  DEI+ AL +GI 
Sbjct: 61  ANSNLAVVKNFINLGGGVDIVSGGELYRALKAGVDPQKVVYSGVGKKDDEIEYALNTGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE EL  +++ A  +GKKA IA RVNPD++  TH  I+TG K  KFGI I +   
Sbjct: 121 MFNVESEQELTRISEIASRMGKKAGIAIRVNPDVDPQTHPYITTGLKNAKFGITIERAIE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A  LPG++I G+D HIGSQ+ ++  F  A K L+++   L+  G ++++ D+GGGL
Sbjct: 181 EYRRAKDLPGIEILGIDCHIGSQLTKVTPFVDAIKKLKNVINTLKGMGISLKYFDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y+ D  PP  +DY + I     +L   ++ EPGR LV + GILV   +  K+  +K 
Sbjct: 241 GIQYN-DEAPPLPADYGTEILAETKDLGLHLLFEPGRNLVGNAGILVATCLYTKQRDEKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F+++D  MND  RP LY +YH +  +VN       I ADIVGPICE+GDF+A +R++ + 
Sbjct: 300 FIMIDAGMNDLARPALYGSYHGVKPVVNDQDGV--IVADIVGPICESGDFLAKDREVPMF 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
           + GD++     GAYG   S +YNSR  + E+MV G +F ++R R T ++LI+ + +PA+L
Sbjct: 358 KQGDMMAFMSAGAYGFAMSSSYNSRPRVAEVMVKGDRFEVVRERETVEDLIKGEKVPAFL 417


>gi|317401523|gb|EFV82153.1| diaminopimelate decarboxylase [Achromobacter xylosoxidans C54]
          Length = 430

 Score =  360 bits (923), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 185/418 (44%), Positives = 261/418 (62%), Gaps = 13/418 (3%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
           F+Y    L+AE+V L+ LA  + TP Y YS  A+   + T+ +A      +VCY +KANS
Sbjct: 17  FQYRNNVLYAEDVPLDHLAGQLGTPLYVYSRAALRAAWDTYRSAVGQRPVLVCYGMKANS 76

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFN 123
           N A++K  A LG+G DIVS GEL+RALAA     +IVFSGVGK + E+  AL +G+ CFN
Sbjct: 77  NLAILKEFARLGAGFDIVSGGELKRALAAGADPAKIVFSGVGKQVWEMRAALAAGVMCFN 136

Query: 124 VESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA 183
           VESE+EL+ L+  A   G++A ++ RVNPD++A TH  ISTG KE+KFGIPI      Y 
Sbjct: 137 VESEAELQRLSDVAQEAGQRARVSLRVNPDVDAQTHPYISTGLKENKFGIPIGAALDAYR 196

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIA 243
            A  LPG++I+G+D HIGSQ+  I  +  A + L DL   L   G  + H+D+GGGLGI 
Sbjct: 197 SARLLPGLEITGLDCHIGSQLTDISPYFDALEKLLDLVADLEGIGIRLSHLDLGGGLGIR 256

Query: 244 YHSDHRPPSSSDYASLIHQYFGNLQC------KIILEPGRFLVADVGILVTKVISIKKSA 297
           Y+ D  PPS     +L+   F  LQ       +++LEPGR LV + G+L+T V  +K   
Sbjct: 257 YN-DEMPPSPK---ALLDHVFQRLQARGQDHLRLVLEPGRSLVGNAGVLLTTVQYLKHGE 312

Query: 298 DKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKI 357
            + F ++D AMND +RP LYDA+H +  +   AGD   I  D+VGP+CE+ D++A  R +
Sbjct: 313 ARNFAVVDAAMNDLLRPALYDAWHGLQPLRPRAGDT--IDYDVVGPVCESADWLARQRAL 370

Query: 358 ALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
            L +  D+L +E  GAYG   +G YN+R    E+MV+G  +H++R R T  +L+  +S
Sbjct: 371 VLEQ-DDVLALESAGAYGMTMAGNYNTRPRAAEVMVDGGHYHVVRQRETLDDLLRGES 427


>gi|257092050|ref|YP_003165691.1| diaminopimelate decarboxylase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257044574|gb|ACV33762.1| diaminopimelate decarboxylase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 414

 Score =  360 bits (923), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 198/414 (47%), Positives = 257/414 (62%), Gaps = 4/414 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+AF    G LHAE+VSL  LA    TP + YS  A+E +   F     G+D +VCYA+K
Sbjct: 1   MTAFARRNGVLHAESVSLIDLAARFGTPCWVYSRAALEASLAEFERELAGLDALVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+   A  G+G DIVS GELRRALAA     RIVFSGVGKT  E++LAL + I 
Sbjct: 61  ANSNLAVLDVFARRGAGFDIVSGGELRRALAAGADPRRIVFSGVGKTAAEMELALAADIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL  L+  A  LGK API+ RVNPD++A TH  ISTG KE+KFG+   +  +
Sbjct: 121 CFNVESAPELDRLSAVAGRLGKTAPISLRVNPDVDAKTHPYISTGLKENKFGVAYEEALA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LY +A++LP + ISG+D HIGSQ+     F  A   +  L  QL +NG  + HID+GGGL
Sbjct: 181 LYRHAASLPNLTISGIDCHIGSQLLDPAPFAAALDKILTLVDQLAANGIVLHHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  D   P+   Y   + Q   +   +++LEPGR LV + G+L+T+V  +K    K 
Sbjct: 241 GIRYR-DEDAPTVQAYLQPMLQKLRDRHLQVLLEPGRRLVGNAGLLLTRVEYLKPGEVKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND  RP LY ++H+I  +V P G       +IVGP+CE+GDF+   R +AL 
Sbjct: 300 FAIVDAAMNDLARPALYGSWHDIVPVVAPQGATRPW--EIVGPVCESGDFLGHGRDLALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELD 414
             GDLL I   GAYG   S  YNSR    E+MV+G+  H++R R T +EL  L+
Sbjct: 358 -TGDLLAIMSAGAYGMAMSSNYNSRPRAAEVMVDGADVHLVRRRETAEELYALE 410


>gi|85707825|ref|ZP_01038891.1| Orn/DAP/Arg decarboxylase, family 2 [Erythrobacter sp. NAP1]
 gi|85689359|gb|EAQ29362.1| Orn/DAP/Arg decarboxylase, family 2 [Erythrobacter sp. NAP1]
          Length = 419

 Score =  359 bits (922), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 179/422 (42%), Positives = 263/422 (62%), Gaps = 4/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGM-DTMVCYAL 59
           M  F Y  G +HAENV L ++A  V TP Y YS   +E++   F  A D + D ++ +A+
Sbjct: 1   MDHFTYQNGVMHAENVPLPRIADDVGTPVYVYSRATLERHARVFREALDAVPDKLIAFAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           K+N N AV+K L+  G G D+VS GE+RRALAA +P E+IVFSGVGKT  E+  AL++GI
Sbjct: 61  KSNPNLAVLKVLSREGYGADVVSVGEMRRALAAGMPPEKIVFSGVGKTRAELQAALEAGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
             FN+ESE E   L + A  +G++A  A R+NPD++A TH KISTGK ++KFG+PI Q  
Sbjct: 121 GQFNIESEEEGLELAELAAEMGREAQCALRINPDVDAGTHDKISTGKADNKFGVPISQAG 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            ++   +   GV++ GV +HIGSQ+ ++    +AF  L +L   LR  GH I H+D+GGG
Sbjct: 181 QIFGKLAGQEGVRLRGVAVHIGSQLGELAPLERAFTKLGELVTSLRGAGHTITHVDLGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           LG+ Y +    PS ++Y +++ +   +    +I EPGR +  + G+L+T+V+ +K+    
Sbjct: 241 LGVPYRAGEELPSPAEYGAMVARVTKDWGVSLIFEPGRVIAGNAGVLLTRVVRVKRGIKD 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND  RP LY AYH+    V P G    + A+IVGPICETGD  A+ R    
Sbjct: 301 PFVIVDAAMNDLARPALYGAYHDF-VAVQPRGS--DMTANIVGPICETGDTFAMGRLTDK 357

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL      GAYGA  + +YNSR  + E++V+G +F ++  R+    +++ + +P W
Sbjct: 358 LESGDLAVFRTAGAYGATMASSYNSRGFVAEVLVDGDKFAVVADRIDAGAIMDAERVPEW 417

Query: 420 LQ 421
           L+
Sbjct: 418 LE 419


>gi|332139612|ref|YP_004425350.1| putative diaminopimelate decarboxylase [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327549634|gb|AEA96352.1| putative diaminopimelate decarboxylase [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 416

 Score =  359 bits (922), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 189/413 (45%), Positives = 262/413 (63%), Gaps = 4/413 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LHAE V++  +A    TP Y YS   +E+++  F++A      +VCYA+K
Sbjct: 1   MDYFAYSQGQLHAEEVAVSDIAAQHGTPVYIYSRATLERHWHAFNDAIGEHPHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LGSG DIVS GEL R + A   A ++VFSGVGK  DEI  AL+ GI 
Sbjct: 61  ANSNIGVLSVLAKLGSGFDIVSAGELARVIEAGGDASKVVFSGVGKKHDEIRYALEQGIM 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL  +N+ A  +G KAPI+ R+NPD++A TH  ISTG K +KFGI   +  +
Sbjct: 121 CFNVESEPELHRINEVAGEVGVKAPISLRINPDVDAKTHPYISTGLKANKFGIARERALA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A++LP + + G+D HIGSQ+ +I  F  A + L  L  +L      I+H+DVGGGL
Sbjct: 181 TYELAASLPNLNVVGMDCHIGSQLTEIGPFVDALERLLVLIDELAERNIIIEHLDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP    YA ++  +  G    K+ILEPGR + A+ GILVT+V  IK+  +K
Sbjct: 241 GVTY-NDEEPPHPKAYAQAMAEKMVGRENLKLILEPGRAIAANAGILVTEVEFIKEGEEK 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           +F I+D AMND +RP LY A+ +I  +   +  +LH + D+VGP+CETGDFI  +R++A+
Sbjct: 300 SFAIVDAAMNDLLRPALYSAWQKIIPVKEESTAKLHTY-DVVGPVCETGDFIGKDRELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
             P DLL +   GAYG V +  YNSR    EIMV+G +  ++R R   ++L +
Sbjct: 359 -EPTDLLAVRSAGAYGFVMASNYNSRCRPAEIMVDGDKAIVVREREKQKDLWQ 410


>gi|303248021|ref|ZP_07334287.1| diaminopimelate decarboxylase [Desulfovibrio fructosovorans JJ]
 gi|302490578|gb|EFL50483.1| diaminopimelate decarboxylase [Desulfovibrio fructosovorans JJ]
          Length = 412

 Score =  359 bits (922), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 180/414 (43%), Positives = 271/414 (65%), Gaps = 3/414 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y  G L+AE+V +  L     TP Y YS   + +++  F +AFDG+  + C+++K
Sbjct: 1   MHHFQYRGGELYAEDVPVSTLVAAYGTPLYIYSAATLRRHFAAFDSAFDGLPHLTCFSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV++TL  +G+G+DIVS GEL RALAA +   +IV+SGVGK  +EI+ AL +GI 
Sbjct: 61  ANSNLAVLRTLGAMGAGVDIVSGGELYRALAAGIDPAKIVYSGVGKRGNEIEEALNAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL+ +++ A  LGK A ++ R+NP+++  TH  ISTG K++KFG+ +    +
Sbjct: 121 MFNVESMGELERISRIAARLGKNANVSLRINPNVDPKTHPYISTGLKKNKFGLDMETSLA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A  LPGV   G+D HIGSQ+  IE F +A   +    ++L + G + +++D+GGGL
Sbjct: 181 AYARAMELPGVTPVGIDCHIGSQLTSIEPFLEALDKILIFREKLVAMGISPRYLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y+ +  PP   ++   + +  G+L   ++LEPGR +V + GILVT+V+  KK+  K 
Sbjct: 241 GIQYNEEE-PPHPREFGQALTKALGDLPLTLVLEPGRVIVGNAGILVTEVVYTKKTPSKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FVI+D AMND +RP+LYD+YH I+  V PA +R  ++ D+VGPICE+GDF+A +R++   
Sbjct: 300 FVIVDAAMNDLIRPSLYDSYHAISE-VRPA-ERDTLNVDVVGPICESGDFLARDRELPAV 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELD 414
            PG+ L +   GAYG   S  YNSR    E++V+G    + R R T+++L+ L+
Sbjct: 358 APGEYLAVYSAGAYGFTMSSNYNSRPRAAEVLVDGDTVTLARRRETYEDLVALE 411


>gi|52426139|ref|YP_089276.1| LysA protein [Mannheimia succiniciproducens MBEL55E]
 gi|52308191|gb|AAU38691.1| LysA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 416

 Score =  359 bits (921), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 189/417 (45%), Positives = 265/417 (63%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y    L+AE++ + +LA    TP Y YS   +E+++  F +A      +VC+A+K
Sbjct: 1   MDFFQYKNNKLYAEDLLVSELAEQFGTPLYIYSRATLERHWKAFDSALGDHPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +N N A+++ +A LG+G DIVS+GEL R +AA     ++VFSGV K   EI  AL+  I 
Sbjct: 61  SNPNIAILQVMAKLGAGFDIVSQGELERVIAAGGDPHKVVFSGVAKNEKEIARALELDIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ +N+ A   GK API+ RVNPD++A+TH  ISTG KE+KFG+ + +   
Sbjct: 121 CFNVESLAELQRINEVAGKSGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVDEARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS LP +K++G+D HIGSQ+ +I+ F  A   L  L +QLR +G  ++H+D+GGGL
Sbjct: 181 VYRLASRLPNIKVTGMDCHIGSQLTEIQPFLDATDRLILLLEQLREDGIELEHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYAS-LIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y SD  PP  S+YA+ L+++       +II+EPGR + A+ GILVTKV  +K +   
Sbjct: 241 GVTY-SDETPPHPSEYATALLNKLKQYTNLEIIMEPGRAISANSGILVTKVEYLKSNETH 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY AY  I            I+ D+VGPICET DF+   R++A+
Sbjct: 300 NFAIVDAGMNDMIRPALYQAYMNIIEADRTLNRESKIY-DVVGPICETSDFLGKQRRLAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             PGD L     GAYGA  S TYNSR L  E+MV+GSQ H+IR R    EL  L+S+
Sbjct: 359 A-PGDYLVQRSAGAYGASMSSTYNSRPLTAEVMVDGSQAHLIRRRAELTELWALESL 414


>gi|258593057|emb|CBE69368.1| diaminopimelate decarboxylase [NC10 bacterium 'Dutch sediment']
          Length = 418

 Score =  359 bits (921), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 185/411 (45%), Positives = 257/411 (62%), Gaps = 2/411 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y    L  E + +E++A  V TPFY YS   +  ++ TF  AF  +  +VC+A+K
Sbjct: 1   MHHFQYRGDLLMCEELPIERIAAEVGTPFYLYSHATLTHHFQTFDQAFADIPHLVCFAIK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN A +K  A LGSG D+VS GEL RA+ A +P  RIVF+GVGKT +E+  AL+S I 
Sbjct: 61  ANSNGATLKLFADLGSGADVVSGGELYRAMRAGIPPSRIVFAGVGKTREEMGFALKSDIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL+ LN  A ++G KA +A R+NPD++  TH  ISTG K+ KFGI I     
Sbjct: 121 MFNVESPQELRLLNDVAGAMGTKARVALRINPDVDPKTHPYISTGLKKSKFGIDISLAME 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A  L  + + GV  HIGSQI +I  F  +   +  L  +LR +G  IQ++DVGGGL
Sbjct: 181 EYRVAKELRHIDVVGVHQHIGSQITEIAPFVDSLVKVAGLIAELRQHGFAIQYLDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  D  PP    +A  +     +L C I+LEPGR +V + G+LVTKV+  K++  K 
Sbjct: 241 GITY-KDEDPPVPRVFAEAMIAVIKDLGCTIVLEPGRVIVGNAGVLVTKVLYDKRTPAKH 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F+++D  MND +RP+LY ++H I       G R  + AD+VGP+CE+GDF+A +R +  P
Sbjct: 300 FIVVDAGMNDLVRPSLYGSFHSILPARRQKG-REEVMADVVGPVCESGDFLAKDRSMPAP 358

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELI 411
            PG+LL +   GAYG   S +YNSR  +PEI+V G ++  IR R ++++LI
Sbjct: 359 EPGELLVVMSAGAYGYTMSSSYNSRPRLPEILVKGDRWFTIRERESYEDLI 409


>gi|328954155|ref|YP_004371489.1| diaminopimelate decarboxylase [Desulfobacca acetoxidans DSM 11109]
 gi|328454479|gb|AEB10308.1| diaminopimelate decarboxylase [Desulfobacca acetoxidans DSM 11109]
          Length = 420

 Score =  359 bits (921), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 190/420 (45%), Positives = 266/420 (63%), Gaps = 3/420 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G L+ E V++  +A  V TPFY YS   ++ ++  F  AF     +VC+A+K
Sbjct: 1   MHHFHYSNGQLYCEGVAVAAIAAKVGTPFYLYSHATLQHHFQVFDRAFGETPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN A+++   + G G+DIVS GEL RAL A V   ++V+SGVGK  DEI  AL+ GI 
Sbjct: 61  SNSNLAILRIFINQGGGVDIVSGGELFRALRAGVAPGKVVYSGVGKRPDEIRYALEQGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FN+ES  EL+ LNQ A  +G++A IA RVNPD++  TH  ISTG K++KFGI I +  +
Sbjct: 121 MFNIESPQELQVLNQAAGQMGRRARIALRVNPDVDPQTHPYISTGLKQNKFGIDIDRSVA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A  LP ++I GV  HIGSQ+ Q+  F +    L++L  +LR     I+++D+GGGL
Sbjct: 181 EYLIAKQLPHLEIVGVACHIGSQLTQLSPFIETLGRLKELIARLRREDIQIRYLDIGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y ++  PP   +Y   I Q    L C +ILEPGR LV + GILVTKV+  K++  K 
Sbjct: 241 GIQY-NEETPPHPVEYGRSIIQELQGLDCTLILEPGRVLVGNAGILVTKVLFTKQTEAKY 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F+I D AMND  RP+LY +YH I  +V    DR  + A +VGPICE+GDF+A +R +   
Sbjct: 300 FIIADAAMNDLARPSLYGSYHGIQPVVEK--DRREVTASLVGPICESGDFLAKDRLMPAF 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
            PG+L+ +   GAYG   S  YNSR  +PEI+V+ ++F++IR R T+++LI  + IP  L
Sbjct: 358 DPGELVAVMSAGAYGFTMSSNYNSRPRVPEILVHKNEFYVIRQRETYEDLIRGEEIPICL 417


>gi|229593312|ref|YP_002875431.1| diaminopimelate decarboxylase [Pseudomonas fluorescens SBW25]
 gi|229365178|emb|CAY53443.1| diaminopimelate decarboxylase [Pseudomonas fluorescens SBW25]
          Length = 415

 Score =  359 bits (921), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 190/416 (45%), Positives = 259/416 (62%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y +G L AE V+L  +A    TP Y YS   IE  Y +F++A DG+  +VCYA+K
Sbjct: 1   MDAFNYRDGELFAEGVALSAIAERFGTPTYVYSRAHIEAQYRSFTDALDGVPHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LG+G DIVS GEL R LAA   A++IVFSGVGKT +++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGKADKIVFSGVGKTREDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ES  EL+ L   A  +G +API+ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNIESTDELERLQGVAAEMGVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIADAED 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LP +++ GVD HIGSQ+  +  F  A   L  L  +L   G  + HID+GGG+
Sbjct: 181 VYIRAAQLPNLEVLGVDCHIGSQLTSLPPFLDALDRLLALIDRLGECGIYLHHIDLGGGV 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP  +DY   + +        ++ EPGR++VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEEPPLIADYIQAVRERIEGRDLTLMFEPGRYIVANAGVLLTQVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+  +   V P       + DIVGPICETGDF+A +R++AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMNVT-AVTPRNSEARAY-DIVGPICETGDFLAKDRQLAL- 356

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+G Q   +R R T  EL   +S+
Sbjct: 357 EEGDLLAVHSAGAYGFVMSSNYNTRGRTAEVLVDGDQAFEVRRRETVAELYAGESL 412


>gi|239906765|ref|YP_002953506.1| diaminopimelate decarboxylase [Desulfovibrio magneticus RS-1]
 gi|239796631|dbj|BAH75620.1| diaminopimelate decarboxylase [Desulfovibrio magneticus RS-1]
          Length = 412

 Score =  359 bits (921), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 184/414 (44%), Positives = 264/414 (63%), Gaps = 3/414 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y  G L+AE+V +  L     TP Y YS   + +++  F +AF  +  + CY++K
Sbjct: 1   MHHFEYRGGELYAEDVPVSTLVAAYGTPLYVYSAATLRRHFRAFDSAFAALPHLTCYSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN +V+KTLA +G+G+DIVS GEL RALAA V  ++IV+SGVGK   EI+ AL++GI 
Sbjct: 61  ANSNLSVLKTLAAMGAGMDIVSGGELYRALAAGVDPQKIVYSGVGKRASEIEEALKAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL+ L+  A  LGK A ++ R+NP+++  TH  ISTG K++KFG+ I    +
Sbjct: 121 MFNVESTGELERLSAIASRLGKTAQVSLRINPNVDPKTHPYISTGLKKNKFGLDIDHSLA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A  LPGV   G+D HIGSQ+  I  F +A   +     +L + G   +++D+GGGL
Sbjct: 181 AYAKAMELPGVTPVGIDCHIGSQLTSISPFLEALDKILAFRDKLTAMGIETRYLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y+ +  PP  S++   + +  G+L   +ILEPGR +V + GILVT+ +  KK+  K 
Sbjct: 241 GIQYN-EEEPPHPSEFGQALTKALGDLPITLILEPGRVIVGNAGILVTEAVYTKKTPSKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F+I+D AMND +RP+LYD+YH I   V PAG R  +  D+VGPICE+GDF+A +R +   
Sbjct: 300 FIIVDAAMNDLIRPSLYDSYHAIRE-VRPAG-RPELSVDVVGPICESGDFLARDRALPAV 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELD 414
            PG+ L +   GAYG   S  YNSR    EI+V+G +  + R R ++ +LI L+
Sbjct: 358 APGEHLAVFSAGAYGFTMSSNYNSRPRAAEILVDGDEVIVARRRESYDDLIALE 411


>gi|302381729|ref|YP_003817552.1| diaminopimelate decarboxylase [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192357|gb|ADK99928.1| diaminopimelate decarboxylase [Brevundimonas subvibrioides ATCC
           15264]
          Length = 424

 Score =  358 bits (920), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 190/426 (44%), Positives = 261/426 (61%), Gaps = 8/426 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDG-----MDTMV 55
           M  F+   G+LHAE+V L+ LA  V TP Y YST  + ++Y     A D       D ++
Sbjct: 1   MDHFQLRAGTLHAEDVPLDTLAAEVGTPAYVYSTATLSRHYGVLREAVDAHPAAFGDALI 60

Query: 56  CYALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLAL 115
            +A+KANSN +V+ TLA LGSG D VSEGE+RRAL A +PA RI+FSGVGKT  E+  AL
Sbjct: 61  AFAVKANSNLSVLATLARLGSGADTVSEGEIRRALKAGIPAARIIFSGVGKTDAELAYAL 120

Query: 116 QSGIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPI 175
             G+   NVES +EL  L   A   G    IA RVNP I A  H KI+TG + DKFGIP 
Sbjct: 121 DVGVRQINVESPAELDRLIAVAAEKGACPDIAIRVNPKIGAGGHAKITTGGEGDKFGIPA 180

Query: 176 HQIHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHID 235
            +  +LYA A+  P V   G+  HIGSQI  +     AF+LLR++T  LR  G ++  +D
Sbjct: 181 DEALALYARAAASPHVTPVGLACHIGSQIIDLTPLEAAFRLLREMTLTLRGQGLSVTRLD 240

Query: 236 VGGGLGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKK 295
           +GGGLG+ Y       S +DYA++       L+ +   EPGR L A+ G+L+ +VI I +
Sbjct: 241 LGGGLGVPYSGGAETASVADYAAMAAGVLEGLEVEAAFEPGRLLAANAGVLLARVIQITE 300

Query: 296 SAD-KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALN 354
            AD + F++LD AMND +RP +YDA+HE+  +    GD   I  DIVGP+CETGD  A  
Sbjct: 301 RADGRRFLVLDAAMNDLVRPAMYDAFHEVKPVTPRDGD--LIAYDIVGPVCETGDTFARG 358

Query: 355 RKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELD 414
           R +   + GDL+     GAYGAV S  YNSR L+PE++V+ +++ ++R R T+ E++  +
Sbjct: 359 RDLPPLQAGDLVVFTGAGAYGAVMSSEYNSRPLVPEVLVDEARWAVVRGRPTYDEMLTRE 418

Query: 415 SIPAWL 420
           ++  WL
Sbjct: 419 TVAGWL 424


>gi|307322647|ref|ZP_07601981.1| diaminopimelate decarboxylase [Sinorhizobium meliloti AK83]
 gi|306891709|gb|EFN22561.1| diaminopimelate decarboxylase [Sinorhizobium meliloti AK83]
          Length = 447

 Score =  358 bits (920), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 183/426 (42%), Positives = 267/426 (62%), Gaps = 3/426 (0%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           +  Y  G L  E + +E +A  V TPFYCYS + I   +   ++    ++ +VC+A+KAN
Sbjct: 20  SLSYRNGKLFIEKLPVEDIAAEVWTPFYCYSASTIRNAFTLLADKLKPVNALVCFAVKAN 79

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN +++K LA LG G+DIVS GEL RAL A V   +IVFSGVGKT  EI  AL+ GI+  
Sbjct: 80  SNISILKLLADLGCGMDIVSGGELERALEAGVAPSKIVFSGVGKTRREIRRALEVGIHQL 139

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES +EL+++ + A  LG +AP+ FRVNPD++A+TH KISTGKK DKFGI I  I  LY
Sbjct: 140 NVESPAELESIREVARDLGCRAPVVFRVNPDVDAHTHAKISTGKKGDKFGINIELIKELY 199

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
           A A+  P + ++G+ +HIGSQ+  +  +  A++ L  L  QLR+    ++ +D+GGGLGI
Sbjct: 200 AKAAACPELDVAGLAVHIGSQLLNLSPYRAAYRRLASLVDQLRTLDLPVRRLDLGGGLGI 259

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y      P   +YA+++ +  G L C++ +EPGR+LV   G+LVT+V+++K++      
Sbjct: 260 NYDFGVG-PDVGEYAAIVEETVGGLHCELTVEPGRWLVGPAGLLVTEVLNLKEAGGTVLA 318

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND MRP LYDA H +  + N      H +  IVGP+CE+ D       +   + 
Sbjct: 319 IVDAAMNDLMRPALYDAVHPVLPLQNLGNCSAHPY-QIVGPVCESSDVFGTYDALPPLQS 377

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWLQK 422
           G  +     GAYGA  + TYNSR LI E++V+  +F +IR R T Q+L+EL+    W QK
Sbjct: 378 GVRIAFGCAGAYGASMASTYNSRDLIAEVLVDADRFRLIRRRQTIQDLLELERATPW-QK 436

Query: 423 TPKQSS 428
           +  +++
Sbjct: 437 SCSETN 442


>gi|33151309|ref|NP_872662.1| diaminopimelate decarboxylase [Haemophilus ducreyi 35000HP]
 gi|33147529|gb|AAP95051.1| diaminopimelate decarboxylase [Haemophilus ducreyi 35000HP]
          Length = 417

 Score =  358 bits (920), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 192/411 (46%), Positives = 262/411 (63%), Gaps = 4/411 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y    L AE V+++ LA    TP Y YS   +E+++  F  AF     ++C+A+K
Sbjct: 1   MNHFAYKHHQLFAEKVAVKALATQYGTPAYIYSRATLEQHWRAFDEAFGDRPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +N N AV+  +A LGSG DIVS+GEL R LAA     +IVFSGV K+  EI  AL  GI+
Sbjct: 61  SNPNLAVLNVMAKLGSGFDIVSQGELERVLAAGGDPAKIVFSGVAKSHIEIRRALAVGIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL  +NQ A  LGK A I+ RVNPD++A TH  ISTG KE+KFGI + Q  +
Sbjct: 121 CFNVESVAELHRINQIAGELGKIATISLRVNPDVDAGTHPYISTGLKENKFGISVQQARA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS LP +++ G+D HIGSQ+ +++ F  A   L  L +QL  +G  + H+D+GGGL
Sbjct: 181 VYQLASRLPHIQVVGLDCHIGSQLTELQPFLDAADRLIVLLEQLYRDGIRLSHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ YH++  PP  ++Y   +   F +  + +IILEPGR + AD GILVTKV  +K + D+
Sbjct: 241 GVVYHTE-TPPQPAEYVRALLAKFAHYPELEIILEPGRAITADAGILVTKVEYLKSNEDR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LYDAY  I+  V+ +  R+    ++VGPICET DF+   R +A+
Sbjct: 300 HFAIVDTGMNDLLRPALYDAYMHISE-VDQSLKRVEQQYEVVGPICETADFLGKARTLAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
              GDLL +   GAYGA  S TYNSR    EIMV+G+  H+I+ R  F EL
Sbjct: 359 AE-GDLLAVYSAGAYGASMSSTYNSRPQAVEIMVDGATSHLIKKRSDFAEL 408


>gi|325579300|ref|ZP_08149256.1| diaminopimelate decarboxylase [Haemophilus parainfluenzae ATCC
           33392]
 gi|325159535|gb|EGC71669.1| diaminopimelate decarboxylase [Haemophilus parainfluenzae ATCC
           33392]
          Length = 416

 Score =  358 bits (920), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 188/417 (45%), Positives = 266/417 (63%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y    L+ E++ +++LA    TP Y YS   +E+++  F +A      ++CYA+K
Sbjct: 1   MDFFQYKNEQLYVEDLPVKQLAEEFGTPLYIYSRATLERHWHAFDSALGEHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  ++  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+  EI  AL+ GI 
Sbjct: 61  ANSNIGILNVMAKLGSGFDIVSQGELERVLAAGGEASKVVFSGVAKSRAEIMRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL  +NQ A  +GK API+ RVNPD++A+TH  ISTG KE+KFG+ + +   
Sbjct: 121 CFNVESVAELHHINQIAGEMGKVAPISLRVNPDVDAHTHPYISTGLKENKFGVSVDEARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+TLP VKI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYKLATTLPHVKITGMDCHIGSQLTELQPFLDATDRLIRLIEQLKEDGITLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDY-ASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  SDY A+L+++       +IILEPGR + A+ GILV KV  +K +  +
Sbjct: 241 GVTY-TDETPPHPSDYAAALLNKLKDYEDLEIILEPGRAITANAGILVAKVQYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I D  MND +RP LY+AY  I  I +   +R     D+VGP+CET DF+   R++A+
Sbjct: 300 NFAITDTGMNDMIRPALYEAYMNIIEI-DRTLEREKTIYDVVGPVCETSDFLGKQRELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GD +     GAYGA  S  YNSR    E++V+G + H+IR R    EL  L+SI
Sbjct: 359 AE-GDYIAQRSAGAYGASMSSNYNSRPRTAEVLVDGDKAHLIRRRENLSELWALESI 414


>gi|206603531|gb|EDZ40011.1| Diaminopimelate decarboxylase [Leptospirillum sp. Group II '5-way
           CG']
          Length = 414

 Score =  358 bits (919), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 180/416 (43%), Positives = 259/416 (62%), Gaps = 3/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L  E+V + K+   V +P Y YS  A+ + Y ++  AF    TM+ YA+K
Sbjct: 1   MNGFEYKGHELFVEDVPVRKIVSSVDSPVYIYSEKALREAYSSYQEAFQSHRTMIAYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           AN N  ++  L  +GSG D+VS GEL RA  A +P++RIVF+GVGKT  E+  A+ +GI 
Sbjct: 61  ANGNLQILSMLGKMGSGADVVSGGELFRARRAGIPSDRIVFAGVGKTEGEMREAIDAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL  L++ A S+GK AP+A RVNPD++  TH  ISTG K+ KFGIP+ Q   
Sbjct: 121 MFNVESSMELDRLSRVASSMGKVAPVALRVNPDVDPKTHPYISTGMKKSKFGIPVDQALE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A+ LPG++I G+  HIGSQ+ +I  F  AF  +    + L+ NG  +  +DVGGGL
Sbjct: 181 EYRRAARLPGIRIVGIHQHIGSQLTEISPFRDAFDRMVAFARLLKENGIEVSWLDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  + +PP+  + A  I      L   IILEPGR +V + GILVT+V  +K+++ K 
Sbjct: 241 GIRY-GNEKPPTPREVAHEILSRLEGLNVGIILEPGRSIVGNAGILVTEVQYLKETSVKM 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I D  MND +RP+LY A+H++  ++   G+      D+VGP+CETGDF+  +R++   
Sbjct: 300 FYIADAGMNDLIRPSLYGAFHDLWPVIKKPGN--GKKGDLVGPVCETGDFLVQDRELPPV 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            PGDLL +   GAYG   +  YN+R    E++V+G +F +IR R T+++LI  + I
Sbjct: 358 EPGDLLAVMSAGAYGFAMASNYNARPRPAEVLVSGDRFSVIRARETYEDLIRGEGI 413


>gi|330444897|ref|ZP_08308552.1| diaminopimelate decarboxylase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489207|dbj|GAA03049.1| diaminopimelate decarboxylase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 416

 Score =  358 bits (919), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 190/418 (45%), Positives = 265/418 (63%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFEG-SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y +   L AE+V L +LA    TP Y YS   +E+++  F  A      ++CYA+
Sbjct: 1   MDHFNYQQNDQLWAEDVPLAQLAEQYGTPLYVYSRATLERHWKAFDEAVATQPHLICYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+  LA LGSG DIVS+GEL R +AA     ++VFSGVGKT  E+  AL+ GI
Sbjct: 61  KANSNLGVLNVLARLGSGFDIVSQGELERVIAAGGDPAKVVFSGVGKTSAEMKRALELGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN  A  LG  API+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNLVAEQLGVIAPISLRINPDVDAKTHPYISTGLRDNKFGIAFERAV 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y  A +LP +K+ G+D HIGSQ+ +I  F  A   L  L  +L++ G  I+H+D+GGG
Sbjct: 181 EVYRLAHSLPHLKVVGMDCHIGSQLTEITPFIDATDRLLALVDELKAEGIAIEHLDLGGG 240

Query: 240 LGIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y SD +PP  +DYA +L+ +     + ++I EPGR + A+ G+L+TKV  +K +  
Sbjct: 241 LGVTY-SDEQPPLPADYAKALLGRLESYPELELIFEPGRAIAANAGVLLTKVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND +RPTLY A+ +I   V P      ++ D+VGPICETGDFI  +R + 
Sbjct: 300 KNFAIVDAAMNDLIRPTLYSAWQDI-VPVTPRQGEAQVY-DLVGPICETGDFIGKDRSLC 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L + GDLL +   GAYG V +  YN+R    E++V+G Q H++R R T  +L +L+ I
Sbjct: 358 LAQ-GDLLAVRSAGAYGFVMASNYNTRARAAEVIVDGEQVHLVRERETLAQLWQLEHI 414


>gi|283850737|ref|ZP_06368024.1| diaminopimelate decarboxylase [Desulfovibrio sp. FW1012B]
 gi|283573980|gb|EFC21953.1| diaminopimelate decarboxylase [Desulfovibrio sp. FW1012B]
          Length = 412

 Score =  358 bits (919), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 184/414 (44%), Positives = 264/414 (63%), Gaps = 3/414 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G L+AE+V +  L     TP Y YS   + +++  F +AF G+  + C+++K
Sbjct: 1   MHHFAYRGGELYAEDVPVSTLVAAYGTPLYVYSAATLRRHFTAFDSAFGGLPHLTCFSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN +V+KTLA +G+G+DIVS GEL RALAA V  E+IV+SGVGK   EI+ AL +GI 
Sbjct: 61  ANSNLSVLKTLAAMGAGVDIVSGGELYRALAAGVAPEKIVYSGVGKRAAEIEQALTAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL+ ++  A  LGK A ++ R+NPD++  TH  ISTG K++KFG+ I    +
Sbjct: 121 MFNVESLGELERISAIAKRLGKTAQVSLRINPDVDPKTHPYISTGLKKNKFGLDIENSLA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A  LP +   G+D HIGSQ+  I  F +A   +    ++L + G   +++D+GGGL
Sbjct: 181 AYAKAMELPNITPVGIDCHIGSQLTSISPFLEALDKILTFREKLCAMGIVPRYLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  +  PP   ++   + +  G+L   +ILEPGR +V + GILVT+V+  KK+  K 
Sbjct: 241 GIQYDEED-PPHPKEFGEALTKALGDLPMTLILEPGRVIVGNAGILVTEVVYTKKTPSKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FVI+D AMND +RP+LYD++H I   V PAG R  ++ D+VGPICE+GDF+A +R +   
Sbjct: 300 FVIVDAAMNDLIRPSLYDSFHAIRE-VRPAG-RETLNVDVVGPICESGDFLARDRDLPAV 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELD 414
            PG+LL +   GAYG   S  YNSR    E++V+G    + R R T+++LI L+
Sbjct: 358 APGELLAVYSAGAYGFTMSSNYNSRPRAAEVLVDGETVTVARRRETYEDLIALE 411


>gi|301057683|ref|ZP_07198758.1| diaminopimelate decarboxylase [delta proteobacterium NaphS2]
 gi|300448229|gb|EFK11919.1| diaminopimelate decarboxylase [delta proteobacterium NaphS2]
          Length = 420

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 190/420 (45%), Positives = 262/420 (62%), Gaps = 3/420 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y E  L+ E+V +  +A  V TP Y YS   +++++  F  AF  +  + CY++K
Sbjct: 1   MHHFHYKENELYCEDVPISAIAAKVGTPAYVYSHATLKQHFDAFDGAFGDVKHLTCYSMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN+A++   A  G G+DIVS GEL RAL A V   RIVFSGVGK++ +++ A+ S I 
Sbjct: 61  SNSNKALLALFAGRGGGVDIVSGGELYRALNAGVDPSRIVFSGVGKSLSDLEYAVSSDIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL  LNQ A   G+KA I+ RVNPD++  TH  ISTG KE+KFGI + +   
Sbjct: 121 MFNVESPQELLKLNQVAREKGRKARISIRVNPDVDPKTHPYISTGLKENKFGIGVEEAIR 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A+TL GV++ GV  HIGSQ+ +   F  A K L++L  +L      I+++D+GGGL
Sbjct: 181 QYEKATTLKGVEVVGVSCHIGSQLTRTSPFVDALKKLKELIARLEKMNIAIRYLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y ++  PP    YA  I +   +    +ILEPGR +V + GILV KV+  K S +K 
Sbjct: 241 GITYDNE-VPPHPKQYAQDIKRELASSDWTLILEPGRVIVGNAGILVAKVLYAKTSHEKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F ++D AMND MRP+LY AYH I  +    G+RL   AD+VGPICE+GDF+A +R I   
Sbjct: 300 FFVVDAAMNDLMRPSLYGAYHGIQPVKKTPGERL--KADVVGPICESGDFLAKDRLIETL 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
              DL+ +   GAYG   S TYNSR  + E+MV+  +F +IR R TF +L+  +SIP +L
Sbjct: 358 TSEDLIAVMSAGAYGFSMSSTYNSRPRVCEVMVSEDRFEVIRERETFADLVRGESIPRFL 417


>gi|332994942|gb|AEF04997.1| putative diaminopimelate decarboxylase [Alteromonas sp. SN2]
          Length = 416

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 190/411 (46%), Positives = 255/411 (62%), Gaps = 4/411 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G L AE+V++  +A   QTP Y YS   +E+++  F++A      ++CYA+K
Sbjct: 1   MDFFAYKNGQLFAEDVAVADIAAQYQTPVYVYSRATLERHWHAFNDAIGEHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+ TLA +GSG DIVS GEL R + A   A ++VFSGVGK  DEI  AL+ GI 
Sbjct: 61  ANSNLGVLSTLAKIGSGFDIVSGGELARVIEAGGDASKVVFSGVGKKADEIRYALEQGIM 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL  +N  A SLGKKAPI+ R+NPD++A TH  ISTG K +KFGI   +   
Sbjct: 121 CFNVESEPELHRINAVAESLGKKAPISLRINPDVDAKTHPYISTGLKANKFGIARERALQ 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A++LP + + G+D HIGSQ+ +I  F  A + L  L  +L   G  I H+DVGGGL
Sbjct: 181 TYELAASLPYLNVVGMDCHIGSQLTEIGPFVDALERLLLLIDELAERGITIDHLDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDY-ASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y+ D  PP    Y A++  +  G    K+ILEPGR + A+ GILVT+V  IK+  +K
Sbjct: 241 GVTYN-DEEPPHPKAYAAAMAEKMVGRENLKLILEPGRAIAANAGILVTEVEFIKEGEEK 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           +F I+D AMND +RP LY A+  I   V         + D+VGP+CETGDFI  +R++A+
Sbjct: 300 SFAIVDAAMNDLLRPALYSAWQNI-IPVKQESTATARNYDVVGPVCETGDFIGKDRELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
             P DLL +   GAYG   +  YNSR    EIMV+G    ++R R   ++L
Sbjct: 359 -EPTDLLAVRSAGAYGFAMASNYNSRCRPAEIMVDGDATIVVREREILKDL 408


>gi|254447342|ref|ZP_05060808.1| diaminopimelate decarboxylase [gamma proteobacterium HTCC5015]
 gi|198262685|gb|EDY86964.1| diaminopimelate decarboxylase [gamma proteobacterium HTCC5015]
          Length = 418

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 185/414 (44%), Positives = 256/414 (61%), Gaps = 4/414 (0%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           A +  +G L  + VSL+++A    TP Y YS   IE  +  +  A      ++CYA+KAN
Sbjct: 8   ASQRVDGELCIDGVSLKRIASTYGTPAYVYSRQHIESAWRAYDEALGSWPHLICYAVKAN 67

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN  V+  LA LG+G DIVS GEL R L A   A+ IVFSGVGKT +E+  AL  GI CF
Sbjct: 68  SNLGVLSVLAKLGAGFDIVSGGELERVLRAGGEAKNIVFSGVGKTAEEMRRALDVGIRCF 127

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES +EL  LN+ A  +GK API+ RVNPD++A TH  ISTG KE+KFG+ + Q  ++Y
Sbjct: 128 NVESHAELLRLNRVAEEMGKTAPISLRVNPDVDAQTHPYISTGLKENKFGVAVDQALAVY 187

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
             A  LP + I G+D HIGSQ+  I+ F  A K +  L  QL +    I H+D+GGGLGI
Sbjct: 188 READALPNIAIHGLDCHIGSQLTTIDPFVDALKRVLALVDQLAAEDIEIHHLDLGGGLGI 247

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y  D +PP+ ++    +    G  + +++ EPGR +V + G+L+T+V  +K S DK F 
Sbjct: 248 CYR-DEQPPAVAELMQALTNTLGERRFELLFEPGRSIVGNAGVLLTQVEYLKHSDDKNFA 306

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND MRP+LY A+  I+ +    G+      DIVGPICETGDF+  +R++ L   
Sbjct: 307 IVDAAMNDLMRPSLYSAWQAIDAVEQREGNAKPY--DIVGPICETGDFLGKDRELVL-EE 363

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           GDLL ++  GAYG   +  YN+R    E+MV+     +IR R TF++LIE + +
Sbjct: 364 GDLLAVQSCGAYGFTMASNYNTRPRAVELMVDAGDIKVIRQRETFEQLIEGEQV 417


>gi|262376587|ref|ZP_06069815.1| diaminopimelate decarboxylase [Acinetobacter lwoffii SH145]
 gi|262308297|gb|EEY89432.1| diaminopimelate decarboxylase [Acinetobacter lwoffii SH145]
          Length = 414

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 184/414 (44%), Positives = 258/414 (62%), Gaps = 3/414 (0%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           +F    G LHAE  SL++LA    TP Y YS   +EK++L    AF+ +D  +C+A+K+N
Sbjct: 2   SFTRINGVLHAEQCSLQQLAEQFGTPLYVYSKATLEKHFLDMDRAFNFIDHQICFAVKSN 61

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+  LA  G+G DIV+ GEL R L A     +IVFSG+GK+  +I  AL+ GI CF
Sbjct: 62  SNLAVLNVLAKQGAGFDIVTGGELARVLKAGGEPSKIVFSGLGKSEADIKKALEVGIACF 121

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES +EL  + + A  L  KAPI+ RVNPD++A TH  ISTG KE+KFGIP   +   Y
Sbjct: 122 NVESYAELDRIQKVAAELNVKAPISLRVNPDVDAKTHPYISTGLKENKFGIPSDSVFETY 181

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
            YA++LP + + G+D HIGSQ+ + + F  A   +  +  QL+  G +++HID+GGGLG+
Sbjct: 182 QYAASLPNLDVVGIDCHIGSQLTETQPFVDALDRVIVMIDQLKEMGIHLKHIDIGGGLGV 241

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y  D  PPS  +YA+ +      L  K+ +EPGR + A+ G+L+TKV  +K +  + F 
Sbjct: 242 TY-KDETPPSVEEYANALRPALEKLGLKVYMEPGRSISANAGVLLTKVDLLKPTNHRNFA 300

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND +RP LY+A+ +I   V P  D      DIVG ICETGDF+   R++A+ + 
Sbjct: 301 IIDAAMNDLIRPALYEAWMDIQP-VRPRTDAETKEWDIVGAICETGDFLGKERELAI-KE 358

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            D+L +   GAYG V S  YNSR    E+MV+  Q H+IR R T + L E + +
Sbjct: 359 NDVLAVLGAGAYGFVMSSNYNSRGRAAEVMVDADQAHLIRERETIESLWERERL 412


>gi|152977874|ref|YP_001343503.1| diaminopimelate decarboxylase [Actinobacillus succinogenes 130Z]
 gi|150839597|gb|ABR73568.1| diaminopimelate decarboxylase [Actinobacillus succinogenes 130Z]
          Length = 415

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 189/420 (45%), Positives = 266/420 (63%), Gaps = 11/420 (2%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L+AE+  + +LA    TP Y YS   +E+++  F +AF     ++C+A+K
Sbjct: 1   MDFFHYKNHKLYAEDCEITQLAEQFGTPLYVYSKATLERHWHAFDDAFGDYPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN AV++T+A LGSG DIVS+GEL R LAA     ++VFSGV KT  EI  AL+ GI 
Sbjct: 61  SNSNIAVLQTMARLGSGFDIVSQGELERVLAAGGDPGKVVFSGVAKTETEITRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL  +N+ A  LGK API+ RVNPD++A+TH  ISTG KE+KFG+ + Q   
Sbjct: 121 CFNVESIPELYRINEVAGKLGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVDQARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LP + ++G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYRRAAELPHIAVTGMDCHIGSQLTELQPFLDAADRLVVLMEQLKQDGVQLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y S+  PP  +DYA+ + Q       +IILEPGR + A+ G+LVTKV  +K +    
Sbjct: 241 GVTY-SNETPPHPTDYATALLQKLQAYNLEIILEPGRAICANAGVLVTKVEYLKSNETHN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHA----DIVGPICETGDFIALNRK 356
           F I+D  MND +RP LY+AY  +N I     DR    A    D+VGPICET DF+   R+
Sbjct: 300 FAIVDAGMNDMIRPALYEAY--MNII---EADRTLPRAKAVYDVVGPICETSDFLGKKRE 354

Query: 357 IALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +A+   GD L     GAYGA  S  YNSR    E+MV+G +  +IR R ++Q L +L+++
Sbjct: 355 LAIA-AGDYLVQRSAGAYGASMSSNYNSRPRTAEVMVDGDKAFLIRRRESYQNLWQLENL 413


>gi|220933233|ref|YP_002512132.1| diaminopimelate decarboxylase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219994543|gb|ACL71145.1| diaminopimelate decarboxylase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 414

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 182/416 (43%), Positives = 257/416 (61%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y +G LHAE V L ++A    TP Y YS   +E+++  F  A      ++CYA+K
Sbjct: 1   MDHFQYRDGVLHAEEVPLSQIAAAHGTPCYVYSRATLERHWRAFDTALGDHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANS+ AV+  LA LGSG DIVS GEL R L A   A R+VFSGVGK  DE+  AL+ GI 
Sbjct: 61  ANSSLAVLNVLARLGSGFDIVSVGELERVLRAGGEASRVVFSGVGKRADEMRRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE+EL  LN  A  LG +AP++ RVNPD++A TH  ISTG KE+KFG+ I    +
Sbjct: 121 CFNVESEAELARLNGVAGELGVEAPVSIRVNPDVDARTHPYISTGLKENKFGVDIRVAPA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LY  A+ +  +++ GVD HIGSQ+  +  F  A K + +L + L ++G  + H+D+GGGL
Sbjct: 181 LYRQAADMAHIRVVGVDCHIGSQLTGLSPFVDALKRVLELARTLEADGIGLDHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  D  PP    YA  + +   + + +I+LEPGR +  + G+L+T+V  +K +  K 
Sbjct: 241 GIRYR-DEEPPLPDAYARALFEGLADTRYEILLEPGRAIAGNAGVLLTRVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F ++D AMND +RP LY A+ EI  +    G+      D+VGP+CETGDF+   R + L 
Sbjct: 300 FAVVDAAMNDLIRPALYGAWQEIVPVAPRLGESRTY--DVVGPVCETGDFLGKERALVLA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              DLL +   GAYG   S  YN+R    E+MV+G Q H++  R + +EL+  +++
Sbjct: 358 ED-DLLAVRSAGAYGFTMSSNYNTRPRAAEVMVDGEQVHLVNRRESLEELMARETL 412


>gi|254427501|ref|ZP_05041208.1| diaminopimelate decarboxylase [Alcanivorax sp. DG881]
 gi|196193670|gb|EDX88629.1| diaminopimelate decarboxylase [Alcanivorax sp. DG881]
          Length = 413

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 192/417 (46%), Positives = 264/417 (63%), Gaps = 7/417 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y +G L AE + +E+LA    TP Y YS  A+E++YL F  AF      VCYA+K
Sbjct: 1   MDPFQYRDGELFAEELPVEQLADRFGTPLYLYSRAALERHYLAFDEAFGDHPHQVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA  G+G DIVS GEL R L A    ++IVFSGVGKT DE+  AL++ I+
Sbjct: 61  ANSNLAVLNVLARCGAGFDIVSGGELERVLRAGGDPDKIVFSGVGKTADEMAAALKANIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN  A  L ++APIA RVNPD++A TH  ISTG K++KFG+ I +  +
Sbjct: 121 CFNVESAAELELLNLVAGELDREAPIAIRVNPDVDAQTHPYISTGLKDNKFGVDITKAPA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LY  A+ LP ++I G+D HIGSQ+ ++  F  A + +  L  QL+ +G  I H+D+GGGL
Sbjct: 181 LYQRAAELPHIRILGIDCHIGSQLTKLAPFEDALERVLKLLAQLQEHGIEIHHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y  D  PP  S Y  +L+    G L   I  EPGR + A+ G+ +T+V+ +K +  K
Sbjct: 241 GVTY-DDETPPDRSAYVQALLKHIPGELPVHI--EPGRSIAANAGLFITQVLFLKPTEHK 297

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D AMND +RP+LY A+  I   V P  D      DIVGP+CETGDF+  +R ++L
Sbjct: 298 NFAIVDGAMNDLIRPSLYSAWQNI-VPVKPH-DADCREWDIVGPVCETGDFLGKDRALSL 355

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GDLL +   GAYG   +  YNSR    EIMV+G Q  ++R R T+ + ++ +S+
Sbjct: 356 -ETGDLLAVRSAGAYGFAMASNYNSRNRPAEIMVDGDQAFVVRQRETYDDQLKQESL 411


>gi|242279430|ref|YP_002991559.1| diaminopimelate decarboxylase [Desulfovibrio salexigens DSM 2638]
 gi|242122324|gb|ACS80020.1| diaminopimelate decarboxylase [Desulfovibrio salexigens DSM 2638]
          Length = 412

 Score =  357 bits (915), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 184/415 (44%), Positives = 259/415 (62%), Gaps = 3/415 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+     LHAEN+S+ +LA    TP Y YS   + +++  F +AF G+D M CY++K
Sbjct: 1   MHHFEIKNNELHAENISITELAKEYGTPLYIYSAATLRRHFEAFDSAFTGLDHMTCYSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN +V+K LA +G+G+DIVS GEL RAL A VPA +IVFSGVGK   EI  AL++ I 
Sbjct: 61  ANSNLSVLKLLAEMGAGMDIVSGGELFRALKAGVPASKIVFSGVGKKAYEIAEALKADIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  E+  +N+ A S+ K A I+FR+NPD++  TH  ISTG K++KFG+ +     
Sbjct: 121 MFNVESVGEMHRINEVAESMNKTARISFRINPDVDPKTHPYISTGMKKNKFGLDMETAKE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A  L  V   G+D HIGSQ+  IE F +A   L     +L + G  I+H+D+GGGL
Sbjct: 181 AYKTAKELSNVSPIGMDCHIGSQLTTIEPFLEALDKLLAFRDELGAMGIEIEHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  +  PP   ++   + +   +   K+ILEPGR +  + GILV +VI  KK+  K 
Sbjct: 241 GITY-DEEEPPHPKEFGEALSKALADKGLKVILEPGRVIAGNAGILVGEVIYTKKTPTKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F+I+D AMND +RP+LY +YH I  +     +R  I  D+VGPICE+GDF+A +R +   
Sbjct: 300 FLIVDAAMNDLVRPSLYQSYHRIAEVTQ--NNRPEIDYDVVGPICESGDFLAKDRMLPEM 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
           + G+L+ +   GAYG   S  YNSRL   EI+V+G    + R R T+++L+ L+S
Sbjct: 358 KQGELIAVFSAGAYGFTMSSNYNSRLRAAEIIVDGDDVIMARRRETYEDLLRLES 412


>gi|91791757|ref|YP_561408.1| diaminopimelate decarboxylase [Shewanella denitrificans OS217]
 gi|91713759|gb|ABE53685.1| diaminopimelate decarboxylase [Shewanella denitrificans OS217]
          Length = 414

 Score =  356 bits (914), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 184/412 (44%), Positives = 264/412 (64%), Gaps = 4/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y + +L AE+ S+ ++A    TP Y YS   +E+++  F +A      ++CYA+K
Sbjct: 1   MDHFIYQDQNLFAESCSVAEIAQQHGTPVYIYSRATLERHWRAFDDAVGTHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R + A    +++VFSGVGKT++E+  AL+ GIY
Sbjct: 61  ANSNLAVLNVLARLGSGFDIVSGGELARVIEAGGDPKKVVFSGVGKTVEEMQQALELGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN  A SL  KAP++ R+NPD++A TH  ISTG KE+KFGI + +   
Sbjct: 121 CFNVESSAELEQLNLVAQSLNTKAPVSLRINPDVDAGTHPYISTGLKENKFGIAMEEAEQ 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++  A+ L  + + GVD HIGSQ+ +++ F  A   L  L  +L + G  + H+DVGGGL
Sbjct: 181 VFVRAAALSHIDVKGVDCHIGSQLTELKPFLDAMDRLLGLVDRLTALGIELSHLDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y ++  PP+   YA+ + +  G  +  +I EPGR + A+ GI VT+V+ +K++++K 
Sbjct: 241 GVPYDNE-TPPAPQVYAAALVERLGERKLTLIFEPGRAIAANAGIFVTQVLYLKENSNKR 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ +I  I     D      DIVGP+CETGDF+  +R++A+ 
Sbjct: 300 FAIVDGAMNDLLRPALYSAWQKI--IPVQQSDAATQAFDIVGPVCETGDFLGKDRQLAVV 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
             GDLL I   GAYG   S  YNSR  + EIMV+GSQ  ++R R   Q+L +
Sbjct: 358 -AGDLLAIRSCGAYGFAMSSNYNSRPRVAEIMVDGSQAFVVREREKRQQLWQ 408


>gi|312795814|ref|YP_004028736.1| Diaminopimelate decarboxylase [Burkholderia rhizoxinica HKI 454]
 gi|312167589|emb|CBW74592.1| Diaminopimelate decarboxylase (EC 4.1.1.20) [Burkholderia
           rhizoxinica HKI 454]
          Length = 420

 Score =  356 bits (914), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 192/419 (45%), Positives = 257/419 (61%), Gaps = 6/419 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           ++AF Y +  LH E V   +LA    TP Y YS  A+   Y  ++ A  G    V YA+K
Sbjct: 2   VNAFAYVDAQLHVERVPAGQLAEQYGTPLYVYSRAALTDAYQAYAGACTGRRAKVHYAVK 61

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+   A LG+G DIVS GEL R LAA      +VFSGVGK   ++ +AL++G+ 
Sbjct: 62  ANSNLAVLNVFARLGAGFDIVSGGELARVLAAGGKPHDVVFSGVGKNAADMRMALEAGVR 121

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL  LNQ A   G+ API+ RVNPD++A TH  ISTG K +KFG+      +
Sbjct: 122 CFNVESLAELARLNQIAGESGRIAPISLRVNPDVDAKTHPYISTGLKANKFGVAFDDARA 181

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A  +  V+I+G+D HIGSQI +I  +  A   + +L  Q+ ++G  I HIDVGGGL
Sbjct: 182 AYRTALGMKHVRIAGIDCHIGSQITEISPYLDAIDKVLELVAQVEADGAPIDHIDVGGGL 241

Query: 241 GIAYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSA 297
           GI Y  D  PP+   +   I  +F   G+   +I  EPGR LV + GIL+T+V  +K  A
Sbjct: 242 GIRY-DDETPPNIGTFVKTILDHFDRRGHGHREIWFEPGRSLVGNAGILLTRVEYLKPGA 300

Query: 298 DKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKI 357
            K F I+D AMND  RP +YDAYH I+  V P   R  +  DIVGP+CE+GD++A +R +
Sbjct: 301 VKHFAIVDAAMNDLARPAMYDAYHAID-AVAPRDGRPPVTYDIVGPVCESGDWLARDRSL 359

Query: 358 ALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           AL  PGDLL I  TGAYG V S  YN+R    E++V+G Q H+ R R T  +L++ +S+
Sbjct: 360 AL-EPGDLLAIRSTGAYGFVMSSNYNTRPRAAELLVDGEQVHVARRRETLAQLMDGESV 417


>gi|226938955|ref|YP_002794026.1| DcdA [Laribacter hongkongensis HLHK9]
 gi|226713879|gb|ACO73017.1| DcdA [Laribacter hongkongensis HLHK9]
          Length = 417

 Score =  356 bits (914), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 181/411 (44%), Positives = 256/411 (62%), Gaps = 2/411 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+AF Y    L  E++ L ++A    TP Y Y+ +A+ + Y  +SNAF GM  +VCYALK
Sbjct: 1   MNAFHYQNRELCVEDIPLARIAEQYGTPCYVYAESALTQAYSAYSNAFAGMPHLVCYALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN +VI+  A LG+G D VS GE+ R LAA   A +IVFSGVGK+  E+  AL+ GI+
Sbjct: 61  ANSNLSVIRHFASLGAGFDTVSIGEIERVLAAGGEAGKIVFSGVGKSAAEMRRALEIGIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ L+  A  LGK+AP++ R+NP+++A TH  ISTG K +KFGI       
Sbjct: 121 CFNVESVNELERLDTVARELGKRAPVSLRINPNVDARTHPYISTGLKNNKFGIAYDIARQ 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A+ LP + + G+D HIGSQ+        A   L  L  QL  +G  ++H+D+GGGL
Sbjct: 181 SYRRAAELPNLDVIGIDCHIGSQLTDSTPLIDALDRLLVLVDQLSEDGIRLRHVDIGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y +D  PP    YA  I +        +++EPGR LV + G+L+T+V  +K+   K 
Sbjct: 241 GIRY-ADETPPDLQQYADAIRERLAGRDLALLMEPGRSLVGNAGVLLTRVEYLKEGDGKH 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F ++D AMND MRP+ Y A+H+I  +     + L    D+VGPICE+ DF+  +R +AL 
Sbjct: 300 FAVVDAAMNDLMRPSYYQAFHDIRPVTQHDAELLPALYDVVGPICESSDFLGKDRALAL- 358

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELI 411
           R GDL+ +  +GAYG+  S  YN+R    E++VNG    ++R R TF++LI
Sbjct: 359 REGDLIAVMSSGAYGSTMSSNYNTRPRAAEVLVNGRHVRLVRARETFEQLI 409


>gi|109900371|ref|YP_663626.1| diaminopimelate decarboxylase [Pseudoalteromonas atlantica T6c]
 gi|109702652|gb|ABG42572.1| diaminopimelate decarboxylase [Pseudoalteromonas atlantica T6c]
          Length = 415

 Score =  356 bits (914), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 193/417 (46%), Positives = 257/417 (61%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L+AE+VSL  +A    TP Y YS   IE+++L F  A      +VCYA+K
Sbjct: 1   MDFFGYNNKKLYAEDVSLHDIAQTHGTPCYVYSKATIERHWLAFDKAAGAHPHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LGSG DIVS GEL R L A     ++VFSGVGKT +EI L LQ  I 
Sbjct: 61  ANSNLGVLSVLAKLGSGFDIVSGGELLRVLKAGGDPTKVVFSGVGKTPEEIALGLQHNIK 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ ++Q AV+  K API+ RVNPD++A TH  ISTG K +KFGI   Q   
Sbjct: 121 CFNVESPAELERISQVAVAENKIAPISIRVNPDVDAKTHPYISTGLKANKFGIEREQAVE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y +A++LP ++I G+D HIGSQ+ +I  F  A   L  L  +L  NG  + H+DVGGGL
Sbjct: 181 VYRHAASLPNLEIKGIDCHIGSQLTEIAPFVDALDKLLVLIDELAENGITLAHLDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYF-GNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y  D  PP   +Y   I Q   G    ++I EPGR ++A+ G+L+TKV  +K+ A+K
Sbjct: 241 GVTY-KDETPPHPDEYTQAIAQRMQGREDLQLIFEPGRAIMANAGVLLTKVEFLKQGAEK 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D AMND +RP LY A+  I   ++ +  R     D+VGPICETGDFI   R++A+
Sbjct: 300 NFAIVDAAMNDLIRPALYSAWQSI-IPLDTSLTRDSAVYDVVGPICETGDFIGKERELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GD L +   GAYG V +  YNSR    EIMV+  Q  ++R R T ++L   +S+
Sbjct: 359 -DAGDYLAVRSAGAYGFVMASNYNSRCKAAEIMVDKDQVMVVRERETLEDLWRGESV 414


>gi|294788607|ref|ZP_06753849.1| diaminopimelate decarboxylase [Simonsiella muelleri ATCC 29453]
 gi|294483484|gb|EFG31169.1| diaminopimelate decarboxylase [Simonsiella muelleri ATCC 29453]
          Length = 406

 Score =  356 bits (913), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 184/403 (45%), Positives = 256/403 (63%), Gaps = 8/403 (1%)

Query: 14  ENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAH 73
           EN++   LA    TP Y YS  A+   +  +  AF G   ++CYA+KANSN ++IK  + 
Sbjct: 6   ENIAYSYLAEHFGTPLYVYSENALTNAFRAYEMAFSGSQPLICYAVKANSNLSIIKHFSE 65

Query: 74  LGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTL 133
           LGSG D VS GE+ R LAA   A++I+FSGVGK++ EI  AL +GI CFNVES  EL  +
Sbjct: 66  LGSGFDTVSGGEIARVLAAGGAAKKIIFSGVGKSVAEIAFALNAGIKCFNVESLPELDRI 125

Query: 134 NQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKI 193
           NQ A  +GK API+ R+NPD++A TH  ISTG K +KFGI + Q    Y YA+    +KI
Sbjct: 126 NQVAEQMGKIAPISLRINPDVDAKTHPYISTGLKANKFGIAMSQAEQAYQYAANQSHLKI 185

Query: 194 SGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRP-PS 252
            G+D HIGSQ+  +    +A + L  L  +L + G  ++HID+GGG+GI YH++  P P+
Sbjct: 186 MGIDCHIGSQLIDLSPLVEACQRLLMLVDKLSAQGIELEHIDLGGGVGIVYHNE--PIPN 243

Query: 253 SSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFM 312
            ++YA  +       +  ++LEPGR LV + G L+T+V  +K+  +K FVI+D AMND M
Sbjct: 244 LNEYAQAVQNLLAGRKLDLVLEPGRSLVGNAGTLLTRVEFVKQGEEKNFVIVDAAMNDLM 303

Query: 313 RPTLYDAYHEINYIVNPAGDRL-HIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKT 371
           RP LY AYH   +I N   ++   I ADIVGPICETGDF+A NR+IA    GDLL +   
Sbjct: 304 RPALYQAYH---HIENAEKNKQPEILADIVGPICETGDFLAQNRQIA-AEAGDLLLVHSA 359

Query: 372 GAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELD 414
           GAYGA  +  YN+R    E++V+G +   IR R T ++++ L+
Sbjct: 360 GAYGASMASNYNTRCRAAEVLVSGDKVREIRQRETLEDVMRLE 402


>gi|307823078|ref|ZP_07653308.1| diaminopimelate decarboxylase [Methylobacter tundripaludum SV96]
 gi|307735853|gb|EFO06700.1| diaminopimelate decarboxylase [Methylobacter tundripaludum SV96]
          Length = 415

 Score =  356 bits (913), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 183/410 (44%), Positives = 253/410 (61%), Gaps = 3/410 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L AE++++  + +   +P Y YS   +E+++  F  AF     ++CYA+K
Sbjct: 1   MDYFNYRNDELFAEDIAVSDIVYKYGSPCYIYSRATLERHWKAFDQAFGEQAHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN A++  LA LGSG DIVS GEL R + A    ++IVFSGVGK  DEI  AL+ GI 
Sbjct: 61  ANSNIAILNLLARLGSGFDIVSLGELERVITAGGDPKKIVFSGVGKREDEILAALKIGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+E   EL  +N+ A  LG  AP++FRVNPD++A TH  ISTG KE+KFGI I Q  +
Sbjct: 121 CFNIEVSGELDRINRLAGQLGVIAPVSFRVNPDVDAKTHPYISTGLKENKFGIDIQQALT 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A+ +P + + G+D HIGSQ+ +   F  A   + DL   L + G  + H+D+GGGL
Sbjct: 181 EYRRAAAMPHISVIGIDCHIGSQLTETRPFLDALDKILDLVAALEAEGIKLHHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  D +PP  ++Y   +    G    +I+LEPGR +V + GILVT+V  +K +A+K 
Sbjct: 241 GICY-KDEQPPEPAEYIQAVLARLGQTDFEILLEPGRAIVGNAGILVTQVEYLKPTANKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+  I   VN   +      DIVGP+CETGDF+  +R + + 
Sbjct: 300 FAIVDAAMNDLVRPALYSAWQNI-IPVNRQNNAAEATWDIVGPVCETGDFLGKDRTLKIA 358

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
           + GDLL I  +GAYG   S  YNSR  + E++V+GS  H+IR R T  +L
Sbjct: 359 Q-GDLLAIRSSGAYGFTMSSNYNSRPRLAELIVDGSNLHVIRERETIAQL 407


>gi|77461719|ref|YP_351226.1| diaminopimelate decarboxylase [Pseudomonas fluorescens Pf0-1]
 gi|77385722|gb|ABA77235.1| diaminopimelate decarboxylase [Pseudomonas fluorescens Pf0-1]
          Length = 415

 Score =  355 bits (912), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 192/416 (46%), Positives = 260/416 (62%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M AF Y  G L AE V+L  +A    TP Y YS   IE  YL +++A  GM  +VC+A+K
Sbjct: 1   MDAFNYRGGELFAEGVALSAIADRFGTPTYVYSRAHIEAQYLAYADALAGMPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA +G+G DIVS GEL R LAA    ++IVFSGVGKT D++  AL+ G++
Sbjct: 61  ANSNLGVLNVLARIGAGFDIVSRGELERVLAAGGSPDKIVFSGVGKTRDDMRRALEVGVH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES  EL+ L   A  LG +API+ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNVESTDELERLQVVAAELGVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIADAED 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LP +++ GVD HIGSQ+  +  F  A   L DL  +L   G +++HID+GGGL
Sbjct: 181 VYVRAAHLPNLEVVGVDCHIGSQLTTLPPFLDALDRLLDLVDRLGDCGIHLRHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP ++DY   + +        ++ EPGRF+VA+ G+L+T+V  +K +  K 
Sbjct: 241 GVRYR-DEEPPLAADYIKAVRERLVGRDLALVFEPGRFIVANAGVLLTQVEYLKHTEHKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ ++   V P       + D+VGPICETGDF+A  R++AL 
Sbjct: 300 FAIVDAAMNDLIRPALYQAWMDVT-PVKPRETAARTY-DVVGPICETGDFLAKERELAL- 356

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GDLL +   GAYG V S  YN+R    E++V+G Q   +R R T  EL   +S+
Sbjct: 357 EEGDLLAVHSAGAYGFVMSSNYNTRGRAAEVLVDGDQAFEVRRRETVAELFAGESL 412


>gi|126666600|ref|ZP_01737578.1| diaminopimelate decarboxylase [Marinobacter sp. ELB17]
 gi|126628988|gb|EAZ99607.1| diaminopimelate decarboxylase [Marinobacter sp. ELB17]
          Length = 416

 Score =  355 bits (912), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 186/415 (44%), Positives = 256/415 (61%), Gaps = 3/415 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L AE V L ++A    TP Y YS   +E++Y  + NA      +VCYA+K
Sbjct: 1   MDYFIYKNDELWAEGVPLARIAEQHGTPAYVYSRATLERHYRAYDNALQNHPHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LG+G DIVS GEL R + A     ++VFSGVGK   E+  AL+ G+ 
Sbjct: 61  ANSNLAVLDVLARLGAGFDIVSAGELERVIRAGGNPAKVVFSGVGKQPWEMRRALEVGVR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES+ EL  LN  A  LG KAP++ RVNPD++A TH  ISTG KE+KFGI I    +
Sbjct: 121 CFNVESDIELDRLNAIAGELGVKAPVSLRVNPDVDAGTHPYISTGLKENKFGIDIEVAPA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A++LP + + GVD HIGSQ+  +  F  A   +  L  +L   G  I+H+D+GGGL
Sbjct: 181 IYARAASLPHLDVRGVDCHIGSQLTTVAPFLDALDRVLALVDKLAEQGVEIKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y+ D  PP   +Y   I    G+ + ++ILEPGR + A+ G+L+T+V  +K +  + 
Sbjct: 241 GVTYN-DETPPQPGEYVEAILARLGDRKLELILEPGRSIAANAGVLLTRVEFLKCTEHRN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+  I   V P  +      D+VGP+CETGDF+  +R+++L 
Sbjct: 300 FAIIDAAMNDLIRPALYGAWQAI-VPVAPHSNGDEKAWDLVGPVCETGDFLGKDRQLSL- 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
             GDLL +   GAYG V S  YN+R   PE+MV+G Q H++R R T +E +  +S
Sbjct: 358 NAGDLLAVRSAGAYGFVMSSNYNTRNRPPELMVDGDQVHVVRRRETVEEQLAPES 412


>gi|223939745|ref|ZP_03631617.1| diaminopimelate decarboxylase [bacterium Ellin514]
 gi|223891616|gb|EEF58105.1| diaminopimelate decarboxylase [bacterium Ellin514]
          Length = 432

 Score =  355 bits (911), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 180/433 (41%), Positives = 265/433 (61%), Gaps = 17/433 (3%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y     + ENVS+E L     +P Y YS   + +++     A   +D ++C+ALK
Sbjct: 1   MHYFRYVGNKFYCENVSVESLVKKYGSPLYIYSQRTLTEHFQKLDQALAPVDHLICFALK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSNQAV++TLA LG G DIVS GEL+RA+AA     + VF+GVGKT  EI+ AL+ G+Y
Sbjct: 61  SNSNQAVLRTLADLGGGFDIVSSGELQRAIAAGADPRKCVFAGVGKTESEIEFALKKGVY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE EL+ +N+ A  L K APIA RVNP+++A+TH KI+TG  ++KFGI I  I  
Sbjct: 121 SFNVESEPELQRINRIAGRLKKIAPIAVRVNPNVDAHTHAKITTGTYDNKFGIAIENIEG 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA AS L  +K+ G+ MHIGSQ+  +E F +A K +  L ++L+   H ++   +GGGL
Sbjct: 181 VYARASKLKNIKLRGLQMHIGSQLTSVEPFEQAVKKVSPLVERLKKK-HGLEFFSIGGGL 239

Query: 241 GIAYH--------------SDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGIL 286
           GI Y                  +  + + YA+ +      L  +I++EPGRF+  + GIL
Sbjct: 240 GIVYDPALESSNPEWWRTTKGKKILTPTLYATRLVPLLKPLGLRILMEPGRFISGNAGIL 299

Query: 287 VTKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICE 346
           VT++  +K++  K F+I+D AMND +RP  YDAYHEI  +    G    I +D+VGPICE
Sbjct: 300 VTRIEYVKRTGKKNFLIVDAAMNDLIRPAFYDAYHEIVPLTRKNGQL--ISSDVVGPICE 357

Query: 347 TGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMT 406
           +GDF A +R +     GD L +   GAYG V +  YN+R +  E++VNG++  ++R R  
Sbjct: 358 SGDFFAKDRPLPKLGEGDHLALLSAGAYGFVMASNYNTRSMAAEVLVNGNKSALVRERQP 417

Query: 407 FQELIELDSIPAW 419
            +E+   +++  W
Sbjct: 418 VEEIWAGETVAPW 430


>gi|212633301|ref|YP_002309826.1| diaminopimelate decarboxylase [Shewanella piezotolerans WP3]
 gi|212554785|gb|ACJ27239.1| Diaminopimelate decarboxylase [Shewanella piezotolerans WP3]
          Length = 414

 Score =  355 bits (911), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 181/412 (43%), Positives = 260/412 (63%), Gaps = 4/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L+AE   + +LA    TP Y YS   +E+++  F NA      ++CYA+K
Sbjct: 1   MDHFIYQAEELYAEQCQVAELAKQHGTPLYIYSRATLERHWYAFDNAVANHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R + A     ++VFSGVGKT+ E++LAL+ GIY
Sbjct: 61  ANSNIAVLNVLARLGSGFDIVSGGELARVIEAGGDPAKVVFSGVGKTVAEMELALEIGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ L+  A  + K AP++ R+NPD++A TH  ISTG KE+KFGI + +  +
Sbjct: 121 CFNVESAAELEQLSVVAQRMNKVAPVSLRINPDVDAGTHPYISTGLKENKFGIAMEEAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++  A  LP ++I GVD HIGSQ+ +I+ F  A   +  L  +L   G  I+H DVGGGL
Sbjct: 181 IFLRAKELPCIEIKGVDCHIGSQLTEIKPFLDAMDRMLALIDRLAELGIEIKHFDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP    YA+ + +  G    K+I EPGR + A+ GI VT+V+ +K+++DK 
Sbjct: 241 GVTY-DDELPPQPDVYAAALLERLGGRDLKLIFEPGRAIAANAGIFVTQVLYLKENSDKR 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F ++D AMND +RP+LY A+ +I   ++  G+ L+   D+VGP+CETGDF+  +R++ + 
Sbjct: 300 FALVDGAMNDLIRPSLYSAWQKIIPAIDRGGETLNY--DVVGPVCETGDFLGKDRQLNIA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
             GD L I  +GAYG   +  YNSR    E+MV+G   ++IR R    +L +
Sbjct: 358 -AGDYLAIRSSGAYGFTMASNYNSRPRAAELMVDGDNAYVIREREKLAQLWQ 408


>gi|50085728|ref|YP_047238.1| diaminopimelate decarboxylase [Acinetobacter sp. ADP1]
 gi|49531704|emb|CAG69416.1| diaminopimelate decarboxylase [Acinetobacter sp. ADP1]
          Length = 416

 Score =  355 bits (911), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 183/414 (44%), Positives = 261/414 (63%), Gaps = 3/414 (0%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           +F    G LHAE  SL++LA    TP Y YS  A EK+Y     AFD +D  +C+A+K+N
Sbjct: 2   SFSRINGVLHAEQCSLDQLAQQFGTPLYVYSKAAFEKHYKDMDRAFDFIDHQICFAVKSN 61

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+  LA LGSG DIV+ GEL R LAA     +IVFSG+GK+  +I  AL+ GI CF
Sbjct: 62  SNLAVLNVLAKLGSGFDIVTGGELARVLAAGGDPSKIVFSGLGKSEADIQKALEVGIACF 121

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES +EL  + + AV L +KAP++ RVNPD++A TH  ISTG KE+KFGIP   +   Y
Sbjct: 122 NVESYAELDRIQKVAVRLDQKAPVSLRVNPDVDAKTHPYISTGLKENKFGIPSDTVFETY 181

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
            YA++L  + + G+D HIGSQ+ + + F  A   +  + +QL   G N++HID+GGGLG+
Sbjct: 182 QYAASLSHLDVVGIDCHIGSQLTETKPFVDALDRVMVMIEQLNKLGINLKHIDIGGGLGV 241

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y  D  PPS ++YA+ +      L  K+ +EPGR + A+ G+L+T+V  +K +  + F 
Sbjct: 242 CY-KDETPPSVAEYANALKPALEKLGLKVYMEPGRSISANAGVLLTRVDLLKPTNHRNFA 300

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND +RP+LY+A+ +I   VN +        D+VG ICETGDF+   R +A+ + 
Sbjct: 301 IIDAAMNDLIRPSLYEAWMDIQS-VNESTSAEAKEWDVVGAICETGDFLGKARTLAI-QE 358

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            D+L +   GAYG V S  YN+R    E+MV+  + H+IR R + + L E + +
Sbjct: 359 NDILAVLGAGAYGFVMSSNYNTRGRAAEVMVDDEKPHLIRERESIESLWERERL 412


>gi|315178745|gb|ADT85659.1| diaminopimelate decarboxylase [Vibrio furnissii NCTC 11218]
          Length = 417

 Score =  355 bits (910), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 191/418 (45%), Positives = 255/418 (61%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AENVSL +LA    TP Y YS   +E+++  F  +      +VCYA+
Sbjct: 1   MDYFNYQDDGQLWAENVSLAQLAEDYGTPLYVYSRATLERHWHAFDKSVGDHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA LGSG DIVS GEL R +AA     ++VFSGVGKT  E+  AL   I
Sbjct: 61  KANSNLGVLNTLARLGSGFDIVSAGELERVVAAGGDPAKVVFSGVGKTAAEMKRALALKI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESESEL+ LNQ A  +G KAPI+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESESELERLNQVAGEMGVKAPISLRINPDVDAKTHPYISTGLRDNKFGIAFDRAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y  A  L  + I G+D HIGSQ+  IE F  A   L  L   L++ G +I+H+DVGGG
Sbjct: 181 DVYRLAQRLDHISIHGIDCHIGSQLTAIEPFIDATDRLLALIDNLKAEGIHIKHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  S+YA  +     N Q  ++I EPGR + A+ G+L+T+V  +K +  
Sbjct: 241 LGVVYR-DELPPQPSEYAKALLSRLANHQELELIFEPGRAIAANAGVLLTRVEYLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I  +    G  L    D+VGP+CETGDF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDIVPVSPREGAALTY--DLVGPVCETGDFLGKDRSLV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L + GDLL +   GAYG   S  YN+R    E++V+G   H++R R     L  L+S+
Sbjct: 358 L-QQGDLLAVRSAGAYGFAMSSNYNTRTRAAEVIVDGETTHVVRQREELSSLWALESL 414


>gi|197120414|ref|YP_002140841.1| diaminopimelate decarboxylase [Geobacter bemidjiensis Bem]
 gi|197089774|gb|ACH41045.1| diaminopimelate decarboxylase [Geobacter bemidjiensis Bem]
          Length = 417

 Score =  355 bits (910), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 188/421 (44%), Positives = 261/421 (61%), Gaps = 5/421 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y    L AE+V+++ +   V +P Y YS   +E++Y    +AF      +CY++K
Sbjct: 1   MHHFQYKGEELFAEDVAIKDIVAAVGSPVYIYSKATLERHYKAMDDAFAQAPHTICYSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+KT  +LG G+DIVS GEL RALAA V  +++V+SGVGK  DEI  AL+SGI 
Sbjct: 61  ANSNLAVLKTFINLGGGVDIVSGGELYRALAAGVDPKKVVYSGVGKRDDEIAYALESGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FN+ESE EL  ++  A  +GKKA IA RVNPD++  TH  I+TG K+ KFGI I +   
Sbjct: 121 MFNIESEQELDRISDIAGRIGKKAGIAIRVNPDVDPQTHPYITTGLKKAKFGINIERALE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A  L  ++I G+D HIGSQ+ ++  F  A K L+ L   +R  G +I+++D+GGGL
Sbjct: 181 QYQRAKGLANIEILGIDCHIGSQLTKVSPFVDAIKKLKRLLDGVRGMGIDIKYLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  D  PP  +DY S I +   +L   +I EPGR LV + GILV K +  KK  +K 
Sbjct: 241 GIQY-DDEAPPLPADYGSSIQEETKDLGLHLIFEPGRNLVGNAGILVGKCLYTKKGEEKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIV-NPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           FVI+D  MND  RP+LY ++H +  +  N  G    I  DIVGPICE+GDF+   R+I  
Sbjct: 300 FVIVDAGMNDLARPSLYGSFHGVRPVFRNQDG---VIEGDIVGPICESGDFLVKEREIPN 356

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            R GDL+     GAYG   S  YNSR    E+MV+G +F ++R R   ++L+  + +P++
Sbjct: 357 FRQGDLIAFMSAGAYGFTMSSNYNSRPRAAEVMVDGGKFEVVRDREKLEDLVRGERVPSF 416

Query: 420 L 420
           L
Sbjct: 417 L 417


>gi|103485699|ref|YP_615260.1| diaminopimelate decarboxylase [Sphingopyxis alaskensis RB2256]
 gi|98975776|gb|ABF51927.1| diaminopimelate decarboxylase [Sphingopyxis alaskensis RB2256]
          Length = 419

 Score =  355 bits (910), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 175/422 (41%), Positives = 261/422 (61%), Gaps = 4/422 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAF-DGMDTMVCYAL 59
           M  F+Y +G LHAE++ L ++A  + TP Y YS   +E++   F++A  D     + +A+
Sbjct: 1   MDHFEYRDGVLHAEDIPLPRIAKEIGTPVYVYSRATLERHAQVFADALRDIPRKHIAFAI 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           K N N  V++ LA  G G D+VS GEL RALAA + AE IVFSGVGKT  E+   L  GI
Sbjct: 61  KCNPNLGVLRVLARQGYGADVVSGGELERALAAGMAAEDIVFSGVGKTRAELAQGLDRGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
             FN+E E E   L++ AV+    A    RVNPD++A TH KISTGK E+KFG+ I    
Sbjct: 121 GQFNIEHEPEGVALSEIAVAKEMTARAVLRVNPDVDAGTHAKISTGKAENKFGVGIDSAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           +++   S LPG+K+ GV +HIGSQ+  ++    AF+ +  L   LR+ GH+I H+D+GGG
Sbjct: 181 AIFDRLSALPGLKMRGVALHIGSQLTSLDPLEAAFERVGRLVADLRAAGHSITHVDLGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           LG+ Y  +  PP+ ++Y +++ +   +    ++ EPGR +  + G+L+T+V+ +K  A  
Sbjct: 241 LGVPYRPEDNPPTPAEYGAMVARVTKDWDVTLMFEPGRVIAGNTGVLLTEVLWVKPGATH 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            FVI+D AMND  RP LYDA+H+    V P G+++   A IVGP+CETGD  A +R+I  
Sbjct: 301 PFVIVDAAMNDLARPALYDAWHDF-VAVKPTGEKM--IASIVGPVCETGDTFARDREIDA 357

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            +PG L      GAYGA  + TYNSR L+PE++V+G ++  +  R+    ++  + +P W
Sbjct: 358 VQPGALAVFRTAGAYGATMASTYNSRSLVPEVLVDGDRYITVADRIAAGTIMAAERVPDW 417

Query: 420 LQ 421
           + 
Sbjct: 418 ID 419


>gi|329118402|ref|ZP_08247108.1| diaminopimelate decarboxylase [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327465448|gb|EGF11727.1| diaminopimelate decarboxylase [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 406

 Score =  355 bits (910), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 184/402 (45%), Positives = 262/402 (65%), Gaps = 4/402 (0%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  EN+S  +LA    TP Y YS +A+++ +  +  AF  ++ ++CYA+KAN N ++I+
Sbjct: 2   TLRCENLSYTELAERYGTPLYVYSQSALDEAFAAYQTAFAALNPLICYAVKANGNLSLIR 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  E++ AL++GI CFNVES  E
Sbjct: 62  RFAELGSGFDIVSGGELARVLAAGGSAAKTIFSGVGKSAAEMEYALKAGIKCFNVESLPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           L+ LN  A  L  +AP++ R+NPD++A TH  ISTG K +KFGI +    + YA A+ LP
Sbjct: 122 LERLNGIAGRLNTRAPVSLRINPDVDAQTHPYISTGLKANKFGIAMRDAEAAYARAAELP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            ++I G+D HIGSQ+ +++   +A + +  L  +L + G  +QHID+GGG+GI Y  D  
Sbjct: 182 HLRIVGIDCHIGSQLIRLDPLIEACERILALADRLAAQGIELQHIDLGGGVGIVYR-DED 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P  S YA+ + +  G+    +ILEPGR LV + G L+T+V  +K++ DK FVI+D AMN
Sbjct: 241 TPDLSAYAAAVQKLIGSRPLGLILEPGRSLVGNAGDLLTRVEYVKRNEDKNFVIVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIE 369
           D MRP LY AYH I     PA       ADIVGP+CETGDF+A +R+IA  + GDLL + 
Sbjct: 301 DLMRPALYQAYHRIEPAEPPA--AAPFTADIVGPVCETGDFLAKDRRIA-AQAGDLLVVR 357

Query: 370 KTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELI 411
             GAY A  +G YN+R    E++V+GSQ  ++R R T +E++
Sbjct: 358 GAGAYAASMAGNYNARRRAAEVLVSGSQARLVRRRETVEEML 399


>gi|260767552|ref|ZP_05876488.1| diaminopimelate decarboxylase [Vibrio furnissii CIP 102972]
 gi|260617452|gb|EEX42635.1| diaminopimelate decarboxylase [Vibrio furnissii CIP 102972]
          Length = 417

 Score =  355 bits (910), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 191/418 (45%), Positives = 255/418 (61%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AENVSL +LA    TP Y YS   +E+++  F  +      +VCYA+
Sbjct: 1   MDYFNYQDDGQLWAENVSLAQLAEDYGTPLYVYSRATLERHWHAFDKSVGDHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA LGSG DIVS GEL R +AA     ++VFSGVGKT  E+  AL   I
Sbjct: 61  KANSNLGVLNTLARLGSGFDIVSAGELERVVAAGGDPAKVVFSGVGKTAAEMKRALALKI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESESEL+ LNQ A  +G KAPI+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESESELERLNQVAGEMGVKAPISLRINPDVDAKTHPYISTGLRDNKFGIAFDRAP 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y  A  L  + I G+D HIGSQ+  IE F  A   L  L   L++ G +I+H+DVGGG
Sbjct: 181 DVYRLAQRLDHISIHGIDCHIGSQLTAIEPFIDATDRLLALIDNLKAEGIHIKHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQ-CKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  S+YA  +     N Q  ++I EPGR + A+ G+L+T+V  +K +  
Sbjct: 241 LGVVYR-DELPPQPSEYAKALLSRLANHQELELIFEPGRAIAANAGVLLTRVEYLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND MRP LY A+ +I  +    G  L    D+VGP+CETGDF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLMRPALYQAWQDIVPVSPREGAALTY--DLVGPVCETGDFLGKDRSLV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L + GDLL +   GAYG   S  YN+R    E++V+G   H++R R     L  L+S+
Sbjct: 358 L-QQGDLLAVRSAGAYGFAMSSNYNTRTRAAEVIVDGGTTHVVRQREELSSLWALESL 414


>gi|117927014|ref|YP_867631.1| diaminopimelate decarboxylase [Magnetococcus sp. MC-1]
 gi|117610770|gb|ABK46225.1| diaminopimelate decarboxylase [Magnetococcus sp. MC-1]
          Length = 419

 Score =  355 bits (910), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 176/416 (42%), Positives = 257/416 (61%), Gaps = 1/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +  L  E V+LE++A  V TPFYCYS   +  +   F  AF   D+++CY++K
Sbjct: 1   MDYFHYQDDQLFCEEVALEQIAQAVGTPFYCYSERTLLHHLQVFQQAFASQDSLICYSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA  G+G DIVS GEL R      P ER+VFSGVGK+  EI  AL  G+ 
Sbjct: 61  ANSNLAVLDALAKQGAGFDIVSGGELERVRRVGCPGERVVFSGVGKSRAEIQAALAYGVR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL+ + + A+++   AP+  R+NPD++  TH  ISTG K +KFGIP  +  +
Sbjct: 121 MFNVESIPELQRIQEVALAMDVAAPVTLRINPDVDPKTHPYISTGLKRNKFGIPFGEAVA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ +  V++ G+D HIGSQ+ Q+  F  A K +  L Q L+ +G  I+++D+GGGL
Sbjct: 181 VYQQAAQMSHVQVVGLDCHIGSQLTQLSPFVDALKRVMVLIQALKGHGIEIKNLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y     PPS ++ A+ + +    +   +ILEPGR +V + G+LVT+V  +KK   + 
Sbjct: 241 GIPYEDGDTPPSPAELAAALLEQLDGMPVTVILEPGRAIVGNAGVLVTRVEYVKKGEQRH 300

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FVI D  MND +RP +Y+AYH +   +    DR     D+VGPICETGDF A +R ++  
Sbjct: 301 FVITDAGMNDLLRPAIYNAYHGV-IPLQRKFDREEQVVDVVGPICETGDFFARDRYLSEV 359

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             G+LL +   GAYG V S  YN+R  + E++V G ++ ++R R +  +L+E +S+
Sbjct: 360 YQGELLAVRSAGAYGFVMSSNYNTRPRVAEVLVRGDRYAVVRKRESVAQLLENESL 415


>gi|85373232|ref|YP_457294.1| diaminopimelate decarboxylase [Erythrobacter litoralis HTCC2594]
 gi|84786315|gb|ABC62497.1| diaminopimelate decarboxylase [Erythrobacter litoralis HTCC2594]
          Length = 420

 Score =  355 bits (910), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 178/422 (42%), Positives = 259/422 (61%), Gaps = 5/422 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGM-DTMVCYAL 59
           M  F    G LHAE+V L ++A  V TP Y YS   +E++   F+     + D ++ +A+
Sbjct: 1   MDHFSLNSGVLHAEDVPLPQIAEEVGTPVYVYSRATLERHARVFTEGLAEVPDKLIAFAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           K+N N AV+K L   G G D+VS GELRRALAA +   +IVFSGVGKT  E+ L L  GI
Sbjct: 61  KSNPNLAVLKVLQKAGFGADVVSGGELRRALAAGMAPAKIVFSGVGKTRAELMLGLDEGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
             FN+ES  E + L + A + G+ AP   R+NPD++A TH+KISTGK E+KFGIP+    
Sbjct: 121 GQFNIESREEGRELAELAAARGELAPACLRINPDVDAKTHEKISTGKAENKFGIPLVHAR 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            ++A    L G+ + G+ +HIGSQ+  +E    AF  +  L   LR  GH I H+D+GGG
Sbjct: 181 EVFAELVQLDGLHLRGIAVHIGSQLGDLEPLETAFGKVGKLVADLREAGHLITHVDLGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD- 298
           LG+ Y +    PS +DY +++ +   + +  +  EPGR +  + GIL+T+VI +K+  + 
Sbjct: 241 LGVPYKAGEEFPSPADYGAMVARVTRDWRVHLTFEPGRVIAGNAGILLTRVIRVKRGGNG 300

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
             FVI+D AMND  RP LY A+H+ +  V P+G+  H+ A+IVGPICETGD  A +RK  
Sbjct: 301 PPFVIVDAAMNDLARPALYGAWHDFD-AVEPSGE--HMTANIVGPICETGDTFARDRKCD 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
             + GDL      GAYGA  + +YNSR  + E++V+G QF ++  R+    +++ + +P 
Sbjct: 358 ALQSGDLAVFRTAGAYGATMASSYNSRGFVAEVLVDGDQFAVVADRIDAGAIMDAERVPE 417

Query: 419 WL 420
           WL
Sbjct: 418 WL 419


>gi|253702729|ref|YP_003023918.1| diaminopimelate decarboxylase [Geobacter sp. M21]
 gi|251777579|gb|ACT20160.1| diaminopimelate decarboxylase [Geobacter sp. M21]
          Length = 417

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 186/421 (44%), Positives = 263/421 (62%), Gaps = 5/421 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y    L AE+V+++ +   V +P Y YS   +E++Y    +AF      +CY++K
Sbjct: 1   MHHFQYKGEELFAEDVAIKDIVAAVGSPVYIYSKATLERHYKAMDDAFAQAPHTICYSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+KT  +LG G+DIVS GEL RALAA V  +++V+SGVGK  +EI  AL+SGI 
Sbjct: 61  ANSNLAVLKTFVNLGGGVDIVSGGELYRALAAGVDPKKVVYSGVGKRDEEIAYALESGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FN+ESE EL  +++ A  +G+KA IA RVNPD++  TH  I+TG K+ KFGI I +   
Sbjct: 121 MFNIESEQELDRISEVAGRIGRKAGIAIRVNPDVDPQTHPYITTGLKKAKFGINIERALE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A  L  ++I G+D HIGSQ+ ++  F  A K L+ L + +R  G +++++D+GGGL
Sbjct: 181 QYQRAKGLADIEILGIDCHIGSQLTKVSPFVDAIKKLKRLLEGVRGMGIDVRYLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  D  PP  +DY S I +   +L   +I EPGR LV + GILV K +  KK  +K 
Sbjct: 241 GIQY-DDEAPPLPADYGSSIQEETKDLGLHLIFEPGRNLVGNAGILVGKCLYTKKGEEKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIV-NPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           FVI+D  MND  RP LY ++H +  ++ N  G    I  DIVGPICE+GDF+   R+I  
Sbjct: 300 FVIVDAGMNDLARPALYGSFHGVRPVLRNQDG---VIEGDIVGPICESGDFLVKEREIPN 356

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            R GDL+     GAYG   S  YNSR    E+MV+G +F ++R R   ++LI  + +P++
Sbjct: 357 FRQGDLIAFMSAGAYGFTMSSNYNSRPRAAEVMVDGDKFEVVRDREKLEDLIRGERVPSF 416

Query: 420 L 420
           L
Sbjct: 417 L 417


>gi|119503712|ref|ZP_01625794.1| putative diaminopimelate decarboxylase [marine gamma
           proteobacterium HTCC2080]
 gi|119460220|gb|EAW41313.1| putative diaminopimelate decarboxylase [marine gamma
           proteobacterium HTCC2080]
          Length = 418

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 185/410 (45%), Positives = 260/410 (63%), Gaps = 4/410 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M++F+  +  L  E V+L+++A    TP Y YS   IE+ YL +  A    D ++CYA+K
Sbjct: 1   MNSFERHKDRLFCEEVALDEMASKYGTPLYVYSRACIEQAYLAYQTALADHDHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN A++  LA LG+G DIVS GEL R +AA     ++VFSGV KT   I  AL+ GI+
Sbjct: 61  ANSNLAILSVLAKLGAGFDIVSLGELERVIAAGGDPTKVVFSGVCKTHAAIKRALEVGIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESESEL+ L++ A + G  API+ RVNPD++A TH  I+TG K++KFG+ +     
Sbjct: 121 CFNVESESELEALSEVAQASGMVAPISLRVNPDVDAQTHPYIATGLKDNKFGVELDSALR 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LY  A  LPG+K  G+D HIGSQI  I  F +A   L D+ + L+S G  ++HID+GGGL
Sbjct: 181 LYRKAVALPGIKPIGIDCHIGSQILDIAPFSEAMDHLIDVLENLKSEGIMLEHIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  +   P  +DY + + Q   +    +ILEPGR +VA+ G+L+T+V+ +K +  K 
Sbjct: 241 GIPY-GNENAPKIADYVAALTQGLSDHSLTLILEPGRSIVAEAGVLLTEVMYLKPTPHKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F ++D AMND +RP LY A+ +I  + N  GD      DIVGP+CETGDF+  +R ++L 
Sbjct: 300 FALVDAAMNDLLRPALYGAWQDIVPLNNRNGDAKCW--DIVGPVCETGDFLGKDRNLSLT 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
             GD+L +   GAYG V +  YN+R    E+MV+GS  H+IR R   + L
Sbjct: 358 E-GDVLAVMTAGAYGFVMASNYNTRPRSAEVMVDGSHSHLIRAREPLETL 406


>gi|221134092|ref|ZP_03560397.1| putative diaminopimelate decarboxylase [Glaciecola sp. HTCC2999]
          Length = 416

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 188/411 (45%), Positives = 259/411 (63%), Gaps = 4/411 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y  G+LHAENV+L  +A    TP Y YS   +E+++  F  A      +VC+A+K
Sbjct: 1   MDFFDYQNGTLHAENVALHDIAAKHGTPTYVYSRKTLERHWHKFDEALGDHPHLVCFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LGSG DIVS GEL+R +AA    +++VFSGVGKT DEI+ ALQ  I 
Sbjct: 61  ANSNIGVLSVLAKLGSGFDIVSGGELKRVIAAGGDPQKVVFSGVGKTADEIEFALQQNIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL  +N  A  L + A I+ R+NPD++ANTH  ISTG K +KFGI   +   
Sbjct: 121 CFNVESFAELDRINAVAAKLDRPARISLRINPDVDANTHPYISTGLKANKFGIAHTKAVE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y YA  L  ++I G+D HIGSQ+ +   F  A + L  L  +L ++  +I+H+DVGGGL
Sbjct: 181 TYLYAKALSYLEIKGMDCHIGSQLTETAPFVDALERLLGLVDELATHDIHIEHLDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYF-GNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y ++  PP  S+YAS I Q   G    KII+EPGR + A+ G+L+TKV  +K++ DK
Sbjct: 241 GVTY-ANETPPLPSEYASAIAQKMQGREHMKIIMEPGRAIAANAGVLLTKVEFLKQNEDK 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D AMND +RP LY A+  I   + P  D      D+VGP+CETGDF+  +R++A+
Sbjct: 300 HFAIIDAAMNDLLRPALYSAWQNI-VPITPRDDVAAAVYDVVGPVCETGDFLGKDRELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
             P D+L ++  GAYG V +  YN+R    EIMV+G    ++R R   ++L
Sbjct: 359 -VPDDILAVKSAGAYGFVMASNYNTRARPAEIMVDGDHVIVVREREKVEDL 408


>gi|206889561|ref|YP_002248957.1| diaminopimelate decarboxylase [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206741499|gb|ACI20556.1| diaminopimelate decarboxylase [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 418

 Score =  354 bits (908), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 184/420 (43%), Positives = 267/420 (63%), Gaps = 3/420 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F + +G L+AE+V +++L +   TP Y YS   + ++   +  AF  +  ++CYA+K
Sbjct: 1   MHFFSHKKGELYAEDVPVKELINKFGTPLYIYSYGTLIRHIRAYEEAFCEVPHIICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN A+++  A LG G DIVS GEL +AL A +   +IVF+GVGKT +EI+ AL++ I 
Sbjct: 61  ANSNLAILRIFAELGIGADIVSGGELFKALKAGIKPYKIVFAGVGKTDEEIEYALKNNIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE+EL  +N++A +L K A +A RVNPDI+  THK I+TG K  KFGIPI +   
Sbjct: 121 MFNVESEAELHKINEKAKNLKKVASVALRVNPDIDPKTHKYIATGLKSSKFGIPIEKALD 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A ++  +K+ G+  HIGSQI +  ++ +A   +  L  QL +    I++ID+GGGL
Sbjct: 181 YYKLAKSMKNIKVIGIHKHIGSQITETSAYVEALNKILSLYDQLANYDMEIEYIDIGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  D  PP   + A ++     N + K+I+EPGR +V + GILVTKV+  K++  K 
Sbjct: 241 GITYR-DEEPPHPKELADVLIPLVKNKKGKLIIEPGRSIVGNAGILVTKVLYTKETEQKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F+I+D  MND +RPTLY +YHEI  +    G +  I ADIVGPICE+GDF+A +R+I   
Sbjct: 300 FIIVDAGMNDLIRPTLYGSYHEIQPVT--PGKKEKIVADIVGPICESGDFLAKDREIEKV 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAWL 420
             G+ L +   GAYG   S  YNSR  + E++V G Q+ +IR R T+++LI  + +P  L
Sbjct: 358 SAGEYLAVMSAGAYGFSMSSNYNSRPRVAEVLVKGDQYALIRKRETYKDLIRNEIVPEEL 417


>gi|90414245|ref|ZP_01222225.1| putative diaminopimelate decarboxylase [Photobacterium profundum
           3TCK]
 gi|90324692|gb|EAS41233.1| putative diaminopimelate decarboxylase [Photobacterium profundum
           3TCK]
          Length = 416

 Score =  354 bits (908), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 189/414 (45%), Positives = 260/414 (62%), Gaps = 6/414 (1%)

Query: 1   MSAFKYF-EGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y   G L AE+++L +LA    TP Y YS   +E+++  F  A      ++CYA+
Sbjct: 1   MDYFNYQPNGQLWAEDIALTELAERYGTPLYVYSRATLERHWNAFDQAVTDHPHLICYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+  LA LGSG DIVS+GEL R + A     ++VFSGVGKT  E+  AL+ GI
Sbjct: 61  KANSNIGVLNVLARLGSGFDIVSQGELERVITAGGDPAKVVFSGVGKTAVEMKRALELGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LNQ A  LG  API+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNQVASELGVIAPISLRINPDVDAQTHPYISTGLRDNKFGIFFERAV 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y  A +LP + + G+D HIGSQ+  I+ F  A   L  L   L++ G  I+H+DVGGG
Sbjct: 181 EVYRLAHSLPNLNVVGMDCHIGSQLTNIDPFIDATDRLLALIDTLKAEGIVIKHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFG-NLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y S+ +PP  S+YA+ +    G + + ++I EPGR + A+ G+L+T+V  +K +  
Sbjct: 241 LGVTY-SEEQPPLPSEYATALLARLGEHSELELIFEPGRAIAANAGVLLTRVEFLKHTDY 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND +RPTLY A+  I  +V   G+      D+VGPICETGDFI  +R++ 
Sbjct: 300 KNFAIVDAAMNDLIRPTLYQAWQNIVPVVPRKGETKTY--DLVGPICETGDFIGKDRELC 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
           L  PGDLL +   GAYG V S  YN+R    EIMV+G+  H++R R    EL +
Sbjct: 358 LA-PGDLLAVRSAGAYGFVMSSNYNTRTRAAEIMVDGNTAHVVREREKLAELWQ 410


>gi|300702820|ref|YP_003744421.1| diaminopimelate decarboxylase [Ralstonia solanacearum CFBP2957]
 gi|299070482|emb|CBJ41777.1| Diaminopimelate decarboxylase [Ralstonia solanacearum CFBP2957]
          Length = 419

 Score =  354 bits (908), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 184/410 (44%), Positives = 260/410 (63%), Gaps = 11/410 (2%)

Query: 8   EGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAV 67
           +G+L  E V+LE +A    TP Y YS  A+  NY  ++ A +G +  V YA+KANSN AV
Sbjct: 9   DGALMVEGVALEAIAAQFGTPTYVYSRAALTANYRAYAAACEGRNARVQYAMKANSNLAV 68

Query: 68  IKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESE 127
           ++  A LG+G DIVS GELRR LAA   A  +VFSGVGKT DE+ LAL++G+ CFNVES 
Sbjct: 69  LQIFAQLGAGFDIVSGGELRRVLAAGGKAADVVFSGVGKTADEMRLALEAGVACFNVESI 128

Query: 128 SELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYAST 187
            EL  LN+ A SLGK AP++ RVNPD++A TH  ISTG K +KFGI   ++   Y  A+ 
Sbjct: 129 PELHRLNEVAGSLGKTAPVSLRVNPDVDAKTHPYISTGLKGNKFGIAFEEVLPTYRAAAA 188

Query: 188 LPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSD 247
           +P +++ G+D HIGSQI ++  +  A   + D+  +L + G  + HIDVGGGLGI Y +D
Sbjct: 189 MPNLRVVGIDCHIGSQITEVSPYLDAIDKVLDVVARLDAEGIRLSHIDVGGGLGITY-TD 247

Query: 248 HRPPSSSDYASLI-----HQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
             PP  + +A  +      + FG+    ++ EPGR LV + G+L+T+V  +K  A K F 
Sbjct: 248 ETPPDITAFARTLLDRIEQRGFGDR--TVLFEPGRSLVGNAGLLLTRVEFLKPGAAKNFC 305

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND  RP +Y+AYH I   V   G    ++ D+VGP+CE+GD++  +R + + +P
Sbjct: 306 IVDAAMNDLARPAMYEAYHHI-VPVRERGGAATVY-DVVGPVCESGDWLGRDRALDV-QP 362

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
           GDLL I   GAYG   S  YN+R    E++V+G + H+ R R  F++L+ 
Sbjct: 363 GDLLAILSAGAYGFTMSSNYNTRNRAAEVIVDGDRVHVARERERFEDLVR 412


>gi|260913224|ref|ZP_05919706.1| diaminopimelate decarboxylase [Pasteurella dagmatis ATCC 43325]
 gi|260632811|gb|EEX50980.1| diaminopimelate decarboxylase [Pasteurella dagmatis ATCC 43325]
          Length = 416

 Score =  353 bits (907), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 187/417 (44%), Positives = 259/417 (62%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y    L AE V +  +A    TP Y YS   +E+++  F  A      ++C+A+K
Sbjct: 1   MDYFQYQNQQLMAEQVPVIHIAQQFGTPLYIYSRATLERHWHAFDKALGKHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +N N A++  +A LGSG DIVS+GEL R L A   A +IVFSGV KT  EI  AL+ GI 
Sbjct: 61  SNPNIAILNVMAKLGSGFDIVSQGELERVLVAGGDANKIVFSGVAKTETEIARALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL  +NQ A  LGK API+ RVNPD++A+TH  ISTG KE+KFGI + +   
Sbjct: 121 CFNVESVAELHRINQVAGELGKVAPISLRVNPDVDAHTHPYISTGLKENKFGISVDEARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  AS LP +KI+G+D HIGSQ+ +++ F  A   L  L +QL+ +   ++H+D+GGGL
Sbjct: 181 VYRLASQLPHIKITGMDCHIGSQLTELQPFLDATDRLIVLMKQLKEDSIQLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  ++YAS + +   +    +IILEPGR + A+ GILVTKV  +K + ++
Sbjct: 241 GVTY-TDETPPHPTEYASALLEKLSDYPDLEIILEPGRAITANAGILVTKVEYLKHNENR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D  MND +RP LY AY  I  I      +  ++ D+VGPICET DF+   R +A+
Sbjct: 300 HFAIVDAGMNDMIRPALYQAYMNIIEIDRTLARKPQVY-DVVGPICETSDFLGKQRTLAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
              GD +     GAYGA  S  YNSR    E+MV+G Q H+IR R   +EL  L+ +
Sbjct: 359 AE-GDYIAQRSAGAYGASMSSNYNSRSRTAEVMVDGEQVHLIRRREKLEELWALEQL 414


>gi|309782874|ref|ZP_07677594.1| diaminopimelate decarboxylase [Ralstonia sp. 5_7_47FAA]
 gi|308918298|gb|EFP63975.1| diaminopimelate decarboxylase [Ralstonia sp. 5_7_47FAA]
          Length = 419

 Score =  353 bits (906), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 179/410 (43%), Positives = 258/410 (62%), Gaps = 11/410 (2%)

Query: 8   EGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAV 67
           EG+L  E V+L+ +A    TP Y YS  A+  NY  ++ A +G +  V YA+KANSN AV
Sbjct: 9   EGALMIEGVALDAIAAQFGTPTYVYSRAALTANYRAYAAACEGRNAHVQYAMKANSNLAV 68

Query: 68  IKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESE 127
           ++  A LG+G DIVS GEL+R LAA  PA ++VFSGVGK+ DE+  AL+ G+ CFNVES 
Sbjct: 69  LQVFAQLGAGFDIVSAGELKRVLAAGAPAAKVVFSGVGKSADEMRFALKVGVACFNVESI 128

Query: 128 SELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYAST 187
            EL  LN  A S+GK AP++ R+NPD++A TH  ISTG K +KFG+   ++   Y  A+ 
Sbjct: 129 PELHRLNDVAASMGKVAPVSLRINPDVDAKTHPYISTGLKGNKFGVAFDEVLPTYRAAAA 188

Query: 188 LPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSD 247
           +P +++ G+D HIGSQI ++  +  A   + D+  QL + G  + HIDVGGGLGI Y +D
Sbjct: 189 MPNLRVVGIDCHIGSQITEVSPYLDALDKVLDVVTQLDAEGIRLAHIDVGGGLGITY-TD 247

Query: 248 HRPPSSSDYASLI-----HQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
             PP  + +A  +      + FG+    ++ EPGR LV + G+L+T+V  +K  A K F 
Sbjct: 248 ETPPDITAFARTLLDRVEQRGFGDR--TVLFEPGRSLVGNAGLLLTRVEYLKPGASKNFC 305

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND  RP +Y+AYH I  +         +  D+VGP+CE+GD++  +R +A+ +P
Sbjct: 306 IVDAAMNDLARPAMYEAYHHIVPVRE--SQSAPVVYDVVGPVCESGDWLGRDRSLAV-QP 362

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
           GD+L I   GAYG   S  YN+R    E++V+G + H+ R R  F++LI 
Sbjct: 363 GDVLAILSAGAYGFTMSSNYNTRNRAAEVIVDGDKVHLARERECFEDLIR 412


>gi|83748189|ref|ZP_00945216.1| Diaminopimelate decarboxylase [Ralstonia solanacearum UW551]
 gi|83725157|gb|EAP72308.1| Diaminopimelate decarboxylase [Ralstonia solanacearum UW551]
          Length = 419

 Score =  353 bits (905), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 183/410 (44%), Positives = 258/410 (62%), Gaps = 11/410 (2%)

Query: 8   EGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAV 67
           +G+L  E V+LE +A    TP Y YS  A+  NY  ++ A +G +  V YA+KANSN AV
Sbjct: 9   DGALMVEGVALEAIAAQFGTPTYVYSRAALTANYRAYAAACEGRNARVQYAMKANSNLAV 68

Query: 68  IKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESE 127
           ++  A LG+G DIVS GELRR LAA   A  +VFSGVGKT DE+ LAL++G+ CFNVES 
Sbjct: 69  LQIFAQLGAGFDIVSGGELRRVLAAGGKAADVVFSGVGKTADEMRLALEAGVACFNVESI 128

Query: 128 SELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYAST 187
            EL  LN+ A SLGK AP++ RVNPD++A TH  ISTG K +KFG+   ++   Y  A+ 
Sbjct: 129 PELHRLNEVAGSLGKTAPVSLRVNPDVDAKTHPYISTGLKGNKFGVAFEEVLPTYRAAAA 188

Query: 188 LPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSD 247
           +P +++ G+D HIGSQI ++  +  A   + D+  +L   G  + HIDVGGGLGI Y +D
Sbjct: 189 MPNLRVVGIDCHIGSQITEVSPYLDAIDKVLDVVARLDGEGIRLSHIDVGGGLGITY-TD 247

Query: 248 HRPPSSSDYASLI-----HQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
             PP  + +A  +      + FG+    ++ EPGR LV + G+L+T+V  +K  A K F 
Sbjct: 248 ETPPDITAFARTLLDRIEQRGFGDR--TVLFEPGRSLVGNAGLLLTRVEFLKPGAAKNFC 305

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND  RP +Y+AYH I  +   +G       D+VGP+CE+GD++  +R + + +P
Sbjct: 306 IVDAAMNDLARPAMYEAYHHIVPVRERSG--AATVYDVVGPVCESGDWLGRDRALDV-QP 362

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
           GDLL I   GAYG   S  YN+R    E++V+G + H+ R R  F++LI 
Sbjct: 363 GDLLAILSAGAYGFTMSSNYNTRNRAAEVIVDGDRVHVARERERFEDLIR 412


>gi|167838175|ref|ZP_02465034.1| diaminopimelate decarboxylase [Burkholderia thailandensis MSMB43]
          Length = 423

 Score =  353 bits (905), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 185/421 (43%), Positives = 256/421 (60%), Gaps = 12/421 (2%)

Query: 2   SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKA 61
           +AF Y +G+LHAE VS   LA    TP + YS  A+   Y  ++ A  G    +  A+KA
Sbjct: 4   AAFDYVDGTLHAERVSAADLAERFGTPLFVYSRAALTAAYEAYAKACAGRRASIHVAVKA 63

Query: 62  NSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYC 121
           NSN  V+   A LG+G DIVS GEL R LAA   A+ +VFSGVGK  DE+ +AL++G+ C
Sbjct: 64  NSNLGVLNVFARLGAGFDIVSGGELARVLAAGGRAQNVVFSGVGKNADEMRIALEAGVKC 123

Query: 122 FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSL 181
           FNVES  EL  LN  A SLGK+AP++ RVNPD++  TH  ISTG K +KFGI      + 
Sbjct: 124 FNVESIPELDRLNAVAASLGKRAPVSLRVNPDVDPKTHPYISTGLKANKFGIAFDDARAT 183

Query: 182 YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG 241
           Y  A+ LP +++ G+D HIGSQI ++  +  A   L DL +Q+ ++G  I H+DVGGGLG
Sbjct: 184 YRAAAALPNLEVVGIDCHIGSQITELSPYLDAIDKLLDLVEQIEADGVKIGHVDVGGGLG 243

Query: 242 IAYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           I Y  D  PP    Y   + +     G+   +I  EPGR L  + GIL+T+V  +K+  +
Sbjct: 244 ITY-DDETPPDIGAYVRAVLERIDARGHGHREIWFEPGRSLTGNAGILLTRVEFLKQGEE 302

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHA---DIVGPICETGDFIALNR 355
           K F I+D AMND  RP +Y A+H I     P   R+ + A   D+VGP+CE+GD++   R
Sbjct: 303 KNFAIVDAAMNDLARPAMYQAFHAI----EPVTPRMDVAAAVYDVVGPVCESGDWLGRGR 358

Query: 356 KIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
            +A+  PGDLL I   GAYG   S  YN+R    E++V+G+  H++RPR T + L E ++
Sbjct: 359 SLAIA-PGDLLAIRSAGAYGFTMSSNYNTRPRAAEVIVDGANAHLVRPRETVESLFEREA 417

Query: 416 I 416
           +
Sbjct: 418 V 418


>gi|299065455|emb|CBJ36624.1| Diaminopimelate decarboxylase [Ralstonia solanacearum CMR15]
          Length = 419

 Score =  353 bits (905), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 186/410 (45%), Positives = 259/410 (63%), Gaps = 11/410 (2%)

Query: 8   EGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAV 67
           +G+L  E V+LE +A    TP Y YS  A+  NY  ++ A +G +  V YA+KANSN AV
Sbjct: 9   DGALMIEGVALEAIAARFGTPTYVYSRAALTANYRAYAAACEGRNARVQYAMKANSNLAV 68

Query: 68  IKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESE 127
           ++  A LG+G DIVS GELRR LAA   A  +VFSGVGKT DE+ LAL++G+ CFNVES 
Sbjct: 69  LQIFAQLGAGFDIVSGGELRRVLAAGGKAADVVFSGVGKTADEMRLALEAGVACFNVESI 128

Query: 128 SELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYAST 187
            EL  LN+ A SLGK AP++ RVNPD++A TH  ISTG K +KFGI   ++   Y  A+ 
Sbjct: 129 PELHRLNEVAGSLGKTAPVSLRVNPDVDAKTHPYISTGLKGNKFGIAFEEVLPTYRAAAA 188

Query: 188 LPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSD 247
           +P +++ G+D HIGSQI ++  +  A   + D+  +L + G  + HIDVGGGLGI Y +D
Sbjct: 189 MPNLRVVGIDCHIGSQITEVSPYLDAIDKVLDVVARLDAEGIRLSHIDVGGGLGITY-TD 247

Query: 248 HRPPSSSDYASLI-----HQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
             PP  + +A  +      + FG+    ++ EPGR LV + G+L+T+V  +K  A K F 
Sbjct: 248 ETPPDITAFARTLLDRIEQRGFGDR--TVLFEPGRSLVGNAGLLLTRVEFLKPGAAKNFC 305

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND  RP +Y+AYH I   V   G    ++ DIVGP+CE+GD++  +R +   +P
Sbjct: 306 IVDAAMNDLARPAMYEAYHHI-VPVRERGGAPTVY-DIVGPVCESGDWLGRDRALD-AQP 362

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
           GDLL I   GAYG   S  YN+R    E++V+G + H+ R R  F++LI 
Sbjct: 363 GDLLAILSAGAYGFTMSSNYNTRGRAAEVIVDGDRVHVARERERFEDLIR 412


>gi|148244272|ref|YP_001218966.1| diaminopimelate decarboxylase [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326099|dbj|BAF61242.1| diaminopimelate decarboxylase [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 413

 Score =  353 bits (905), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 189/408 (46%), Positives = 260/408 (63%), Gaps = 5/408 (1%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
            F Y    LHAE+V++  L     +P Y YS T IE N+  FS+AF     +VCYA+KAN
Sbjct: 2   GFSYQNHILHAESVAIADLMKTYGSPLYVYSRTDIEYNWHLFSHAFGIHPHLVCYAVKAN 61

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+  LA +GSG D+VS GEL R L A   A R VFSGV KT  EI  AL+ GI+CF
Sbjct: 62  SNLAVLSVLAKIGSGFDVVSNGELERILLAGADASRCVFSGVAKTNIEIKRALEVGIFCF 121

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES +E+  + Q A  +  +API+ RVNPD++A TH  ISTG KE+KFG+ I     +Y
Sbjct: 122 NVESMAEMIRIEQVAKEMSMQAPISLRVNPDVDAKTHPYISTGLKENKFGVDIDDAIPIY 181

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
             A   P +K+ G+D HIGSQ+ +I  F  A   + +L  +L     ++ H+D+GGG+GI
Sbjct: 182 KMAYNSPYLKVKGIDCHIGSQLTKISPFLDALDKVLELVAKLGKLNIHVTHLDLGGGVGI 241

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y ++     ++ Y S I    G+L  KIILEPGR +V + GI VTKV  +K+++DK+F 
Sbjct: 242 KYDNEQTIDINA-YISSILDKVGSL--KIILEPGRAIVGNAGIFVTKVEFLKQNSDKSFA 298

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND +RP+ Y AYH++   ++   + +  H D+VGPICETGDF+A NR+++L   
Sbjct: 299 IIDGAMNDLLRPSFYQAYHQV-LPIDENAEGIDAHWDLVGPICETGDFLAKNRRLSLSE- 356

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
           GD L +   GAYG+  S  YNSR  + E+MV GSQ+ ++R R T Q+L
Sbjct: 357 GDYLALMSAGAYGSTMSSNYNSRPRVAEVMVLGSQYTLVRERETIQDL 404


>gi|296159586|ref|ZP_06842410.1| diaminopimelate decarboxylase [Burkholderia sp. Ch1-1]
 gi|295890294|gb|EFG70088.1| diaminopimelate decarboxylase [Burkholderia sp. Ch1-1]
          Length = 420

 Score =  353 bits (905), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 187/421 (44%), Positives = 257/421 (61%), Gaps = 13/421 (3%)

Query: 2   SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKA 61
           SAF Y  G LHAE VS   LA    TP Y YS  A+ + +  ++ A  G    V  A+KA
Sbjct: 4   SAFDYVNGVLHAEGVSAVSLAEQFGTPLYVYSRAALTEAWNAYAGACAGRRASVHVAVKA 63

Query: 62  NSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYC 121
           NSN AV+   A LG+G DIVS GEL R LAA   AE  VFSGVGK  +E+  AL +G+ C
Sbjct: 64  NSNLAVLNVFARLGAGFDIVSGGELARVLAAGGKAENTVFSGVGKNANEMREALAAGVKC 123

Query: 122 FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSL 181
           FNVES  EL  LN  A  +GKKAP++ RVNPD++A TH  ISTG K +KFG+      + 
Sbjct: 124 FNVESIPELDRLNAVAAEMGKKAPVSLRVNPDVDAKTHPYISTGLKSNKFGVAFEDARAT 183

Query: 182 YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG 241
           Y  A+ +  +++ G+D HIGSQI ++  +  A   + +L +Q+  +G  I+HIDVGGGLG
Sbjct: 184 YQAAAGMANLEVVGIDCHIGSQITEVAPYLDAVDKVLELVEQIEQDGLKIRHIDVGGGLG 243

Query: 242 IAYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           I Y  D  PP   ++   +       G+   ++  EPGR LV + G+L+T+V  +K  A+
Sbjct: 244 ITY-DDETPPEIGEFVRTVLDRIEARGHGHREVYFEPGRSLVGNAGVLLTRVEFLKPGAE 302

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVN---PAGDRLHIHADIVGPICETGDFIALNR 355
           K F I+D AMND  RP +Y+AYH I+ +V    PA    H++ D+VGP+CE+GD++   R
Sbjct: 303 KNFAIVDAAMNDLARPAMYEAYHAIDPVVKHDVPA----HVY-DVVGPVCESGDWLGRER 357

Query: 356 KIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
            +A+  PGDLL I   GAYG V S  YN+R    E+MV+G+Q H+IR R   ++L   ++
Sbjct: 358 LLAI-EPGDLLAIRSAGAYGFVMSSNYNTRPRAAEVMVDGTQTHVIRAREEARQLFSGET 416

Query: 416 I 416
           I
Sbjct: 417 I 417


>gi|90416170|ref|ZP_01224102.1| diaminopimelate decarboxylase [marine gamma proteobacterium
           HTCC2207]
 gi|90331895|gb|EAS47109.1| diaminopimelate decarboxylase [marine gamma proteobacterium
           HTCC2207]
          Length = 421

 Score =  353 bits (905), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 184/415 (44%), Positives = 262/415 (63%), Gaps = 5/415 (1%)

Query: 8   EGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAV 67
           +G+L  E+ +L  +A  + TP Y YS  AI  N+L + +A    + ++CYA+KANSN AV
Sbjct: 11  DGNLFIESTALSTIAGQLGTPCYVYSKAAISNNFLAYQSALVDKEHLICYAVKANSNIAV 70

Query: 68  IKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESE 127
           ++TLA LG+G DIVS GEL R L A     ++VFSGV KT  E+  AL+ GI+CFNVESE
Sbjct: 71  LQTLAELGAGFDIVSIGELERVLRAGGDPAKVVFSGVAKTASEMQRALELGIHCFNVESE 130

Query: 128 SELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYAST 187
           +EL+ LN  A S G  A ++ RVNPD++A TH  ISTG KE+KFGI I+    +Y  A+ 
Sbjct: 131 AELELLNSTASSCGATAAVSLRVNPDVDAQTHPYISTGLKENKFGIDINLAAQVYQRAAQ 190

Query: 188 LPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSD 247
           +  + + GVD HIGSQ+  I  F  A + L  L  +L   G  ++HID+GGGLG+ Y  D
Sbjct: 191 MAHINVVGVDCHIGSQLVDIAPFVSALERLLALVDELAGLGIALKHIDIGGGLGVRY-DD 249

Query: 248 HRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVA 307
             PP+   Y S I     +    ++LEPGR + A+ G+++T+V  +K + +K F I+D A
Sbjct: 250 EEPPTPQSYMSAILPLLMDRSETLVLEPGRSITANAGVMLTQVQYLKSNGEKNFAIVDAA 309

Query: 308 MNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLY 367
           MND +RP LY A+ +I  I    G+      D+VGP+CETGDF+A +R +++   GD L 
Sbjct: 310 MNDMIRPALYQAWMDIQSI--STGNSESAVYDVVGPVCETGDFLAKDRPLSIC-AGDYLC 366

Query: 368 IEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS-IPAWLQ 421
           +   GAYG V S  YNSR   PE+MV+G Q H++R R T ++L+  +S +PA ++
Sbjct: 367 LMSAGAYGFVMSSNYNSRPRAPEVMVDGDQIHLVRQRETIEDLLSGESLLPAVVR 421


>gi|294142609|ref|YP_003558587.1| diaminopimelate decarboxylase [Shewanella violacea DSS12]
 gi|293329078|dbj|BAJ03809.1| diaminopimelate decarboxylase [Shewanella violacea DSS12]
          Length = 414

 Score =  352 bits (904), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 187/412 (45%), Positives = 262/412 (63%), Gaps = 4/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L AE+ S+  LA    TP Y YS   +E+++  F  A      ++CYA+K
Sbjct: 1   MDHFLYKNNELLAEDCSVADLARTHGTPLYIYSRATLERHWHAFDRAVADHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL+R + A     ++VFSGVGKT  E+++AL  GI+
Sbjct: 61  ANSNIAVLNVLARLGSGFDIVSGGELQRVIQAGGDPAKVVFSGVGKTAAEMEMALNLGIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN  A  +GK AP++ R+NPD++A TH  ISTG K++KFGI + Q  +
Sbjct: 121 CFNVESAAELEQLNIVAGRIGKLAPVSLRINPDVDAGTHPYISTGLKDNKFGIAMEQAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++A A+ LP +K+ GVD HIGSQ+ +I+ F  A   +  L  +L   G +I+H DVGGGL
Sbjct: 181 IFARAAALPNLKVKGVDCHIGSQLTEIQPFLDAMDRMLALIDRLAEQGIHIEHFDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP  + YA+ + +  G+ + K+I EPGR + A+ GI VT+V+ +K + DK 
Sbjct: 241 GVPY-DDETPPQPAVYAAALIERLGDRKLKLIFEPGRAIAANAGIFVTQVLYLKGNGDKH 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F ++D AMND +RP LY A+  I   VNP  D   ++ DIVGP+CETGDF+  +R++ L 
Sbjct: 300 FALVDGAMNDLIRPALYSAWQNI-IPVNPR-DGETLNYDIVGPVCETGDFLGKDRELNLA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
             GD L +  +GAYG   S  YNSR    E+MV+G Q ++IR R    +L +
Sbjct: 358 -AGDFLAVRSSGAYGFTMSSNYNSRPRAAELMVDGEQAYVIREREKVTQLWQ 408


>gi|167564379|ref|ZP_02357295.1| diaminopimelate decarboxylase [Burkholderia oklahomensis EO147]
 gi|167571526|ref|ZP_02364400.1| diaminopimelate decarboxylase [Burkholderia oklahomensis C6786]
          Length = 423

 Score =  352 bits (904), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 185/418 (44%), Positives = 256/418 (61%), Gaps = 6/418 (1%)

Query: 2   SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKA 61
           +AF Y +G+LHAE V+  +LA    TP + YS  A+   Y  ++ A  G    V  A+KA
Sbjct: 4   AAFDYVDGTLHAERVAAAELAERFGTPLFVYSRAALTAAYDAYAKACAGRRASVHVAVKA 63

Query: 62  NSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYC 121
           NSN  V+   A LG+G DIVS GEL R LAA   A+ +VFSGVGK+ DE+  AL++G+ C
Sbjct: 64  NSNLGVLNVFARLGAGFDIVSGGELARVLAAGGRAQNVVFSGVGKSADEMRAALEAGVKC 123

Query: 122 FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSL 181
           FNVES  EL  LN  A SLGK+AP++ RVNPD++  TH  ISTG K +KFGI   +  + 
Sbjct: 124 FNVESTPELDRLNAVAASLGKRAPVSLRVNPDVDPKTHPYISTGLKANKFGIAFDEARAT 183

Query: 182 YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG 241
           Y  A+ LP + + G+D HIGSQI ++  +  A   L DL +Q+ ++G  I H+DVGGGLG
Sbjct: 184 YRAAAALPNLDVVGIDCHIGSQITELSPYLDAIDKLLDLVEQIEADGVKIHHVDVGGGLG 243

Query: 242 IAYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           I Y  D  PP    Y   + +     G+   +I  EPGR L  + GIL+T+V  +K+  +
Sbjct: 244 ITY-DDETPPDIGAYVRAVLERIDARGHGHREIWFEPGRSLTGNAGILLTRVEFLKQGDE 302

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND  RP +Y+A+H I   V P  D      D+VGP+CE+GD++   R +A
Sbjct: 303 KNFAIVDAAMNDLARPAMYEAFHAIE-PVKPRTDIATAVYDVVGPVCESGDWLGRERSLA 361

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +  PGDLL I   GAYG   S  YN+R    E++V+G+  +++RPR T + L E +S+
Sbjct: 362 IA-PGDLLAIRSAGAYGFTMSSNYNTRPRAAEVIVDGANAYLVRPRETVESLFERESV 418


>gi|218885457|ref|YP_002434778.1| diaminopimelate decarboxylase [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756411|gb|ACL07310.1| diaminopimelate decarboxylase [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 416

 Score =  352 bits (903), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 182/411 (44%), Positives = 255/411 (62%), Gaps = 3/411 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y EG L+AE V + +LA    TP Y YS   + +++  F +AF G+  + CY++K
Sbjct: 1   MHHFQYREGQLYAEGVPVHELASRYGTPLYVYSAATLRRHFQAFDSAFTGVGHLTCYSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  +++ LA +G+G+DIVS GEL RALAA VP +RIV+SGVGK  DEI  AL++ I 
Sbjct: 61  ANSNVHLLRLLADMGAGMDIVSGGELHRALAAGVPGQRIVYSGVGKQDDEIRAALEADIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL+ +N  A  +G+ A I  R+NPD++  TH  ISTG + +KFG+ + Q  +
Sbjct: 121 LFNVESVQELERINAVAGQMGRTARIGVRINPDVDPKTHPYISTGMRNNKFGLDMEQALA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A  LP V+  G+D HIGSQ+  +  F +A   + D  ++LR  G  I H+D+GGGL
Sbjct: 181 AYLLARDLPNVQPVGIDCHIGSQLTTLAPFLEALDRVLDFHERLRDLGLAITHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  +  PP   ++   + +        +ILEPGR +  + GILV +VI  K +  K 
Sbjct: 241 GITY-GEETPPHPREFGEAVSERLRGRGLSLILEPGRVIAGNAGILVGRVIYTKSTPSKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F+I D AMND +RP+LY +YH I   V PAG R  I AD+VGPICE+GDF+A +R +   
Sbjct: 300 FIIADAAMNDLVRPSLYQSYHRIAE-VQPAG-RDEITADVVGPICESGDFLARDRILPDM 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELI 411
           + G+LL +   GAYG   S  YNSR    E++V+G+    IR R T  +L+
Sbjct: 358 QQGELLAVFSAGAYGFSMSSNYNSRPRAAEVLVDGATARCIRKRETLADLV 408


>gi|17547698|ref|NP_521100.1| diaminopimelate decarboxylase [Ralstonia solanacearum GMI1000]
 gi|17430003|emb|CAD16688.1| probable diaminopimelate decarboxylase protein [Ralstonia
           solanacearum GMI1000]
          Length = 451

 Score =  352 bits (902), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 185/410 (45%), Positives = 259/410 (63%), Gaps = 11/410 (2%)

Query: 8   EGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAV 67
           +G+L  E V+LE +A    TP Y YS  A+  NY  ++ A +G +  V YA+KANSN AV
Sbjct: 41  DGALMIEGVALEAIAARFGTPTYVYSRAALTANYRAYAAACEGRNARVQYAMKANSNLAV 100

Query: 68  IKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESE 127
           ++  A LG+G DIVS GELRR LAA   A  +VFSGVGKT DE+ LAL++G+ CFNVES 
Sbjct: 101 LQIFAQLGAGFDIVSGGELRRVLAAGGKAADVVFSGVGKTADEMRLALEAGVACFNVESI 160

Query: 128 SELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYAST 187
            EL  LN+ A SLGK AP++ RVNPD++A TH  ISTG K +KFG+   ++   Y  A+ 
Sbjct: 161 PELHRLNEVAGSLGKTAPVSLRVNPDVDAKTHPYISTGLKGNKFGVAFDEVLPTYRAAAA 220

Query: 188 LPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSD 247
           +P +++ G+D HIGSQI ++  +  A   + D+  +L + G  + HIDVGGGLGI Y +D
Sbjct: 221 MPNLRVVGIDCHIGSQITEVSPYLDAIDKVLDVVARLDAEGIRLSHIDVGGGLGITY-TD 279

Query: 248 HRPPSSSDYASLI-----HQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
             PP  + +A  +      + FG+    ++ EPGR LV + G+L+T+V  +K  A K F 
Sbjct: 280 ETPPDITAFARTLLDRIEQRGFGDR--TVLFEPGRSLVGNAGLLLTRVEFLKPGAAKNFC 337

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND  RP +Y+AYH I   V   G    ++ DIVGP+CE+GD++  +R +   +P
Sbjct: 338 IVDAAMNDLARPAMYEAYHHI-VPVRERGGAPTVY-DIVGPVCESGDWLGRDRALD-AQP 394

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
           GDLL I   GAYG   S  YN+R    E++V+G + H+ R R  F++LI 
Sbjct: 395 GDLLAILSAGAYGFTMSSNYNTRGRAAEVIVDGDRVHVARERERFEDLIR 444


>gi|241664492|ref|YP_002982852.1| diaminopimelate decarboxylase [Ralstonia pickettii 12D]
 gi|240866519|gb|ACS64180.1| diaminopimelate decarboxylase [Ralstonia pickettii 12D]
          Length = 423

 Score =  352 bits (902), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 178/410 (43%), Positives = 258/410 (62%), Gaps = 11/410 (2%)

Query: 8   EGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAV 67
           EG+L  E V+L+ +A    TP Y YS  A+  NY  ++ A +G +  V YA+KANSN AV
Sbjct: 13  EGALMIEGVALDAIAAQFGTPTYVYSRAALTANYRAYAAACEGRNAHVQYAMKANSNLAV 72

Query: 68  IKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESE 127
           ++  A LG+G DIVS GEL+R LAA  PA ++VFSGVGK+ DE+  AL+ G+ CFNVES 
Sbjct: 73  LQVFAQLGAGFDIVSAGELKRVLAAGAPAAKVVFSGVGKSADEMRFALKVGVACFNVESI 132

Query: 128 SELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYAST 187
            EL  LN  A S+GK AP++ R+NPD++A TH  ISTG K +KFG+   ++   Y  A+ 
Sbjct: 133 PELHRLNDVAASMGKVAPVSLRINPDVDAKTHPYISTGLKGNKFGVAFDEVLPTYRAAAA 192

Query: 188 LPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSD 247
           +P +++ G+D HIGSQI ++  +  A   + D+  QL + G  + HIDVGGGLGI Y +D
Sbjct: 193 MPNLRVVGIDCHIGSQITEVSPYLDALDKVLDVVTQLDAEGIRLAHIDVGGGLGITY-TD 251

Query: 248 HRPPSSSDYASLI-----HQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
             PP  + +A  +      + FG+    ++ EPGR LV + G+L+T+V  +K  A K F 
Sbjct: 252 ETPPDITAFARTLLDRVEQRGFGDR--TVLFEPGRSLVGNAGLLLTRVEYLKPGASKNFC 309

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND  RP +Y+AYH I  +         +  D+VGP+CE+GD++  +R +A+ +P
Sbjct: 310 IVDAAMNDLARPAMYEAYHHIVPVRE--SQSAPVVYDVVGPVCESGDWLGRDRSLAV-QP 366

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
           GD++ I   GAYG   S  YN+R    E++V+G + H+ R R  F++LI 
Sbjct: 367 GDVVAILSAGAYGFTMSSNYNTRNRAAEVIVDGDKVHLARERECFEDLIR 416


>gi|53720784|ref|YP_109770.1| diaminopimelate decarboxylase [Burkholderia pseudomallei K96243]
 gi|53723888|ref|YP_104274.1| diaminopimelate decarboxylase [Burkholderia mallei ATCC 23344]
 gi|67641896|ref|ZP_00440661.1| diaminopimelate decarboxylase [Burkholderia mallei GB8 horse 4]
 gi|121598495|ref|YP_994480.1| diaminopimelate decarboxylase [Burkholderia mallei SAVP1]
 gi|124383764|ref|YP_001027872.1| diaminopimelate decarboxylase [Burkholderia mallei NCTC 10229]
 gi|126440111|ref|YP_001060712.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 668]
 gi|126450624|ref|YP_001082967.1| diaminopimelate decarboxylase [Burkholderia mallei NCTC 10247]
 gi|134283137|ref|ZP_01769838.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 305]
 gi|167004384|ref|ZP_02270142.1| diaminopimelate decarboxylase [Burkholderia mallei PRL-20]
 gi|167721539|ref|ZP_02404775.1| diaminopimelate decarboxylase [Burkholderia pseudomallei DM98]
 gi|167817718|ref|ZP_02449398.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 91]
 gi|167826115|ref|ZP_02457586.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 9]
 gi|167896199|ref|ZP_02483601.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 7894]
 gi|167920804|ref|ZP_02507895.1| diaminopimelate decarboxylase [Burkholderia pseudomallei BCC215]
 gi|217424773|ref|ZP_03456270.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 576]
 gi|226198282|ref|ZP_03793853.1| diaminopimelate decarboxylase [Burkholderia pseudomallei Pakistan
           9]
 gi|254174722|ref|ZP_04881383.1| diaminopimelate decarboxylase [Burkholderia mallei ATCC 10399]
 gi|254180377|ref|ZP_04886975.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 1655]
 gi|254201350|ref|ZP_04907714.1| diaminopimelate decarboxylase [Burkholderia mallei FMH]
 gi|254206692|ref|ZP_04913043.1| diaminopimelate decarboxylase [Burkholderia mallei JHU]
 gi|52211198|emb|CAH37187.1| diaminopimelate decarboxylase [Burkholderia pseudomallei K96243]
 gi|52427311|gb|AAU47904.1| diaminopimelate decarboxylase [Burkholderia mallei ATCC 23344]
 gi|121227305|gb|ABM49823.1| diaminopimelate decarboxylase [Burkholderia mallei SAVP1]
 gi|124291784|gb|ABN01053.1| diaminopimelate decarboxylase [Burkholderia mallei NCTC 10229]
 gi|126219604|gb|ABN83110.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 668]
 gi|126243494|gb|ABO06587.1| diaminopimelate decarboxylase [Burkholderia mallei NCTC 10247]
 gi|134245332|gb|EBA45425.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 305]
 gi|147747244|gb|EDK54320.1| diaminopimelate decarboxylase [Burkholderia mallei FMH]
 gi|147752234|gb|EDK59300.1| diaminopimelate decarboxylase [Burkholderia mallei JHU]
 gi|160695767|gb|EDP85737.1| diaminopimelate decarboxylase [Burkholderia mallei ATCC 10399]
 gi|184210916|gb|EDU07959.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 1655]
 gi|217392229|gb|EEC32254.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 576]
 gi|225929802|gb|EEH25818.1| diaminopimelate decarboxylase [Burkholderia pseudomallei Pakistan
           9]
 gi|238522908|gb|EEP86350.1| diaminopimelate decarboxylase [Burkholderia mallei GB8 horse 4]
 gi|243060289|gb|EES42475.1| diaminopimelate decarboxylase [Burkholderia mallei PRL-20]
          Length = 423

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 187/418 (44%), Positives = 255/418 (61%), Gaps = 6/418 (1%)

Query: 2   SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKA 61
           +AF Y +G+LHAE VS  +LA    TP + YS  A+   Y  ++ A  G    +  A+KA
Sbjct: 4   AAFDYVDGTLHAERVSTVELAERFGTPLFVYSRAALTAAYEAYAKACAGRRASIHVAVKA 63

Query: 62  NSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYC 121
           NSN  V+   A LG+G DIVS GEL R LAA   A  +VFSGVGK+ DE+ +AL++G+ C
Sbjct: 64  NSNLGVLNVFARLGAGFDIVSGGELARVLAAGGRARDVVFSGVGKSADEMRVALEAGVKC 123

Query: 122 FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSL 181
           FNVES  EL  LN  A SLGK+AP++ RVNPD++  TH  ISTG K +KFGI      + 
Sbjct: 124 FNVESIPELDRLNAVAASLGKRAPVSLRVNPDVDPKTHPYISTGLKANKFGIAFDDARAT 183

Query: 182 YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG 241
           Y  A+ LP +++ G+D HIGSQI ++  +  A   L DL +++ ++G  I H+DVGGGLG
Sbjct: 184 YRAAAALPNLEVVGIDCHIGSQITELSPYLDAIDKLLDLVERIEADGVQIHHVDVGGGLG 243

Query: 242 IAYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           I Y  D  PP    Y   +       G+ Q +I  EPGR L  + GIL+T+V  +K+  +
Sbjct: 244 ITY-DDETPPDIGAYVRAVLARIDARGHGQREIWFEPGRSLTGNAGILLTRVEFLKQGEE 302

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND  RP +Y A+H I   V P  D      DIVGP+CE+GD++   R +A
Sbjct: 303 KNFAIVDAAMNDLARPAMYQAFHAI-VPVAPRTDVAAAVYDIVGPVCESGDWLGRERSLA 361

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +  PGDLL I   GAYG   S  YN+R    E++V+G+  H++RPR T + L E ++I
Sbjct: 362 IA-PGDLLAIRSAGAYGFTMSSNYNTRPRAAEVIVDGANAHLVRPRETVESLFEHETI 418


>gi|54310576|ref|YP_131596.1| putative diaminopimelate decarboxylase [Photobacterium profundum
           SS9]
 gi|46915019|emb|CAG21794.1| putative diaminopimelate decarboxylase [Photobacterium profundum
           SS9]
          Length = 416

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 189/414 (45%), Positives = 259/414 (62%), Gaps = 6/414 (1%)

Query: 1   MSAFKYF-EGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y   G L AE+++L +LA    TP Y YS   +E+++  F  A      ++CYA+
Sbjct: 1   MDYFNYQPNGQLWAEDIALTELAERYGTPLYVYSRATLERHWNAFDQAVIDHPHLICYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+  LA LGSG DIVS+GEL R + A     ++VFSGVGKT  E+  AL+ GI
Sbjct: 61  KANSNIGVLNVLARLGSGFDIVSQGELERVITAGGDPAKVVFSGVGKTAVEMKRALELGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LNQ A  LG  API+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELERLNQVASELGLVAPISLRINPDVDAQTHPYISTGLRDNKFGIFFERAV 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y  A +LP + + G+D HIGSQ+  I+ F  A   L  L   L++ G  I+H+DVGGG
Sbjct: 181 EVYRLAHSLPNLNVVGMDCHIGSQLTNIDPFIDATDRLLALIDTLKAEGIVIKHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFG-NLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y+ + +PP  S+YAS +    G +   ++I EPGR + A+ G+L+T+V  +K +  
Sbjct: 241 LGVTYN-EEQPPLPSEYASALLARLGEHSDLELIFEPGRAIAANAGVLLTRVEFLKHTDY 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND +RPTLY A+  I  +V   G+      D+VGPICETGDFI  +R++ 
Sbjct: 300 KNFAIVDAAMNDLIRPTLYQAWQNIVPVVPREGEAKTY--DLVGPICETGDFIGKDRELC 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
           L  PGDLL +   GAYG V S  YN+R    EIMV+G+  H++R R    EL +
Sbjct: 358 LA-PGDLLAVRSAGAYGFVMSSNYNTRTRAAEIMVDGNTAHVVREREKLAELWQ 410


>gi|126453755|ref|YP_001067996.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 1106a]
 gi|167847626|ref|ZP_02473134.1| diaminopimelate decarboxylase [Burkholderia pseudomallei B7210]
 gi|242316004|ref|ZP_04815020.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 1106b]
 gi|126227397|gb|ABN90937.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 1106a]
 gi|242139243|gb|EES25645.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 1106b]
          Length = 423

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 187/418 (44%), Positives = 255/418 (61%), Gaps = 6/418 (1%)

Query: 2   SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKA 61
           +AF Y +G+LHAE VS  +LA    TP + YS  A+   Y  ++ A  G    +  A+KA
Sbjct: 4   AAFDYVDGALHAERVSTVELAERFGTPLFVYSRAALTAAYEAYAKACAGRRASIHVAVKA 63

Query: 62  NSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYC 121
           NSN  V+   A LG+G DIVS GEL R LAA   A  +VFSGVGK+ DE+ +AL++G+ C
Sbjct: 64  NSNLGVLNVFARLGAGFDIVSGGELARVLAAGGRARDVVFSGVGKSADEMRVALEAGVKC 123

Query: 122 FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSL 181
           FNVES  EL  LN  A SLGK+AP++ RVNPD++  TH  ISTG K +KFGI      + 
Sbjct: 124 FNVESIPELDRLNAVAASLGKRAPVSLRVNPDVDPKTHPYISTGLKANKFGIAFDDARAT 183

Query: 182 YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG 241
           Y  A+ LP +++ G+D HIGSQI ++  +  A   L DL +++ ++G  I H+DVGGGLG
Sbjct: 184 YRAAAALPNLEVVGIDCHIGSQITELSPYLDAIDKLLDLVERIEADGVQIHHVDVGGGLG 243

Query: 242 IAYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           I Y  D  PP    Y   +       G+ Q +I  EPGR L  + GIL+T+V  +K+  +
Sbjct: 244 ITY-DDETPPDIGAYVRAVLARIDARGHGQREIWFEPGRSLTGNAGILLTRVEFLKQGEE 302

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND  RP +Y A+H I   V P  D      DIVGP+CE+GD++   R +A
Sbjct: 303 KNFAIVDAAMNDLARPAMYQAFHAI-VPVAPRTDVAAAVYDIVGPVCESGDWLGRERSLA 361

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +  PGDLL I   GAYG   S  YN+R    E++V+G+  H++RPR T + L E ++I
Sbjct: 362 IA-PGDLLAIRSAGAYGFTMSSNYNTRPRAAEVIVDGANAHLVRPRETVESLFEHETI 418


>gi|322421972|ref|YP_004201195.1| diaminopimelate decarboxylase [Geobacter sp. M18]
 gi|320128359|gb|ADW15919.1| diaminopimelate decarboxylase [Geobacter sp. M18]
          Length = 417

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 186/421 (44%), Positives = 263/421 (62%), Gaps = 5/421 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y    L AE V+++ +     +P Y YS   +E+++    +AF G    +CY++K
Sbjct: 1   MHHFQYKGDELFAEEVAIKDIVAKTGSPVYIYSKATLERHFKAMDDAFAGAPHTICYSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+KT  +LGSG+DIVS GEL RALAA V  +++V+SGVGK  DEI  AL++GI 
Sbjct: 61  ANSNLAVLKTFINLGSGVDIVSGGELYRALAAGVDPKKVVYSGVGKRDDEIAYALETGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE EL  +N+ A  L KKA IA RVNPD++  TH  I+TG K+ KFGI I +   
Sbjct: 121 LFNVESEQELDRINEVAGRLNKKAGIAIRVNPDVDPQTHPYITTGLKKAKFGINIERALG 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A  L  ++I G+D HIGSQ+ ++  F  A K L+ L + +R  G  ++++D+GGGL
Sbjct: 181 QYQRAKELSNLEILGIDCHIGSQLTKVSPFVDAIKKLKRLLKGVREMGIEVKYLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y+ D  PP  +DY S I +   +L   ++ EPGR LV + GILV   +  KK  +K 
Sbjct: 241 GIQYN-DEAPPLPADYGSSILEETKDLGLHLLFEPGRNLVGNAGILVGTCLYTKKGEEKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIV-NPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           FVI+D  MND  RP LY ++H +  +  N  G    I  DIVGPICE+GDF+  +R+I  
Sbjct: 300 FVIVDAGMNDLARPALYGSFHGVRPVFRNQDG---VIEGDIVGPICESGDFLVKDREIPN 356

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
            + GD +     GAYG   S  YNSR  + E+MV+G +F ++R R T ++L++ + IP++
Sbjct: 357 FQQGDQIAFMSAGAYGFTMSSNYNSRPRVAEVMVDGVKFEVVRERETLEDLVKGERIPSF 416

Query: 420 L 420
           L
Sbjct: 417 L 417


>gi|291612946|ref|YP_003523103.1| diaminopimelate decarboxylase [Sideroxydans lithotrophicus ES-1]
 gi|291583058|gb|ADE10716.1| diaminopimelate decarboxylase [Sideroxydans lithotrophicus ES-1]
          Length = 433

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 183/431 (42%), Positives = 264/431 (61%), Gaps = 18/431 (4%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
           F Y +  L+AE V+L ++A    TP Y YS  A+  +Y  F+ A    D ++CYA+KANS
Sbjct: 5   FHYQQDQLYAEKVALSEIAQRFGTPCYVYSRAALTDSYRQFAEALKSRDHLICYAVKANS 64

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFN 123
           N A++   A LG+G DIVS GEL+R LAA   A ++VFSGVGK+  E+  AL++ I CFN
Sbjct: 65  NLAILNLFARLGAGFDIVSGGELQRVLAAGGAASKVVFSGVGKSEAEMRQALEAEILCFN 124

Query: 124 VESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA 183
           VES  EL  LN  A S+GK AP++ RVNPD++A TH  ISTG K++KFG+   +   LY 
Sbjct: 125 VESAPELDRLNALAGSMGKVAPVSLRVNPDVDAKTHPYISTGLKQNKFGVAYTEALELYR 184

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIA 243
            A+ +P ++++G+D HIGSQ+ +   F  A + +  L  +L + G  ++H+D+GGGLGI 
Sbjct: 185 KAAAMPNLRVTGMDCHIGSQLTETSPFIAAAEKVLALVDKLAAAGITLEHLDLGGGLGIR 244

Query: 244 YHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVI 303
           Y  D  PPS ++Y   +         K+I+EPGR LV + G+L+T++  +K   +K F I
Sbjct: 245 Y-DDETPPSIAEYGKALLAVLQGRSEKLIVEPGRVLVGNAGVLLTRIEYLKHGEEKNFAI 303

Query: 304 LDVAMNDFMRPTLYDAYHEINYI-----------VNPAGDRLHIHA-----DIVGPICET 347
           +D AMND MRP LYDA+H I  +           +  AG+R    +     ++VGPICET
Sbjct: 304 VDAAMNDLMRPALYDAWHAILPVQRRQNAPLSNSLPQAGERTSEKSNSQIYEVVGPICET 363

Query: 348 GDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTF 407
           GDFI   R++A+ + GD L +   GAYG   S  YN+R    E+MV+G+  H++R R T 
Sbjct: 364 GDFIGHAREMAVDK-GDALAVMSAGAYGMSMSSNYNTRPRAAEVMVDGAVVHLVRERETV 422

Query: 408 QELIELDSIPA 418
           ++L   + I A
Sbjct: 423 RQLYASEKIVA 433


>gi|326386636|ref|ZP_08208258.1| diaminopimelate decarboxylase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208951|gb|EGD59746.1| diaminopimelate decarboxylase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 419

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 177/421 (42%), Positives = 259/421 (61%), Gaps = 4/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMD-TMVCYAL 59
           M  F+Y  G LHAE+V L ++A  V TP Y YS   + ++   F +A   +  T + +A+
Sbjct: 1   MDHFEYRNGVLHAEDVPLPRIADAVGTPVYVYSRATLTRHARVFRDALSILPATKIAFAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           K+N N AV+K LA  G G D+VS GE+ RALAA +PAE IVFSGVGKT  E+  AL++GI
Sbjct: 61  KSNPNLAVLKVLAAEGYGADVVSGGEMERALAAGMPAEGIVFSGVGKTEAEMIRALEAGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
             FN+ES  E   L + A  LGK A  A RVNPD++A TH KISTGK E+KFG+P  +  
Sbjct: 121 GQFNLESAEEGLELAELAQRLGKTATCALRVNPDVDAGTHGKISTGKAENKFGVPFDRAA 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            ++A  S  PG+ + G+ +HIGSQ+  +     AF  +  L +++R+ GH I H+D+GGG
Sbjct: 181 DIFARLSAEPGLAMRGLALHIGSQLSSLAPLEAAFTKIGGLMREIRAAGHAITHMDLGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           +G+ Y +    P   +YA++I +   +    ++ EPGR +  + G+LVT+V+ +K+    
Sbjct: 241 VGVPYKAGDVFPQPEEYAAMIARVTADWGVTLMFEPGRVITGNTGVLVTRVVRVKEGVGH 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            +V++D AMND  RP LYDA+H+    V P G    I A+IVGPICE+ D  A+ R I  
Sbjct: 301 PWVVVDAAMNDLARPALYDAWHDFA-AVTPNGQ--TITANIVGPICESSDTFAMARDIDE 357

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
              GDL      GAYGA  + TYNSR ++PE+MV+G ++ ++  R+    ++  + +P +
Sbjct: 358 VARGDLAVFRTAGAYGATMANTYNSRPMVPEVMVDGERWAVVADRIVPATILSAERVPDF 417

Query: 420 L 420
           L
Sbjct: 418 L 418


>gi|332304598|ref|YP_004432449.1| diaminopimelate decarboxylase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332171927|gb|AEE21181.1| diaminopimelate decarboxylase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 415

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 190/416 (45%), Positives = 255/416 (61%), Gaps = 4/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L+AE+VSL  +A    TP Y YS   IE+++L F  A      +VCYA+K
Sbjct: 1   MDFFGYKNEKLYAEDVSLHDIAQTHGTPCYVYSKATIERHWLAFDKAAGAHPHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+  LA LGSG DIVS GEL R + A     ++VFSGVGKT +EI L L+  I 
Sbjct: 61  ANSNLGVLSVLAKLGSGFDIVSGGELLRVIKAGGDPSKVVFSGVGKTPEEIALGLKHNIK 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ ++Q AV+  K API+ RVNPD++A TH  ISTG K +KFGI   Q   
Sbjct: 121 CFNVESPAELERISQVAVAENKIAPISIRVNPDVDAKTHPYISTGLKANKFGIEREQAVE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y +A++LP ++I G+D HIGSQ+ +I  F  A   L  L  +L  NG  + H+DVGGGL
Sbjct: 181 VYRHAASLPNLEIKGIDCHIGSQLTEIAPFVDALDKLLVLIDELAENGITLAHLDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYF-GNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y  D  PP   +Y   I Q   G    ++I EPGR ++A+ G+L+TKV  +K+ A+K
Sbjct: 241 GVTY-KDETPPHPDEYTQAIAQRMQGREDLQLIFEPGRAIMANAGVLLTKVEFLKQGAEK 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D AMND +RP LY A+  I   ++ +  R     D+VGPICETGDFI   R++A+
Sbjct: 300 NFAIVDAAMNDLIRPALYSAWQSI-IPLDTSLTRDSAVYDVVGPICETGDFIGKERELAI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
              GD L +   GAYG V +  YNSR    EIMV+     ++R R T ++L   +S
Sbjct: 359 -EAGDYLAVRSAGAYGFVMASNYNSRCKAAEIMVDKENVIVVRERETLEDLWRGES 413


>gi|89091913|ref|ZP_01164868.1| diaminopimelate decarboxylase [Oceanospirillum sp. MED92]
 gi|89083648|gb|EAR62865.1| diaminopimelate decarboxylase [Oceanospirillum sp. MED92]
          Length = 418

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 181/413 (43%), Positives = 265/413 (64%), Gaps = 5/413 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y  G L  E+V+L  +A    TP Y YS  A+E+ YL +++A +G  ++VCYA+K
Sbjct: 1   MDNFEYRNGQLCCEDVALAGVAEEFGTPTYVYSRDALERAYLAYADALEGHKSLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LG+G DIVS GEL R L A   A +IVFSGVGK   EI  AL+ GI 
Sbjct: 61  ANSNLAVLNVLARLGAGFDIVSVGELERVLRAGGDAAKIVFSGVGKQPHEIQRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ESE+EL+ +N+ A S GK A I+FRVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNIESEAELERVNEVAGSEGKVAAISFRVNPDVDAGTHPYISTGLKENKFGIDIDDAVR 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y+ A+ +  V + G+D HIGSQ+ +++ F  A   +  L  ++   G  I+H+D+GGGL
Sbjct: 181 IYSRAADMDHVDVVGMDCHIGSQLTEVDPFLDALDRVLMLVDKIAEQGIKIKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y +D  PP+  +Y + + +       ++I EPGR + A+ G+++T+V  +K + +K 
Sbjct: 241 GVCY-TDEVPPTPQEYIAEVLKKVEGRDLELIFEPGRSIAANAGVMLTRVEFLKCTGEKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEI-NYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           F I+D AMND +RP+LY AY EI   ++   G+      D+VGP+CETGDF+  +R + L
Sbjct: 300 FAIIDGAMNDLIRPSLYSAYQEIVPVMLRETGEEQQW--DLVGPVCETGDFLGKDRSLNL 357

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
              GDLL +   GAYG V +  YNSR    E+M++ ++ ++IR R +  +L++
Sbjct: 358 -EAGDLLAVCSAGAYGFVMASNYNSRGRPAEVMIDDNKSYLIRKRESLADLVK 409


>gi|307731218|ref|YP_003908442.1| diaminopimelate decarboxylase [Burkholderia sp. CCGE1003]
 gi|307585753|gb|ADN59151.1| diaminopimelate decarboxylase [Burkholderia sp. CCGE1003]
          Length = 420

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 188/420 (44%), Positives = 260/420 (61%), Gaps = 13/420 (3%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           AF Y +G LHAE VS   LA    TP Y YS  A+ + +  +++A  G    V  A+KAN
Sbjct: 5   AFDYVDGVLHAEGVSAVSLAEQFGTPLYVYSRAALTEAWNAYASACAGRRASVHVAVKAN 64

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+   A LG+G DIVS GEL R LAA   AE  VFSGVGK  +E+  AL +G+ CF
Sbjct: 65  SNLAVLNVFARLGAGFDIVSGGELARVLAAGGKAENTVFSGVGKHANEMREALAAGVKCF 124

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES  EL  LN  A  +GKKAP++ RVNPD++A TH  ISTG K +KFG+   +  + Y
Sbjct: 125 NVESIPELDRLNAVAAQMGKKAPVSLRVNPDVDAKTHPYISTGLKSNKFGVAFDEARATY 184

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
             A+ +  +++ G+D HIGSQI ++  +  A   L +L +Q+  +G  I+HIDVGGGLGI
Sbjct: 185 QAAAAMANLEVVGIDCHIGSQITEVAPYLDAVDKLLELVEQIEQDGMTIRHIDVGGGLGI 244

Query: 243 AYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
            Y  D  PP  SD+   +       G+   ++  EPGR LV + G+L+T+V  +K  A+K
Sbjct: 245 TY-DDETPPDISDFVRTVLDRIEARGHGHREVYFEPGRSLVGNAGVLLTRVEFLKPGAEK 303

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVN---PAGDRLHIHADIVGPICETGDFIALNRK 356
            F I+D AMND  RP +Y+AYH I+ +V    PA    H++ D+VGP+CE+GD++   R 
Sbjct: 304 NFAIVDAAMNDLARPAMYEAYHAIDAVVQRELPA----HVY-DVVGPVCESGDWLGRERL 358

Query: 357 IALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +A+  PGDLL I   GAYG V S  YN+R    E+MV+G+Q H++R R   Q+L   +++
Sbjct: 359 LAV-EPGDLLAIRSAGAYGFVMSSNYNTRPRAAEVMVDGTQAHVVRAREEVQQLFAGETV 417


>gi|310823824|ref|YP_003956182.1| diaminopimelate decarboxylase [Stigmatella aurantiaca DW4/3-1]
 gi|309396896|gb|ADO74355.1| Diaminopimelate decarboxylase [Stigmatella aurantiaca DW4/3-1]
          Length = 413

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 172/410 (41%), Positives = 253/410 (61%), Gaps = 3/410 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M++F+Y +G+LHAE+V L  +A  V TP Y YS  A+  ++     AF     ++CY++K
Sbjct: 1   MTSFQYKKGALHAESVPLGAIAEAVGTPTYVYSQAALTGHFQVLDKAFGESPHLICYSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANS  AV+   A +GSG DIVS GEL R   A     + VF+GVGKT +E+  AL +GI 
Sbjct: 61  ANSTLAVLGLFAGMGSGFDIVSGGELARVRQARGDMGKTVFAGVGKTQEEMARALAAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL+ L+      G++AP   RVNPD++A TH+ ISTG K  KFG+P  +  +
Sbjct: 121 LFNVESAEELEALDAVGRQAGRRAPFGLRVNPDVDARTHRYISTGLKTSKFGVPFEEAVA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LYA A  + GV+  GVD HIGSQ+ +      A   +  L  +L++ GH ++++D+GGGL
Sbjct: 181 LYARARKMKGVRALGVDCHIGSQLTRTAPVKAALSKVAGLYAELKAQGHPLEYLDIGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y +D  PPS  +YA  + +       ++ILEPGR LV + G+L+T+V+  K++  KT
Sbjct: 241 GITY-ADETPPSPQEYARTVLEVVKGTGARLILEPGRSLVGNAGVLLTRVLYRKQAPAKT 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FV++D  MND +RP LY+A+H +  +V   G  + +  D+VGP+CE+ D +A  R + LP
Sbjct: 300 FVVVDAGMNDLIRPALYEAHHALLPVVKQRGKAVEV--DVVGPVCESTDVLARARPLVLP 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
           R G L  +   GAYG   + TYNSR    E++V G+ + ++R R   ++L
Sbjct: 358 RQGALFAVMSAGAYGMSMASTYNSRPRPAEVLVEGTAWRVVRERERDEDL 407


>gi|83721058|ref|YP_443535.1| diaminopimelate decarboxylase [Burkholderia thailandensis E264]
 gi|167620699|ref|ZP_02389330.1| diaminopimelate decarboxylase [Burkholderia thailandensis Bt4]
 gi|257137679|ref|ZP_05585941.1| diaminopimelate decarboxylase [Burkholderia thailandensis E264]
 gi|83654883|gb|ABC38946.1| diaminopimelate decarboxylase [Burkholderia thailandensis E264]
          Length = 423

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 183/418 (43%), Positives = 255/418 (61%), Gaps = 6/418 (1%)

Query: 2   SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKA 61
           +AF Y +G+LHAE V    LA    TP + YS  A+   Y  ++ A  G    +  A+KA
Sbjct: 4   AAFDYVDGTLHAERVCTADLAERFGTPLFVYSRAALTAAYEAYAKACAGRRASIHVAVKA 63

Query: 62  NSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYC 121
           NSN  V+   A LG+G DIVS GEL R LAA   A+ +VFSGVGK+ DE+ +AL++G+ C
Sbjct: 64  NSNLGVLNVFARLGAGFDIVSGGELARVLAAGGRAQNVVFSGVGKSADEMRIALEAGVKC 123

Query: 122 FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSL 181
           FNVES  EL  LN  A SLGK+AP++ RVNPD++  TH  ISTG K +KFGI      + 
Sbjct: 124 FNVESIPELDRLNAVAASLGKRAPVSLRVNPDVDPKTHPYISTGLKANKFGIAFDDARAT 183

Query: 182 YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG 241
           Y  A+ LP +++ G+D HIGSQI ++  +  A   L DL +Q+ ++G  I H+DVGGGLG
Sbjct: 184 YRAAAALPNLEVVGIDCHIGSQITELSPYLDAIDKLLDLVEQIEADGVKIHHVDVGGGLG 243

Query: 242 IAYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           I Y  D  PP    Y   + +     G+   +I  EPGR L  + GIL+T+V  +K+  +
Sbjct: 244 ITY-DDETPPDIGAYVRAVLERIDARGHGHREIWFEPGRSLTGNAGILLTRVEFLKQGEE 302

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND  RP +Y A+H I   V P  D      D+VGP+CE+GD++  +R +A
Sbjct: 303 KNFAIVDAAMNDLARPAMYQAFHAIE-PVTPRTDVAAAVYDVVGPVCESGDWLGRDRSLA 361

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +  PGDLL I   GAYG   S  YN+R    E++V+G+  +++RPR T + L E +++
Sbjct: 362 IA-PGDLLAIRSAGAYGFTMSSNYNARPRAAEVIVDGASAYLVRPRETVESLFEREAV 418


>gi|83595885|gb|ABC25247.1| diaminopimelate decarboxylase [uncultured marine bacterium Ant4D3]
          Length = 421

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 181/404 (44%), Positives = 259/404 (64%), Gaps = 3/404 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y    LHAE++ L ++A    TP Y YS   +E+NY+ +S A +G + +VCYA+K
Sbjct: 5   MDNFEYRGEKLHAEDLDLNQIAEQFGTPTYVYSRDTLERNYVAYSQALEGCEHLVCYAVK 64

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LG+G DIVS GEL R L A    +RIVFSGVGK   E+  AL+ G++
Sbjct: 65  ANSNIAVLNVLAQLGAGFDIVSVGELERVLVAGADPKRIVFSGVGKQTHEMQRALEVGVH 124

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE+EL+ L   A  +   AP++ R+NPD++A TH  ISTG KE+KFGI I Q  +
Sbjct: 125 CFNVESEAELERLQNVAAGMNCIAPVSLRINPDVDAKTHPYISTGLKENKFGIGIDQAPA 184

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A+ +  +K+ GVD HIGSQ+  I+ +  A   L  L   + + G  I+H+D+GGGL
Sbjct: 185 AYAQAAAMAHIKVIGVDCHIGSQLTSIDPYLDAMDRLFGLIDTIAAQGIAIEHLDLGGGL 244

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP+ +D+ + +  + G+ +  ++ EPGR + AD G+L+T+V  IK + DK 
Sbjct: 245 GVCY-GDEEPPAIADFMARVRAHLGDRKLALVFEPGRSICADAGVLLTRVEYIKNNQDKY 303

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ +I  +   +  + H + DIVGPICET DF+  +R +A+ 
Sbjct: 304 FAIVDAAMNDLIRPALYSAWQDIIPVNLHSNSQAH-NFDIVGPICETSDFLGKDRNLAI- 361

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPR 404
              DLL +  +GAYG   +  YNSR    E+MV+G++ H+I  R
Sbjct: 362 EANDLLAVCSSGAYGFAMASNYNSRNRAAEVMVDGNKSHLIGER 405


>gi|76810164|ref|YP_335101.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 1710b]
 gi|167740511|ref|ZP_02413285.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 14]
 gi|167904581|ref|ZP_02491786.1| diaminopimelate decarboxylase [Burkholderia pseudomallei NCTC
           13177]
 gi|167912845|ref|ZP_02499936.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 112]
 gi|254190340|ref|ZP_04896848.1| diaminopimelate decarboxylase [Burkholderia pseudomallei Pasteur
           52237]
 gi|254258974|ref|ZP_04950028.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 1710a]
 gi|76579617|gb|ABA49092.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 1710b]
 gi|157938016|gb|EDO93686.1| diaminopimelate decarboxylase [Burkholderia pseudomallei Pasteur
           52237]
 gi|254217663|gb|EET07047.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 1710a]
          Length = 423

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 187/418 (44%), Positives = 254/418 (60%), Gaps = 6/418 (1%)

Query: 2   SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKA 61
           +AF Y +G+LHAE VS   LA    TP + YS  A+   Y  ++ A  G    +  A+KA
Sbjct: 4   AAFDYVDGTLHAERVSTIDLAERFGTPLFVYSRAALTAAYEAYAKACAGRRASIHVAVKA 63

Query: 62  NSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYC 121
           NSN  V+   A LG+G DIVS GEL R LAA   A  +VFSGVGK+ DE+ +AL++G+ C
Sbjct: 64  NSNLGVLNVFARLGAGFDIVSGGELARVLAAGGRARDVVFSGVGKSADEMRVALEAGVKC 123

Query: 122 FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSL 181
           FNVES  EL  LN  A SLGK+AP++ RVNPD++  TH  ISTG K +KFGI      + 
Sbjct: 124 FNVESIPELDRLNAVAASLGKRAPVSLRVNPDVDPKTHPYISTGLKANKFGIAFDDARAT 183

Query: 182 YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG 241
           Y  A+ LP +++ G+D HIGSQI ++  +  A   L DL +++ ++G  I H+DVGGGLG
Sbjct: 184 YRAAAALPNLEVVGIDCHIGSQITELSPYLDAIDKLLDLVERIEADGVQIHHVDVGGGLG 243

Query: 242 IAYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           I Y  D  PP    Y   +       G+ Q +I  EPGR L  + GIL+T+V  +K+  +
Sbjct: 244 ITY-DDETPPDIGAYVRAVLARIDARGHGQREIWFEPGRSLTGNAGILLTRVEFLKQGEE 302

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND  RP +Y A+H I   V P  D      DIVGP+CE+GD++   R +A
Sbjct: 303 KNFAIVDAAMNDLARPAMYQAFHAI-VPVAPRTDVAAAVYDIVGPVCESGDWLGRERSLA 361

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +  PGDLL I   GAYG   S  YN+R    E++V+G+  H++RPR T + L E ++I
Sbjct: 362 IA-PGDLLAIRSAGAYGFTMSSNYNTRPRAAEVIVDGANAHLVRPRETVESLFEHETI 418


>gi|288941801|ref|YP_003444041.1| diaminopimelate decarboxylase [Allochromatium vinosum DSM 180]
 gi|288897173|gb|ADC63009.1| diaminopimelate decarboxylase [Allochromatium vinosum DSM 180]
          Length = 423

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 186/410 (45%), Positives = 257/410 (62%), Gaps = 3/410 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F   +G LHAE V L ++A    TP Y YS   +E+++  F  AF     ++C+++K
Sbjct: 1   MDHFNDRDGLLHAEEVPLTEIAERFGTPCYVYSRATLERHWRAFERAFRDHPHLICFSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +NSN AV+  LA LGSG DIVS GEL R LAA     R+VFSGVGK  DEI  AL+ GI 
Sbjct: 61  SNSNLAVLNVLARLGSGFDIVSVGELERVLAAGGDPARVVFSGVGKRADEIRRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESESEL  +++ A  LG +AP++ RVNPD++  TH  ISTG KE+KFGI I +  S
Sbjct: 121 CFNVESESELTRIDRIAGELGVRAPVSLRVNPDVDPQTHHYISTGLKENKFGIDIQEAES 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A+ +P +K+ G+D HIGSQ+  +  F  A   +  L  +L ++G  I+H+D+GGGL
Sbjct: 181 VYALAAAMPNLKVVGIDCHIGSQLTDLAPFIDALGRVLALADRLCASGIAIEHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  +H P  ++  A++ H    +   ++ILEPGR +V + G+L+T+V  +K    K 
Sbjct: 241 GIRYREEHPPEPAAYAAAMSH-LLADRPYEVILEPGRAIVGNAGVLLTQVEYLKHGPHKH 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F ILD AMND +RP LY A HEI  +V    D      D+VGP+CETGDF+  +R +AL 
Sbjct: 300 FAILDAAMNDLLRPALYQAGHEIVRVVQET-DADPSRYDLVGPVCETGDFLGKDRTLAL- 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
             GDL+ +   GAYG   S  YNSR    E+MV+G + +++R R    +L
Sbjct: 358 EEGDLVAVRGAGAYGFTMSSNYNSRPRAAEVMVDGDRAYLVRAREQVADL 407


>gi|300690200|ref|YP_003751195.1| diaminopimelate decarboxylase [Ralstonia solanacearum PSI07]
 gi|299077260|emb|CBJ49886.1| Diaminopimelate decarboxylase [Ralstonia solanacearum PSI07]
          Length = 419

 Score =  350 bits (898), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 183/410 (44%), Positives = 259/410 (63%), Gaps = 11/410 (2%)

Query: 8   EGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAV 67
           +G+L  E V+LE +A    TP Y YS  A+  NY  ++ A +  +  V YA+KANSN AV
Sbjct: 9   DGALMVEGVALEAIAAQFGTPTYVYSRAALTANYRAYAAACESRNARVQYAMKANSNLAV 68

Query: 68  IKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESE 127
           ++  A LG+G DIVS GELRR LAA   A  +VFSGVGKT DE+ LAL++G+ CFNVES 
Sbjct: 69  LQIFAQLGAGFDIVSGGELRRVLAAGGKAANVVFSGVGKTADEMRLALEAGVACFNVESI 128

Query: 128 SELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYAST 187
            EL  LN+ A SLGK AP++ R+NPD++A TH  ISTG K +KFG+   ++   Y  A+ 
Sbjct: 129 PELHRLNEVAGSLGKTAPVSLRINPDVDAKTHPYISTGLKGNKFGVAFEEVLPTYRAAAA 188

Query: 188 LPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSD 247
           +P +++ G+D HIGSQI ++  +  A   + D+  +L + G  + HIDVGGGLGI Y +D
Sbjct: 189 MPNLRMVGIDCHIGSQITEVSPYLDAIDKVLDVVARLDAEGIRLSHIDVGGGLGITY-TD 247

Query: 248 HRPPSSSDYASLI-----HQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
             PP  + +A  +      + FG+    ++ EPGR LV + G+L+T+V  +K  A K F 
Sbjct: 248 ETPPDITAFARTLLDRIEQRGFGDR--TVLFEPGRSLVGNAGLLLTRVEFLKPGAAKNFC 305

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND  RP +Y+AYH I   V   G    ++ DIVGP+CE+GD++  +R + + +P
Sbjct: 306 IVDAAMNDLARPAMYEAYHHI-VPVRERGGAPTVY-DIVGPVCESGDWLGRDRALDV-QP 362

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
           GDLL I   GAYG   S  YN+R    E++V+G + H+ R R  F++LI 
Sbjct: 363 GDLLAILSAGAYGFTMSSNYNTRNRAAEVIVDGDRVHVARERERFEDLIR 412


>gi|167582586|ref|ZP_02375460.1| diaminopimelate decarboxylase [Burkholderia thailandensis TXDOH]
          Length = 423

 Score =  350 bits (898), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 183/418 (43%), Positives = 255/418 (61%), Gaps = 6/418 (1%)

Query: 2   SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKA 61
           +AF Y +G+LHAE V    LA    TP + YS  A+   Y  ++ A  G    +  A+KA
Sbjct: 4   AAFDYVDGTLHAERVCTADLAERFGTPLFVYSRAALTAAYEAYAKACAGRRASIHVAVKA 63

Query: 62  NSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYC 121
           NSN  V+   A LG+G DIVS GEL R LAA   A+ +VFSGVGK+ DE+ +AL++G+ C
Sbjct: 64  NSNLGVLNVFARLGAGFDIVSGGELARVLAAGGRAQNVVFSGVGKSADEMRIALEAGVKC 123

Query: 122 FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSL 181
           FNVES  EL  LN  A SLGK+AP++ RVNPD++  TH  ISTG K +KFGI      + 
Sbjct: 124 FNVESIPELDRLNAVAASLGKRAPVSLRVNPDVDPKTHPYISTGLKANKFGIAFDDARAT 183

Query: 182 YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG 241
           Y  A+ LP +++ G+D HIGSQI ++  +  A   L DL +Q+ ++G  I H+DVGGGLG
Sbjct: 184 YRAAAALPNLEVVGIDCHIGSQITELSPYLDAIDKLLDLVEQIEADGVKIHHVDVGGGLG 243

Query: 242 IAYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           I Y  D  PP    Y   + +     G+   +I  EPGR L  + GIL+T+V  +K+  +
Sbjct: 244 ITY-DDETPPDIGAYVRAVLERIDARGHGHREIWFEPGRSLTGNAGILLTRVEFLKQGEE 302

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND  RP +Y A+H I   V P  D      D+VGP+CE+GD++  +R +A
Sbjct: 303 KNFAIVDAAMNDLARPAMYQAFHAIE-PVTPRTDVAAAVYDVVGPVCESGDWLGRDRSLA 361

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +  PGDLL I   GAYG   S  YN+R    E++V+G+  +++RPR T + L E +++
Sbjct: 362 IA-PGDLLAIRSAGAYGFTMSSNYNTRPRAAEVIVDGASAYLVRPRETVESLFEREAV 418


>gi|332704148|ref|ZP_08424236.1| diaminopimelate decarboxylase [Desulfovibrio africanus str. Walvis
           Bay]
 gi|332554297|gb|EGJ51341.1| diaminopimelate decarboxylase [Desulfovibrio africanus str. Walvis
           Bay]
          Length = 420

 Score =  350 bits (898), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 181/411 (44%), Positives = 255/411 (62%), Gaps = 3/411 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y  G LHAE++ +E LA    TP Y YS     +++  F +AF  +  + CY++K
Sbjct: 1   MHHFEYHNGRLHAEDIPVEDLARQFGTPLYVYSKATFSRHFQAFDSAFSALPHITCYSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V++ LA LG+G+DIVS GEL RAL A V  E+IV+SGVGK  +EI  AL +GI 
Sbjct: 61  ANSNLCVLRLLASLGAGMDIVSGGELHRALKAGVSPEKIVYSGVGKRPEEIRQALDAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL+T++  A   G+ A I+ R+NPD++  TH  ISTG K++KFG+ +     
Sbjct: 121 MFNVESREELRTISAIASESGRIARISLRINPDVDPKTHPYISTGMKKNKFGLDMETSLE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A  LPG++  G+D HIGSQ+  IE F +A   L +   +LR  G +I+++D+GGGL
Sbjct: 181 TYRMAKGLPGIEPVGIDCHIGSQLTSIEPFLEALDKLVEFYGKLREMGIDIRYLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y+ +  PP    +   + +    L   IILEPGR +  + GILVTKV+  K +  K 
Sbjct: 241 GITYNEEE-PPHPEAFGKALTERLKGLPLTIILEPGRVIAGNAGILVTKVLYTKSTPSKD 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FVI+D AMND +RP+LY ++H I  +V    +R  I+ D+VGPICE+GDF+A +R++   
Sbjct: 300 FVIVDAAMNDLVRPSLYGSFHRIAEVVE--HNRPKINVDVVGPICESGDFLARDRELPNV 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELI 411
             G+LL     GAYG   S  YNSR    E+MV+G    + R R T+ +L+
Sbjct: 358 ESGELLAAFSAGAYGFAMSSQYNSRPRAAEVMVDGEVTVLARRRETYDDLV 408


>gi|262172884|ref|ZP_06040562.1| diaminopimelate decarboxylase [Vibrio mimicus MB-451]
 gi|261893960|gb|EEY39946.1| diaminopimelate decarboxylase [Vibrio mimicus MB-451]
          Length = 417

 Score =  350 bits (897), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 188/418 (44%), Positives = 258/418 (61%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE V L  LA+   TP Y YS   +E+++  F  +      ++CYA+
Sbjct: 1   MDYFNYQDDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGDYPHLICYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA LGSG DIVS GEL R LAA     ++VFSGVGKT  E+  ALQ  I
Sbjct: 61  KANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL  LN+ A  LG KAPI+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESERELHRLNKVAAELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDRAA 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y  A +LP + + G+D HIGSQ+  +  F  A   L  L   L++ G +I+H+DVGGG
Sbjct: 181 EVYRLAHSLPHLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  S+YA +L+ +   +   ++I EPGR + A+ G+LVTKV  +K +  
Sbjct: 241 LGVVYR-DELPPQPSEYAKALLDRLERHRDLELIFEPGRAIAANAGVLVTKVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND +RP LY A+ +I  +    G+      D+VGP+CET DF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLIRPALYQAWQDIIPLRPRQGEAQTY--DLVGPVCETSDFLGKDRDLV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L   GDLL +  +GAYG   S  YNSR  + E+MV+G++ H++R R T   L  L+S+
Sbjct: 358 L-EEGDLLAVRSSGAYGFTMSSNYNSRPRVAEVMVDGNKAHLVRQRETLSSLWALESV 414


>gi|115372602|ref|ZP_01459909.1| diaminopimelate decarboxylase [Stigmatella aurantiaca DW4/3-1]
 gi|115370323|gb|EAU69251.1| diaminopimelate decarboxylase [Stigmatella aurantiaca DW4/3-1]
          Length = 457

 Score =  350 bits (897), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 172/410 (41%), Positives = 253/410 (61%), Gaps = 3/410 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M++F+Y +G+LHAE+V L  +A  V TP Y YS  A+  ++     AF     ++CY++K
Sbjct: 45  MTSFQYKKGALHAESVPLGAIAEAVGTPTYVYSQAALTGHFQVLDKAFGESPHLICYSVK 104

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANS  AV+   A +GSG DIVS GEL R   A     + VF+GVGKT +E+  AL +GI 
Sbjct: 105 ANSTLAVLGLFAGMGSGFDIVSGGELARVRQARGDMGKTVFAGVGKTQEEMARALAAGIL 164

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL+ L+      G++AP   RVNPD++A TH+ ISTG K  KFG+P  +  +
Sbjct: 165 LFNVESAEELEALDAVGRQAGRRAPFGLRVNPDVDARTHRYISTGLKTSKFGVPFEEAVA 224

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LYA A  + GV+  GVD HIGSQ+ +      A   +  L  +L++ GH ++++D+GGGL
Sbjct: 225 LYARARKMKGVRALGVDCHIGSQLTRTAPVKAALSKVAGLYAELKAQGHPLEYLDIGGGL 284

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y +D  PPS  +YA  + +       ++ILEPGR LV + G+L+T+V+  K++  KT
Sbjct: 285 GITY-ADETPPSPQEYARTVLEVVKGTGARLILEPGRSLVGNAGVLLTRVLYRKQAPAKT 343

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FV++D  MND +RP LY+A+H +  +V   G  + +  D+VGP+CE+ D +A  R + LP
Sbjct: 344 FVVVDAGMNDLIRPALYEAHHALLPVVKQRGKAVEV--DVVGPVCESTDVLARARPLVLP 401

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
           R G L  +   GAYG   + TYNSR    E++V G+ + ++R R   ++L
Sbjct: 402 RQGALFAVMSAGAYGMSMASTYNSRPRPAEVLVEGTAWRVVRERERDEDL 451


>gi|91785428|ref|YP_560634.1| diaminopimelate decarboxylase [Burkholderia xenovorans LB400]
 gi|91689382|gb|ABE32582.1| diaminopimelate decarboxylase [Burkholderia xenovorans LB400]
          Length = 420

 Score =  350 bits (897), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 186/421 (44%), Positives = 255/421 (60%), Gaps = 13/421 (3%)

Query: 2   SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKA 61
           SAF Y +G LHAE VS   LA    TP Y YS  A+   +  ++ A  G    V  A+KA
Sbjct: 4   SAFDYVDGVLHAEGVSAVSLAEQFGTPLYVYSRAALTAAWNAYAGACAGRRASVHVAVKA 63

Query: 62  NSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYC 121
           NSN AV+   A LG+G DIVS GEL R LAA   AE  VFSGVGK  +E+  AL +G+ C
Sbjct: 64  NSNLAVLNVFARLGAGFDIVSGGELARVLAAGGKAENTVFSGVGKNANEMREALAAGVKC 123

Query: 122 FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSL 181
           FNVES  EL  LN  A  +GKKAP++ RVNPD++A TH  ISTG K +KFG+      + 
Sbjct: 124 FNVESIPELDRLNAVAAEMGKKAPVSLRVNPDVDAKTHPYISTGLKSNKFGVAFEDARAT 183

Query: 182 YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG 241
           Y  A+ +  +++ G+D HIGSQI +   +  A   + +L +Q+  +G  I+HIDVGGGLG
Sbjct: 184 YQAAAGMANLEVVGIDCHIGSQITEAAPYLDAVDKVLELVEQIEQDGLKIRHIDVGGGLG 243

Query: 242 IAYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           I Y  D  PP   ++   +       G+   ++  EPGR LV + G+L+T+V  +K  A+
Sbjct: 244 ITY-DDETPPEIGEFVRTVLDRIEARGHGHREVYFEPGRSLVGNAGVLLTRVEFLKPGAE 302

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVN---PAGDRLHIHADIVGPICETGDFIALNR 355
           K F I+D AMND  RP +Y+AYH I+ +V    PA    H++ D+VGP+CE+GD++   R
Sbjct: 303 KNFAIVDAAMNDLARPAMYEAYHAIDPVVKRDVPA----HVY-DVVGPVCESGDWLGRER 357

Query: 356 KIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
            +A+  PGDLL I   GAYG V S  YN+R    E+MV+G+Q H+ R R   ++L   ++
Sbjct: 358 LLAV-EPGDLLAIRSAGAYGFVMSSNYNTRPRAAEVMVDGTQVHVARAREEVRQLFVGET 416

Query: 416 I 416
           I
Sbjct: 417 I 417


>gi|187930324|ref|YP_001900811.1| diaminopimelate decarboxylase [Ralstonia pickettii 12J]
 gi|187727214|gb|ACD28379.1| diaminopimelate decarboxylase [Ralstonia pickettii 12J]
          Length = 423

 Score =  350 bits (897), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 178/410 (43%), Positives = 257/410 (62%), Gaps = 11/410 (2%)

Query: 8   EGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAV 67
           EG+L  E V+L+ +A    TP Y YS  A+  NY  ++ A +G +  V YA+KANSN AV
Sbjct: 13  EGALMIEGVALDAIAAQFGTPTYVYSRAALTANYRAYAAACEGRNAHVQYAMKANSNLAV 72

Query: 68  IKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESE 127
           ++  A LG+G DIVS GEL+R L A  PA ++VFSGVGK+ DE+  AL+ G+ CFNVES 
Sbjct: 73  LQVFAQLGAGFDIVSAGELKRVLRAGAPASKVVFSGVGKSADEMRFALEVGVACFNVESI 132

Query: 128 SELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYAST 187
            EL  LN  A S+GK AP++ R+NPD++A TH  ISTG K +KFG+   ++   Y  A+ 
Sbjct: 133 PELHRLNDVAASMGKVAPVSLRINPDVDAKTHPYISTGLKGNKFGVAFDEVLPTYRAAAA 192

Query: 188 LPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSD 247
           +P + + G+D HIGSQI ++  +  A   + D+  QL + G ++ HIDVGGGLGI Y +D
Sbjct: 193 MPNLHVVGIDCHIGSQITEVSPYLDALDKVLDVVTQLDAEGIHLSHIDVGGGLGITY-TD 251

Query: 248 HRPPSSSDYASLI-----HQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
             PP  + +A  +      + FG+    ++ EPGR LV + G+L+T+V  +K  A K F 
Sbjct: 252 ETPPDITAFARTLLDRVEQRGFGDR--TVLFEPGRSLVGNAGLLLTRVEYLKPGASKNFC 309

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND  RP +Y+AYH I  +         +  D+VGP+CE+GD++  +R +A+ +P
Sbjct: 310 IVDAAMNDLARPAMYEAYHHIVPVRE--SQSAPVVYDVVGPVCESGDWLGRDRSLAV-QP 366

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
           GD+L I   GAYG   S  YN+R    E++V+G + H+ R R  F++LI 
Sbjct: 367 GDVLAILSAGAYGFTMSSNYNTRNRAAEVIVDGDKIHLARERECFEDLIR 416


>gi|217975044|ref|YP_002359795.1| diaminopimelate decarboxylase [Shewanella baltica OS223]
 gi|217500179|gb|ACK48372.1| diaminopimelate decarboxylase [Shewanella baltica OS223]
          Length = 414

 Score =  350 bits (897), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 188/412 (45%), Positives = 258/412 (62%), Gaps = 4/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y + +LHAE   +  LA    TP Y YS   +E+++  F+NA      ++CYA+K
Sbjct: 1   MDHFLYQQNALHAEGCQVADLAQTYGTPLYIYSRATLERHWHAFNNAVADHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           AN+N AV+  LA LGSG DIVS GEL R + A     ++VFSGVGKT  E++ AL  GIY
Sbjct: 61  ANANLAVLNVLARLGSGFDIVSGGELARVMEAGGDPAKVVFSGVGKTAAEMEQALNLGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN  A  LGK AP++ R+NPD++A TH  ISTG KE+KFGI + +   
Sbjct: 121 CFNVESSAELEQLNLVAGRLGKVAPVSLRINPDVDAGTHPYISTGLKENKFGIAMDEAEI 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++A A  LP +K+ GVD HIGSQ+ +I+ F  A   +  L  +L   G  I+H DVGGGL
Sbjct: 181 VFARAHALPHLKVKGVDCHIGSQLTEIKPFLDAMDRMLALIDRLAEQGIVIEHFDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y ++  PP    YA+ I    G+ Q K+I EPGR + A+ GI VT+V+ +K+++DK 
Sbjct: 241 GVTYDAE-TPPHPDVYAAAILARLGDRQLKLIFEPGRAIAANAGIFVTQVLYLKENSDKR 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+  I  +V    D      DIVGP+CETGDF+  NR++AL 
Sbjct: 300 FAIVDGAMNDLIRPALYSAWQNIIPVV--PRDSEAYEFDIVGPVCETGDFLGKNRQLALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
              DLL +  +GAYG   +  YN+R    E+MV+G Q  ++R R    +L +
Sbjct: 358 AG-DLLAVRSSGAYGFAMASNYNTRPRAAEVMVDGEQAFLVREREKLSQLWQ 408


>gi|126176184|ref|YP_001052333.1| diaminopimelate decarboxylase [Shewanella baltica OS155]
 gi|160877194|ref|YP_001556510.1| diaminopimelate decarboxylase [Shewanella baltica OS195]
 gi|125999389|gb|ABN63464.1| diaminopimelate decarboxylase [Shewanella baltica OS155]
 gi|160862716|gb|ABX51250.1| diaminopimelate decarboxylase [Shewanella baltica OS195]
 gi|315269398|gb|ADT96251.1| diaminopimelate decarboxylase [Shewanella baltica OS678]
          Length = 414

 Score =  350 bits (897), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 188/412 (45%), Positives = 258/412 (62%), Gaps = 4/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y + +LHAE   +  LA    TP Y YS   +E+++  F+NA      ++CYA+K
Sbjct: 1   MDHFLYQQNALHAEGCQVADLAQTYGTPLYIYSRATLERHWHAFNNAVADHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           AN+N AV+  LA LGSG DIVS GEL R + A     ++VFSGVGKT  E++ AL  GIY
Sbjct: 61  ANANLAVLNVLARLGSGFDIVSGGELARVMEAGGDPAKVVFSGVGKTAAEMEQALNLGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN  A  LGK AP++ R+NPD++A TH  ISTG KE+KFGI + +   
Sbjct: 121 CFNVESSAELELLNLVAGRLGKVAPVSLRINPDVDAGTHPYISTGLKENKFGIAMDEAEI 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++A A  LP +K+ GVD HIGSQ+ +I+ F  A   +  L  +L   G  I+H DVGGGL
Sbjct: 181 VFARAHALPHLKVKGVDCHIGSQLTEIKPFLDAMDRMLALIDRLAEQGIVIEHFDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y ++  PP    YA+ I    G+ Q K+I EPGR + A+ GI VT+V+ +K+++DK 
Sbjct: 241 GVTYDAE-TPPHPDVYAAAILARLGDRQLKLIFEPGRAIAANAGIFVTQVLYLKENSDKR 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+  I  +V    D      DIVGP+CETGDF+  NR++AL 
Sbjct: 300 FAIVDGAMNDLIRPALYSAWQNIIPVV--PRDSEAYEFDIVGPVCETGDFLGKNRQLALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
              DLL +  +GAYG   +  YN+R    E+MV+G Q  ++R R    +L +
Sbjct: 358 AG-DLLAVRSSGAYGFAMASNYNTRPRAAEVMVDGEQAFLVREREKLSQLWQ 408


>gi|256829250|ref|YP_003157978.1| diaminopimelate decarboxylase [Desulfomicrobium baculatum DSM 4028]
 gi|256578426|gb|ACU89562.1| diaminopimelate decarboxylase [Desulfomicrobium baculatum DSM 4028]
          Length = 423

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 184/414 (44%), Positives = 257/414 (62%), Gaps = 3/414 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y  G LHAE++++  L +   TP Y YS T ++++Y  F +AFDG+D + CY++K
Sbjct: 1   MHHFQYKNGQLHAEDIAVADLVYEYGTPLYIYSATTLKRHYKAFDSAFDGIDHLTCYSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN + +K LA  G+G DIVS GEL RAL A V  ++IV+SGVGK   EI  AL + I 
Sbjct: 61  ANSNLSFLKILAQEGAGTDIVSGGELFRALRAGVDPKKIVYSGVGKKTVEIQEALFADIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL+ +N  A  + K A ++ R+NPD++  TH  +STG KE+KFG+       
Sbjct: 121 MFNVESVQELERINDVAGGVDKVARVSLRINPDVDPKTHPYVSTGLKENKFGLSRADALK 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            YA A +LP V+  G+D HIGSQ+ Q+  F +A + L++   QL   G  I+++D+GGGL
Sbjct: 181 AYALAQSLPNVEPIGMDCHIGSQLTQLSPFMEALEKLKEFHGQLVQMGIKIKYMDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y+ +  PP   +    + +    L   +ILEPGR +  + GILVT+V   K + DKT
Sbjct: 241 GITYN-EEAPPHPEELGKALIESLKGLDVTLILEPGRVIAGNTGILVTEVQYTKTNEDKT 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FVI+D AMND +RP+LY +YH I  +    G+ +   AD+VGPICE+GDF+A NR     
Sbjct: 300 FVIVDAAMNDLVRPSLYGSYHRIASVREGNGEEM--TADVVGPICESGDFLAKNRTFPKV 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELD 414
             GDLL     GAYG V S  YNSR    EIMV G +  ++R R  + +L+ L+
Sbjct: 358 AQGDLLAAFSAGAYGFVMSSQYNSRARAAEIMVEGDKHVLVRKREVYNDLVALE 411


>gi|254198509|ref|ZP_04904930.1| diaminopimelate decarboxylase [Burkholderia pseudomallei S13]
 gi|169655249|gb|EDS87942.1| diaminopimelate decarboxylase [Burkholderia pseudomallei S13]
          Length = 423

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 187/418 (44%), Positives = 254/418 (60%), Gaps = 6/418 (1%)

Query: 2   SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKA 61
           +AF Y +G+LHAE VS   LA    TP + YS  A+   Y  ++ A  G    +  A+KA
Sbjct: 4   AAFDYVDGTLHAERVSTIDLAERFGTPLFVYSRAALTAAYEAYAKACAGRRASIHVAVKA 63

Query: 62  NSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYC 121
           NSN  V+   A LG+G DIVS GEL R LAA   A  +VFSGVGK+ DE+ +AL++G+ C
Sbjct: 64  NSNLGVLNVFARLGAGFDIVSGGELARVLAAGGRARDVVFSGVGKSADEMRVALEAGVKC 123

Query: 122 FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSL 181
           FNVES  EL  LN  A SLGK+AP++ RVNPD++  TH  ISTG K +KFGI      + 
Sbjct: 124 FNVESIPELDRLNAVAASLGKRAPVSLRVNPDVDPKTHPYISTGLKANKFGIAFDDARAT 183

Query: 182 YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG 241
           Y  A+ LP +++ G+D HIGSQI ++  +  A   L DL +++ ++G  I H+DVGGGLG
Sbjct: 184 YRAAAALPNLEVVGIDCHIGSQITELSPYLDAIDKLLDLVERIEADGVQIHHVDVGGGLG 243

Query: 242 IAYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           I Y  D  PP    Y   +       G+ Q +I  EPGR L  + GIL+T+V  +K+  +
Sbjct: 244 ITY-DDETPPDIGAYVRAVLARIDARGHGQREIWFEPGRSLTGNAGILLTRVEFLKQGEE 302

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND  RP +Y A+H I   V P  D      DIVGP+CE+GD++   R +A
Sbjct: 303 KNFAIVDAAMNDLARPAMYQAFHAI-VPVAPRTDVAAAVYDIVGPVCESGDWLGRERLLA 361

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +  PGDLL I   GAYG   S  YN+R    E++V+G+  H++RPR T + L E ++I
Sbjct: 362 IA-PGDLLAIRSAGAYGFTMSSNYNTRPRAAEVIVDGANAHLVRPRETVESLFEHETI 418


>gi|153002477|ref|YP_001368158.1| diaminopimelate decarboxylase [Shewanella baltica OS185]
 gi|151367095|gb|ABS10095.1| diaminopimelate decarboxylase [Shewanella baltica OS185]
          Length = 414

 Score =  349 bits (895), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 188/412 (45%), Positives = 258/412 (62%), Gaps = 4/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y + +LHAE   +  LA    TP Y YS   +E+++  F+NA      ++CYA+K
Sbjct: 1   MDHFLYQQNALHAEGCQVAYLAQTYGTPLYIYSRATLERHWHAFNNAVADHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           AN+N AV+  LA LGSG DIVS GEL R + A     ++VFSGVGKT  E++ AL  GIY
Sbjct: 61  ANANLAVLNVLARLGSGFDIVSGGELARVMEAGGDPAKVVFSGVGKTAAEMEQALNLGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN  A  LGK AP++ R+NPD++A TH  ISTG KE+KFGI + +   
Sbjct: 121 CFNVESSAELEQLNLVAGRLGKVAPVSLRINPDVDAGTHPYISTGLKENKFGIAMDEAEI 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++A A  LP +K+ GVD HIGSQ+ +I+ F  A   +  L  +L   G  I+H DVGGGL
Sbjct: 181 VFARAHALPHLKVKGVDCHIGSQLTEIKPFLDAMDRMLALIDRLAEQGIVIEHFDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y ++  PP    YA+ I    G+ Q K+I EPGR + A+ GI VT+V+ +K+++DK 
Sbjct: 241 GVTYDAE-TPPHPDVYAAAILARLGDRQLKLIFEPGRAIAANAGIFVTQVLYLKENSDKR 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+  I  +V    D      DIVGP+CETGDF+  NR++AL 
Sbjct: 300 FAIVDGAMNDLIRPALYSAWQNIIPVV--PRDSEAYEFDIVGPVCETGDFLGKNRQLALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
              DLL +  +GAYG   +  YN+R    E+MV+G Q  ++R R    +L +
Sbjct: 358 AG-DLLAVRSSGAYGFAMASNYNTRPRAAEVMVDGEQAFLVREREKLSQLWQ 408


>gi|207721858|ref|YP_002252296.1| diaminopimelate decarboxylase protein [Ralstonia solanacearum
           MolK2]
 gi|206587025|emb|CAQ17609.1| diaminopimelate decarboxylase protein [Ralstonia solanacearum
           MolK2]
          Length = 407

 Score =  349 bits (895), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 181/404 (44%), Positives = 255/404 (63%), Gaps = 11/404 (2%)

Query: 14  ENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAH 73
           E V+LE +A    TP Y YS  A+  NY  ++ A +G +  V YA+KANSN AV++  A 
Sbjct: 3   EGVALEAIAAQFGTPTYVYSRAALTANYRAYAAACEGRNARVQYAMKANSNLAVLQIFAQ 62

Query: 74  LGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTL 133
           LG+G DIVS GELRR LAA   A  +VFSGVGKT DE+ LAL++G+ CFNVES  EL  L
Sbjct: 63  LGAGFDIVSGGELRRVLAAGGKAADVVFSGVGKTADEMRLALEAGVACFNVESIPELHRL 122

Query: 134 NQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKI 193
           N+ A SLGK AP++ RVNPD++A TH  ISTG K +KFG+   ++   Y  A+ +P +++
Sbjct: 123 NEVAGSLGKTAPVSLRVNPDVDAKTHPYISTGLKGNKFGVAFEEVLPTYRAAAAMPNLRV 182

Query: 194 SGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSS 253
            G+D HIGSQI ++  +  A   + D+  +L + G  + HIDVGGGLGI Y +D  PP  
Sbjct: 183 VGIDCHIGSQITEVSPYLDAIDKVLDVVARLDAEGIRLSHIDVGGGLGITY-TDETPPDI 241

Query: 254 SDYASLI-----HQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAM 308
           + +A  +      + FG+    ++ EPGR LV + G+L+T+V  +K  A K F I+D AM
Sbjct: 242 TAFARTLLDRIEQRGFGDR--TVLFEPGRSLVGNAGLLLTRVEFLKPGAAKNFCIVDAAM 299

Query: 309 NDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYI 368
           ND  RP +Y+AYH I  +   +G       D+VGP+CE+GD++  +R + + +PGDLL I
Sbjct: 300 NDLARPAMYEAYHHIVPVRERSG--AATVYDVVGPVCESGDWLGRDRALDV-QPGDLLAI 356

Query: 369 EKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
              GAYG   S  YN+R    E++V+G + H+ R R  F++LI 
Sbjct: 357 LSAGAYGFTMSSNYNTRNRAAEVIVDGDRVHVARERERFEDLIR 400


>gi|237814107|ref|YP_002898558.1| diaminopimelate decarboxylase [Burkholderia pseudomallei MSHR346]
 gi|237505838|gb|ACQ98156.1| diaminopimelate decarboxylase [Burkholderia pseudomallei MSHR346]
          Length = 423

 Score =  349 bits (895), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 186/418 (44%), Positives = 254/418 (60%), Gaps = 6/418 (1%)

Query: 2   SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKA 61
           +AF Y +G+LHAE VS  +LA    TP + YS  A+   Y  ++ A  G    +  A+KA
Sbjct: 4   AAFDYVDGTLHAERVSTVELAERFGTPLFVYSRAALTAAYEAYAKACAGRRASIHVAVKA 63

Query: 62  NSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYC 121
           NSN  V+   A LG+G DIVS GEL R LAA   A  +VFSGVGK+ DE+ +AL++G+ C
Sbjct: 64  NSNLGVLNVFARLGAGFDIVSGGELARVLAAGGRARDVVFSGVGKSADEMRVALEAGVKC 123

Query: 122 FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSL 181
           FNVES  EL  LN  A SLGK+AP++ RVNPD++  TH  ISTG K +KFGI      + 
Sbjct: 124 FNVESIPELDRLNAVAASLGKRAPVSLRVNPDVDPKTHPYISTGLKANKFGIAFDDARAT 183

Query: 182 YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG 241
           Y  A+  P +++ G+D HIGSQI ++  +  A   L DL +++ ++G  I H+DVGGGLG
Sbjct: 184 YRAAAAQPNLEVVGIDCHIGSQITELSPYLDAIDKLLDLVERIEADGVQIHHVDVGGGLG 243

Query: 242 IAYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           I Y  D  PP    Y   +       G+ Q +I  EPGR L  + GIL+T+V  +K+  +
Sbjct: 244 ITY-DDETPPDIGAYVRAVLARIDARGHGQREIWFEPGRSLTGNAGILLTRVEFLKQGEE 302

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND  RP +Y A+H I   V P  D      DIVGP+CE+GD++   R +A
Sbjct: 303 KNFAIVDAAMNDLARPAMYQAFHAI-VPVAPRTDVAAAVYDIVGPVCESGDWLGRERSLA 361

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +  PGDLL I   GAYG   S  YN+R    E++V+G+  H++RPR T + L E ++I
Sbjct: 362 IA-PGDLLAIRSAGAYGFTMSSNYNTRPRAAEVIVDGANAHLVRPRETVESLFEHETI 418


>gi|331005625|ref|ZP_08328994.1| Diaminopimelate decarboxylase [gamma proteobacterium IMCC1989]
 gi|330420550|gb|EGG94847.1| Diaminopimelate decarboxylase [gamma proteobacterium IMCC1989]
          Length = 417

 Score =  349 bits (895), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 184/416 (44%), Positives = 254/416 (61%), Gaps = 2/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y +  L  E +SL+ +A    TP Y YS  A  ++Y  + +A      M+CYA+K
Sbjct: 1   MNHFYYQQQQLMCEQLSLDTIAKQYGTPAYVYSRAAFTQHYCEYRDALGDHPGMICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R + A    +RIVFSGV KT  E+  AL+ G+Y
Sbjct: 61  ANSNIAVLNVLAKLGSGFDIVSIGELERVIQAGGDPQRIVFSGVAKTEGEMRRALELGVY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ES  EL  L   A S+G +API+ RVNPD++A TH  ISTG KE+KFG+ I     
Sbjct: 121 CFNIESIPELSRLQTVAESMGVQAPISLRVNPDVDAETHPYISTGLKENKFGVDIDHAVE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y +A+TLP + I GVD HIGSQ+  +  F  A   +  L  QL   G  I+H+D+GGGL
Sbjct: 181 IYQHAATLPNLTIKGVDCHIGSQLTSVAPFLDALDRVLALIDQLAEQGIIIEHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y+ D +PP   DY   + +        +  EPGR + A+ G+L+TKV  +K +  K 
Sbjct: 241 GVVYN-DEQPPKIGDYIDEVKRRIAGRNLSLSFEPGRSIAANAGVLLTKVEFLKPTEHKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D  MND +RP+LY A+ ++  +     D      D+VGP+CETGDF+A +R++AL 
Sbjct: 300 FAIIDAGMNDNIRPSLYRAWQKVLPVTETKADTATELWDLVGPVCETGDFLAKDRELALD 359

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
             GD L +  +GAYG   S  YNSR    EIMV+G + HIIR R T  +L++ +++
Sbjct: 360 E-GDYLALMSSGAYGFTMSSNYNSRGRAIEIMVDGDKSHIIRQRETVADLVKGEAL 414


>gi|88813059|ref|ZP_01128301.1| diaminopimelate decarboxylase [Nitrococcus mobilis Nb-231]
 gi|88789692|gb|EAR20817.1| diaminopimelate decarboxylase [Nitrococcus mobilis Nb-231]
          Length = 425

 Score =  348 bits (894), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 185/404 (45%), Positives = 255/404 (63%), Gaps = 2/404 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           ++ F    G LHAE+++L  +A    TP Y YS  AIE  +  F +AF G D ++CYA+K
Sbjct: 5   LNNFTLRNGVLHAEDIALPSVAKRFGTPCYVYSRRAIEAAWRVFDDAFAGHDHLICYAVK 64

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R LAA     ++VFSGV KT  E+  AL+ GI 
Sbjct: 65  ANSNLAVLNLLARLGSGFDIVSGGELERVLAAGGDPAKVVFSGVAKTEAEMRRALEVGIL 124

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL+ L   A SL ++A ++ R+NPD++ +TH  I+TG  E+KFGI IH +  
Sbjct: 125 CFNVESEPELERLAAVAQSLNRRARVSLRINPDVDPDTHPYIATGLSENKFGIDIHAVER 184

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LPG+ ++GVD HIGSQ+ +IE    A + +  L  +L+  G  I H+DVGGG+
Sbjct: 185 VYRRAADLPGIDVTGVDFHIGSQLTRIEPITDALERVLALIDRLQGQGIEISHLDVGGGV 244

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
            I Y  D  PPS   YA  +     +   +++LEPGR +V + G+L+T+V  +K +A + 
Sbjct: 245 AIRYR-DETPPSIGTYARQLLARLESRPLRVLLEPGRAIVGNAGVLLTRVEYLKHTAQRH 303

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LYDA+  I  +V   GD      D+VGP+CE+ DF+A +R++AL 
Sbjct: 304 FAIVDAAMNDLLRPALYDAWMAIEAVVPREGDTPTRRYDVVGPVCESADFLARDRELAL- 362

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPR 404
             GDLL +   GAYG V S  YNSR    E++ +G   H+IR R
Sbjct: 363 AAGDLLAVRSAGAYGFVMSSNYNSRPRPAELLADGEVIHLIRER 406


>gi|254300613|ref|ZP_04968058.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 406e]
 gi|157810592|gb|EDO87762.1| diaminopimelate decarboxylase [Burkholderia pseudomallei 406e]
          Length = 423

 Score =  348 bits (894), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 186/418 (44%), Positives = 254/418 (60%), Gaps = 6/418 (1%)

Query: 2   SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKA 61
           +AF Y +G+LHAE VS  +LA    TP + YS  A+   Y  ++ A  G    +  A+KA
Sbjct: 4   AAFDYVDGTLHAERVSTVELAERFGTPLFVYSRAALTAAYEAYAKACAGRRASIHVAVKA 63

Query: 62  NSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYC 121
           NSN  V+   A LG+G DIVS GEL R LAA   A  +VFSGVGK+ DE+ +AL++G+ C
Sbjct: 64  NSNLGVLNVFARLGAGFDIVSGGELARVLAAGGRARDVVFSGVGKSADEMRVALEAGVKC 123

Query: 122 FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSL 181
           FNVES  EL  LN  A SLGK+AP++ RVNPD++  TH  ISTG K +KFGI      + 
Sbjct: 124 FNVESIPELDRLNAVAASLGKRAPVSLRVNPDVDPKTHPYISTGLKANKFGIAFDDARAT 183

Query: 182 YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG 241
           Y  A+ LP +++ G+D HIGSQI ++  +  A   L DL +++ ++G  I H+DVGGGLG
Sbjct: 184 YRAAAALPNLEVVGIDCHIGSQITELSPYLDAIDKLLDLVERIEADGVQIHHVDVGGGLG 243

Query: 242 IAYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           I Y  D  PP    Y   +       G+ Q +I  EPGR L  + GIL+T+V  +K+  +
Sbjct: 244 ITY-DDETPPDIGAYVRAVLARIDARGHGQREIWFEPGRSLTGNAGILLTRVEFLKQGEE 302

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND  RP +Y A+H I   V P  D      DIVGP+CE+GD++   R +A
Sbjct: 303 KNFAIVDAAMNDLARPAMYQAFHAI-VPVAPRTDVAAAVYDIVGPVCESGDWLGRERSLA 361

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +  PG LL I   GAYG   S  YN+R    E++V+G+  H++RPR T + L E ++I
Sbjct: 362 IA-PGGLLAIRSAGAYGFTMSSNYNTRPRAAEVIVDGANAHLVRPRETVESLFEHEAI 418


>gi|87121333|ref|ZP_01077223.1| diaminopimelate decarboxylase [Marinomonas sp. MED121]
 gi|86163490|gb|EAQ64765.1| diaminopimelate decarboxylase [Marinomonas sp. MED121]
          Length = 418

 Score =  348 bits (894), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 186/415 (44%), Positives = 258/415 (62%), Gaps = 15/415 (3%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y + +L AE VS+  +A    TP Y YS   +E++Y  +++AF    +++CYA+K
Sbjct: 1   MDFFNYKDQALMAEGVSIASIAQQHGTPCYVYSRETLERHYKAYADAFASHPSLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SN A++  LA +G+G DIVS GEL R L A   A +++FSG+GK   E++ AL+ GI+
Sbjct: 61  ACSNIAILNVLAKMGAGFDIVSVGELERVLRAGGDASKVMFSGLGKQAHEMERALEVGIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ESE EL  LN+ A  LGKKAP++ RVNPD++A TH  ISTG KE+KFGI I+    
Sbjct: 121 CFNIESEFELYRLNEVAEKLGKKAPVSLRVNPDVDAKTHPYISTGLKENKFGIDINDAVR 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A  LP + + GVD HIGSQ+ ++  F  AF  L  L  +L   G  I+H+D+GGGL
Sbjct: 181 IYTIAHELPYLDVMGVDCHIGSQLTELTPFIDAFDRLLKLIDELALVGIEIKHVDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP  +DYA+L+     N    +  EPGR + A+ GILVT+V  +K S  K 
Sbjct: 241 GVRYR-DEVPPVPADYAALVLPKVENRAFSLAFEPGRSIAANAGILVTQVEFLKCSEHKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHA-------DIVGPICETGDFIAL 353
           F I+D AMND +RP+LY A+ +I  +      +L   A       D+VGP+CETGDF+  
Sbjct: 300 FAIIDGAMNDLIRPSLYSAWMDIVPV------KLKSQATGNKKLYDLVGPVCETGDFLGK 353

Query: 354 NRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQ 408
           +R++ L   GDLL +   GAYG   S  YNSR    E+MV+G + H+IR R T +
Sbjct: 354 DRELDL-EAGDLLAVRSAGAYGFTMSSNYNSRNRAAEVMVDGDKVHLIRARETIE 407


>gi|207744536|ref|YP_002260928.1| diaminopimelate decarboxylase protein [Ralstonia solanacearum
           IPO1609]
 gi|206595942|emb|CAQ62869.1| diaminopimelate decarboxylase protein [Ralstonia solanacearum
           IPO1609]
          Length = 407

 Score =  348 bits (893), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 181/404 (44%), Positives = 254/404 (62%), Gaps = 11/404 (2%)

Query: 14  ENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAH 73
           E V+LE +A    TP Y YS  A+  NY  ++ A +G +  V YA+KANSN AV++  A 
Sbjct: 3   EGVALEAIAAQFGTPTYVYSRAALTANYRAYAAACEGRNARVQYAMKANSNLAVLQIFAQ 62

Query: 74  LGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTL 133
           LG+G DIVS GELRR LAA   A  +VFSGVGKT DE+ LAL++G+ CFNVES  EL  L
Sbjct: 63  LGAGFDIVSGGELRRVLAAGGKAADVVFSGVGKTADEMRLALEAGVACFNVESIPELHRL 122

Query: 134 NQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKI 193
           N+ A SLGK AP++ RVNPD++A TH  ISTG K +KFG+   ++   Y  A+ +P +++
Sbjct: 123 NEVAGSLGKTAPVSLRVNPDVDAKTHPYISTGLKGNKFGVAFEEVLPTYRAAAAMPNLRV 182

Query: 194 SGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSS 253
            G+D HIGSQI ++  +  A   + D+  +L   G  + HIDVGGGLGI Y +D  PP  
Sbjct: 183 VGIDCHIGSQITEVSPYLDAIDKVLDVVARLDGEGIRLSHIDVGGGLGITY-TDETPPDI 241

Query: 254 SDYASLI-----HQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAM 308
           + +A  +      + FG+    ++ EPGR LV + G+L+T+V  +K  A K F I+D AM
Sbjct: 242 TAFARTLLDRIEQRGFGDR--TVLFEPGRSLVGNAGLLLTRVEFLKPGAAKNFCIVDAAM 299

Query: 309 NDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYI 368
           ND  RP +Y+AYH I  +   +G       D+VGP+CE+GD++  +R + + +PGDLL I
Sbjct: 300 NDLARPAMYEAYHHIVPVRERSG--AATVYDVVGPVCESGDWLGRDRALDV-QPGDLLAI 356

Query: 369 EKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
              GAYG   S  YN+R    E++V+G + H+ R R  F++LI 
Sbjct: 357 LSAGAYGFTMSSNYNTRNRAAEVIVDGDRVHVARERERFEDLIR 400


>gi|198284947|ref|YP_002221268.1| diaminopimelate decarboxylase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218666233|ref|YP_002427632.1| diaminopimelate decarboxylase [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198249468|gb|ACH85061.1| diaminopimelate decarboxylase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218518446|gb|ACK79032.1| diaminopimelate decarboxylase [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 419

 Score =  348 bits (893), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 180/417 (43%), Positives = 262/417 (62%), Gaps = 5/417 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y + +L+ E++ L+++A    TP Y YS  A+ + Y +FS A  G +T VCYA+K
Sbjct: 1   MNTFHYRDHALYGEDLPLQEIAAHYGTPCYVYSEAALRERYHSFSAAL-GDNTRVCYAVK 59

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  +++  A +G+G DIVS GEL R L A   A  IVFSGVGK+  EI  AL +GI+
Sbjct: 60  ANSNLGILRIFAEMGAGFDIVSGGELERVLRAGGDAGTIVFSGVGKSSVEIRAALGAGIF 119

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           C NVES +EL  +   A  +GK+AP+A RVNPD++  TH+ I+TG KE KFGIP+ Q   
Sbjct: 120 CLNVESAAELWRIADIAADMGKRAPVALRVNPDVDPGTHRYIATGLKESKFGIPMDQARH 179

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           LY  A+  P +++ G+  HIGSQ+  +    +A   +R L  +L ++G  +QH+D+GGG+
Sbjct: 180 LYLQAAQHPALELKGIACHIGSQLLDLTPLGEAAGRVRALYDELAAHGIALQHLDLGGGV 239

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI YH D  PPS +DYA  + Q    +  + ++E GR L  + G+L+TKV  +K +  K 
Sbjct: 240 GIRYH-DEIPPSPADYAWTLDQALQGVAVRRVVELGRALAGNAGVLLTKVEYLKDNGGKQ 298

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F ++D AMND +RP LY A+H+I  +    G    +  D+VGP+CE+GDF+A +R +A  
Sbjct: 299 FCVVDAAMNDLLRPALYGAWHDILPLHQSVGTGPAM--DVVGPVCESGDFLARDRPLA-A 355

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIP 417
           + GDLL +   GAYG   S  YNSR   PE++++G Q  +IR R T  + + L+  P
Sbjct: 356 KAGDLLAVMSAGAYGFAMSSNYNSRPRPPEVLISGHQHRLIRRRETLADQLSLEENP 412


>gi|170695718|ref|ZP_02886860.1| diaminopimelate decarboxylase [Burkholderia graminis C4D1M]
 gi|170139323|gb|EDT07509.1| diaminopimelate decarboxylase [Burkholderia graminis C4D1M]
          Length = 420

 Score =  348 bits (893), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 189/420 (45%), Positives = 256/420 (60%), Gaps = 13/420 (3%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           AF Y +G LHAE VS   LA    TP Y YS  A+   +  ++ A  G    V  A+KAN
Sbjct: 5   AFDYVDGVLHAEGVSAVSLAEQFGTPLYVYSRAALTAAWNAYAGACAGRRASVHVAVKAN 64

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+   A LG+G DIVS GEL R LAA   AE  VFSGVGK  +E+  AL +G+ CF
Sbjct: 65  SNLAVLNVFARLGAGFDIVSGGELARVLAAGGKAENTVFSGVGKHANEMREALAAGVKCF 124

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES  EL  LNQ A  +GKKAP++ RVNPD++A TH  ISTG K +KFG+      + Y
Sbjct: 125 NVESIPELDRLNQVAAQMGKKAPVSLRVNPDVDAKTHPYISTGLKSNKFGVAFEDARATY 184

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
             A+ +  +++ G+D HIGSQI +I  +  A   + +L +Q+  +G  I+HIDVGGGLGI
Sbjct: 185 QAAAAMTNLEVVGIDCHIGSQITEIAPYLDAVDKVLELVEQIEQDGVTIRHIDVGGGLGI 244

Query: 243 AYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
            Y  D  PP   ++   +       G+   ++  EPGR LV + G+L+T+V  +K  A+K
Sbjct: 245 TY-DDETPPDIGEFVRTVLDRIEARGHGHREVYFEPGRSLVGNAGVLLTRVEFLKPGAEK 303

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVN---PAGDRLHIHADIVGPICETGDFIALNRK 356
            F I+D AMND  RP +YDAYH I+  V    PA    H++ DIVGP+CE+GD++   R 
Sbjct: 304 NFAIVDAAMNDLARPAMYDAYHAIDAAVKRDVPA----HVY-DIVGPVCESGDWLGRERL 358

Query: 357 IALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +++  PGDLL I   GAYG V S  YN+R    E+MV+G+Q H++R R   Q+L   ++I
Sbjct: 359 LSV-EPGDLLAIRSAGAYGFVMSSNYNTRPRAAEVMVDGTQAHVVRAREEVQQLFAGEAI 417


>gi|120600508|ref|YP_965082.1| diaminopimelate decarboxylase [Shewanella sp. W3-18-1]
 gi|120560601|gb|ABM26528.1| diaminopimelate decarboxylase [Shewanella sp. W3-18-1]
          Length = 414

 Score =  348 bits (893), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 187/412 (45%), Positives = 256/412 (62%), Gaps = 4/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y   +LHAE   +  LA    TP Y YS   +E+++  F+NA      ++CYA+K
Sbjct: 1   MDHFLYHNNALHAEGCQVADLAKTYGTPLYIYSRATLERHWHAFNNAVMDHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           AN+N AV+  LA LGSG DIVS GEL R + A     ++VFSGVGKT+ E++ AL  GIY
Sbjct: 61  ANANLAVLNVLARLGSGFDIVSGGELARVIEAGGSPAKVVFSGVGKTVAEMEQALNLGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN  A  LGK AP++ R+NPD++A TH  ISTG KE+KFGI + +   
Sbjct: 121 CFNVESSAELEQLNLVAGRLGKVAPVSLRINPDVDAGTHPYISTGLKENKFGIAMDEAEI 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++A A  LP +K+ GVD HIGSQ+ +I+ F  A   +  L  +L   G  I+H DVGGGL
Sbjct: 181 VFARAHALPHLKVKGVDCHIGSQLTEIQPFLDAMDRMLALIDRLAEQGIVIEHFDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP    YA+ + +  GN + K+I EPGR + A+ GI VT+V+ +K+++DK 
Sbjct: 241 GVTY-DDETPPHPDVYAAALLKRLGNRKLKLIFEPGRAIAANAGIFVTQVLYLKENSDKR 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+  I  +V    D      DIVGP+CETGDF+   RK+AL 
Sbjct: 300 FAIVDGAMNDLIRPALYSAWQNIIPVV--PRDSEAYEFDIVGPVCETGDFLGKERKLALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
              DLL +  +GAYG   +  YN+R    E+MV+G    ++R R    +L +
Sbjct: 358 AG-DLLAVRSSGAYGFAMASNYNTRPRAAEVMVDGEHAFLVREREKISQLWQ 408


>gi|146294666|ref|YP_001185090.1| diaminopimelate decarboxylase [Shewanella putrefaciens CN-32]
 gi|145566356|gb|ABP77291.1| diaminopimelate decarboxylase [Shewanella putrefaciens CN-32]
 gi|319427902|gb|ADV55976.1| diaminopimelate decarboxylase [Shewanella putrefaciens 200]
          Length = 414

 Score =  348 bits (892), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 187/412 (45%), Positives = 255/412 (61%), Gaps = 4/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y   +LHAE   +  LA    TP Y YS   +E+++  F+NA      ++CYA+K
Sbjct: 1   MDHFLYHNNALHAEGCQVADLAKTYGTPLYIYSRATLERHWHAFNNAVMDHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           AN+N AV+  LA LGSG DIVS GEL R + A     ++VFSGVGKT+ E++ AL  GIY
Sbjct: 61  ANANLAVLNVLARLGSGFDIVSGGELARVIEAGGSPAKVVFSGVGKTVAEMEQALNLGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN  A  LGK AP++ R+NPD++A TH  ISTG KE+KFGI + +   
Sbjct: 121 CFNVESSAELEQLNLVAGRLGKVAPVSLRINPDVDAGTHPYISTGLKENKFGIAMDEAEI 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++A A  LP +K+ GVD HIGSQ+ +I+ F  A   +  L  +L   G  I+H DVGGGL
Sbjct: 181 VFARAHALPHLKVKGVDCHIGSQLTEIQPFLDAMDRMLALIDRLAEQGIVIEHFDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP    YA+ + +  GN + K+I EPGR + A+ GI VT+V+ +K+++DK 
Sbjct: 241 GVTY-DDETPPHPDVYAAALLKRLGNRKLKLIFEPGRAIAANAGIFVTQVLYLKENSDKR 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+   N I     D      DIVGP+CETGDF+   RK+AL 
Sbjct: 300 FAIVDGAMNDLIRPALYSAWQ--NIIPVAPRDSEAYEFDIVGPVCETGDFLGKERKLALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
              DLL +  +GAYG   +  YN+R    E+MV+G    ++R R    +L +
Sbjct: 358 AG-DLLAVRSSGAYGFAMASNYNTRPRAAEVMVDGEHAFLVREREKISQLWQ 408


>gi|186477550|ref|YP_001859020.1| diaminopimelate decarboxylase [Burkholderia phymatum STM815]
 gi|184194009|gb|ACC71974.1| diaminopimelate decarboxylase [Burkholderia phymatum STM815]
          Length = 420

 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 185/418 (44%), Positives = 257/418 (61%), Gaps = 7/418 (1%)

Query: 2   SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKA 61
           SAF Y +G LHAE VS   LA    TP Y YS  A+ K +  +++A  G    V  A+KA
Sbjct: 4   SAFAYVDGVLHAEGVSAVSLAEQFGTPLYVYSRDALTKAWHAYADACAGRRATVHVAVKA 63

Query: 62  NSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYC 121
           NSN AV+   A +G+G DIVS GEL R LAA   AE  VFSGVGK++ E+  AL +G+ C
Sbjct: 64  NSNLAVLNLFARMGAGFDIVSGGELARVLAAGGKAENTVFSGVGKSVAEMRDALAAGVKC 123

Query: 122 FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSL 181
           FNVES  EL  LN  A  +GKKAP++ RVNPD++A TH  ISTG K +KFG+      + 
Sbjct: 124 FNVESIPELDRLNAVAGEMGKKAPVSLRVNPDVDAKTHPYISTGLKSNKFGVAFDDARAT 183

Query: 182 YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG 241
           Y  A+ +  + + G+D HIGSQI ++  +  A   L +L  Q+ ++G  I+H+DVGGGLG
Sbjct: 184 YRAAAAMKHLDVVGIDCHIGSQITEVAPYLDAVDKLLELVAQIEADGVTIKHVDVGGGLG 243

Query: 242 IAYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           I Y  D  PP   D+   +       G+   ++  EPGR LV + G+L+T+V  +K  A+
Sbjct: 244 ITY-DDETPPDIGDFVRTLLDRIEARGHGHREVYFEPGRSLVGNAGMLLTRVEFLKTGAE 302

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND  RP +Y+AYH I  +V   G R H++ DIVGP+CE+GD++   R++A
Sbjct: 303 KNFAIVDAAMNDLARPAMYEAYHAIEPVVQRDGAR-HVY-DIVGPVCESGDWLGRERRLA 360

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +  PGDLL I   GAYG   S  YN+R    E+MV+G + +++R R   ++L   +S+
Sbjct: 361 V-EPGDLLAIRSAGAYGFAMSSNYNTRARAAEVMVDGDKAYVVRKREEVKDLFAGESV 417


>gi|238025969|ref|YP_002910200.1| Diaminopimelate decarboxylase [Burkholderia glumae BGR1]
 gi|237875163|gb|ACR27496.1| Diaminopimelate decarboxylase [Burkholderia glumae BGR1]
          Length = 423

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 179/420 (42%), Positives = 252/420 (60%), Gaps = 12/420 (2%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           AF Y +G+LHAE +  +KLA    TP Y YS  A+   Y  ++ A +G    +  A+KAN
Sbjct: 5   AFDYVDGTLHAEGIPADKLADHFDTPLYVYSRAALTAAYQAYAKACEGRRASLHVAVKAN 64

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN  V+   A LG+G DIVS GEL R LAA   AE +VFSGV K+ DE+ LAL++G+ CF
Sbjct: 65  SNLGVLNVFARLGAGFDIVSGGELARVLAAGGKAEHVVFSGVAKSADEMRLALEAGVKCF 124

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES  EL  LN  A SLGK+AP++ RVNPD++  TH  ISTG K +KFG+      + Y
Sbjct: 125 NVESVPELDRLNAVAGSLGKRAPVSLRVNPDVDPKTHPYISTGLKANKFGVAFADARATY 184

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
             A  LP ++++G+D HIGSQI ++  +  A   + DL +Q+ ++G  I H+DVGGGLGI
Sbjct: 185 RAADALPNLQVAGIDCHIGSQITELSPYLDALDKVLDLVEQIEADGIAIHHVDVGGGLGI 244

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCK------IILEPGRFLVADVGILVTKVISIKKS 296
            Y +D  PP   D  + +   F  L  +      +  EPGR L  + GIL+T+V  +K  
Sbjct: 245 TY-ADETPP---DIGAFVQALFAKLDARGHGHRELCFEPGRSLTGNAGILLTRVEFLKPG 300

Query: 297 ADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRK 356
            +K F I+D  MND  RP +Y+AYH I  +   +     ++ D+VGP+CE+GD++   R 
Sbjct: 301 EEKNFAIVDAGMNDLARPAMYEAYHAIVPVRQTSAHASAVY-DVVGPVCESGDWLGRERT 359

Query: 357 IALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +A+   GDLL I   GAYG   S  YN+R    E++V+G   +++R R T   L E ++I
Sbjct: 360 LAIA-AGDLLAIRSAGAYGFAMSSNYNTRPRAAEVLVDGQNAYLVRQRETIASLYENEAI 418


>gi|152997590|ref|YP_001342425.1| diaminopimelate decarboxylase [Marinomonas sp. MWYL1]
 gi|150838514|gb|ABR72490.1| diaminopimelate decarboxylase [Marinomonas sp. MWYL1]
          Length = 417

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 182/411 (44%), Positives = 259/411 (63%), Gaps = 8/411 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y   +LHAE+V+L  +A+   TP Y YS   +E++Y  +++AF    T++CYA+K
Sbjct: 1   MDFFNYSNQTLHAEDVALSDVANQYGTPCYVYSRATLERHYKAYADAFASHPTLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SN A++  LA LGSG DIVS GEL R L A     +++FSG+GK  +E+  AL+ GI+
Sbjct: 61  ACSNIAILNVLARLGSGFDIVSVGELERVLKAGGEPSKVMFSGLGKQAEEMRRALEVGIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE+EL  L++ A  +GK AP++ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNVESEAELYRLDKVAGEMGKLAPVSLRVNPDVDAKTHPYISTGLKENKFGIDIKDAVR 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A  LP + + GVD HIGSQ+ +++ F   F  L  L  +L   G  I+H+D+GGGL
Sbjct: 181 IYKIAHELPNLNVMGVDCHIGSQLTELKPFLDTFDRLIGLVDELAEVGITIKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP  +DYA L+ +       ++  EPGR + A+ GIL+T+V  +K +  K 
Sbjct: 241 GVRYR-DEVPPEPADYAKLLLEKVKGRNFELAFEPGRSIAANAGILLTQVEFLKCNPHKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEI---NYIVNPAGDRLHIHADIVGPICETGDFIALNRKI 357
           F I+D AMND +RP+LY A+  I   + +    G R   + D+VGPICETGDF+  +R++
Sbjct: 300 FAIIDGAMNDLIRPSLYGAWMNIVPVSLLPTAEGKR---NYDLVGPICETGDFLGKDREL 356

Query: 358 ALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQ 408
            + + GDLL +   GAYG   S  YNSR    E+MV+G + ++IR R T +
Sbjct: 357 DI-QAGDLLAVRSAGAYGFTMSSNYNSRNRAAEVMVDGDKTYLIRARETIE 406


>gi|15640156|ref|NP_229783.1| diaminopimelate decarboxylase [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121587729|ref|ZP_01677490.1| diaminopimelate decarboxylase [Vibrio cholerae 2740-80]
 gi|121728316|ref|ZP_01681347.1| diaminopimelate decarboxylase [Vibrio cholerae V52]
 gi|147674363|ref|YP_001218294.1| diaminopimelate decarboxylase [Vibrio cholerae O395]
 gi|153214838|ref|ZP_01949646.1| diaminopimelate decarboxylase [Vibrio cholerae 1587]
 gi|153803072|ref|ZP_01957658.1| diaminopimelate decarboxylase [Vibrio cholerae MZO-3]
 gi|153818954|ref|ZP_01971621.1| diaminopimelate decarboxylase [Vibrio cholerae NCTC 8457]
 gi|153822335|ref|ZP_01975002.1| diaminopimelate decarboxylase [Vibrio cholerae B33]
 gi|153826290|ref|ZP_01978957.1| diaminopimelate decarboxylase [Vibrio cholerae MZO-2]
 gi|153830026|ref|ZP_01982693.1| diaminopimelate decarboxylase [Vibrio cholerae 623-39]
 gi|227080361|ref|YP_002808912.1| diaminopimelate decarboxylase [Vibrio cholerae M66-2]
 gi|229508403|ref|ZP_04397907.1| diaminopimelate decarboxylase [Vibrio cholerae BX 330286]
 gi|229508916|ref|ZP_04398406.1| diaminopimelate decarboxylase [Vibrio cholerae B33]
 gi|229515840|ref|ZP_04405298.1| diaminopimelate decarboxylase [Vibrio cholerae TMA 21]
 gi|229517030|ref|ZP_04406476.1| diaminopimelate decarboxylase [Vibrio cholerae RC9]
 gi|229520083|ref|ZP_04409511.1| diaminopimelate decarboxylase [Vibrio cholerae TM 11079-80]
 gi|229525021|ref|ZP_04414426.1| diaminopimelate decarboxylase [Vibrio cholerae bv. albensis VL426]
 gi|229527133|ref|ZP_04416527.1| diaminopimelate decarboxylase [Vibrio cholerae 12129(1)]
 gi|229606676|ref|YP_002877324.1| diaminopimelate decarboxylase [Vibrio cholerae MJ-1236]
 gi|254291934|ref|ZP_04962715.1| diaminopimelate decarboxylase [Vibrio cholerae AM-19226]
 gi|254851509|ref|ZP_05240859.1| diaminopimelate decarboxylase [Vibrio cholerae MO10]
 gi|255743922|ref|ZP_05417877.1| diaminopimelate decarboxylase [Vibrio cholera CIRS 101]
 gi|262151161|ref|ZP_06028300.1| diaminopimelate decarboxylase [Vibrio cholerae INDRE 91/1]
 gi|262167030|ref|ZP_06034747.1| diaminopimelate decarboxylase [Vibrio cholerae RC27]
 gi|297581834|ref|ZP_06943755.1| diaminopimelate decarboxylase [Vibrio cholerae RC385]
 gi|298501107|ref|ZP_07010907.1| diaminopimelate decarboxylase [Vibrio cholerae MAK 757]
 gi|13124077|sp|Q9KVL7|DCDA_VIBCH RecName: Full=Diaminopimelate decarboxylase; Short=DAP
           decarboxylase
 gi|9654525|gb|AAF93302.1| diaminopimelate decarboxylase [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121548028|gb|EAX58106.1| diaminopimelate decarboxylase [Vibrio cholerae 2740-80]
 gi|121629446|gb|EAX61875.1| diaminopimelate decarboxylase [Vibrio cholerae V52]
 gi|124115081|gb|EAY33901.1| diaminopimelate decarboxylase [Vibrio cholerae 1587]
 gi|124121391|gb|EAY40134.1| diaminopimelate decarboxylase [Vibrio cholerae MZO-3]
 gi|126510516|gb|EAZ73110.1| diaminopimelate decarboxylase [Vibrio cholerae NCTC 8457]
 gi|126520161|gb|EAZ77384.1| diaminopimelate decarboxylase [Vibrio cholerae B33]
 gi|146316246|gb|ABQ20785.1| diaminopimelate decarboxylase [Vibrio cholerae O395]
 gi|148874511|gb|EDL72646.1| diaminopimelate decarboxylase [Vibrio cholerae 623-39]
 gi|149739958|gb|EDM54137.1| diaminopimelate decarboxylase [Vibrio cholerae MZO-2]
 gi|150422144|gb|EDN14110.1| diaminopimelate decarboxylase [Vibrio cholerae AM-19226]
 gi|227008249|gb|ACP04461.1| diaminopimelate decarboxylase [Vibrio cholerae M66-2]
 gi|227011873|gb|ACP08083.1| diaminopimelate decarboxylase [Vibrio cholerae O395]
 gi|229335364|gb|EEO00847.1| diaminopimelate decarboxylase [Vibrio cholerae 12129(1)]
 gi|229338602|gb|EEO03619.1| diaminopimelate decarboxylase [Vibrio cholerae bv. albensis VL426]
 gi|229342871|gb|EEO07861.1| diaminopimelate decarboxylase [Vibrio cholerae TM 11079-80]
 gi|229346093|gb|EEO11065.1| diaminopimelate decarboxylase [Vibrio cholerae RC9]
 gi|229347103|gb|EEO12064.1| diaminopimelate decarboxylase [Vibrio cholerae TMA 21]
 gi|229354033|gb|EEO18966.1| diaminopimelate decarboxylase [Vibrio cholerae B33]
 gi|229354676|gb|EEO19598.1| diaminopimelate decarboxylase [Vibrio cholerae BX 330286]
 gi|229369331|gb|ACQ59754.1| diaminopimelate decarboxylase [Vibrio cholerae MJ-1236]
 gi|254847214|gb|EET25628.1| diaminopimelate decarboxylase [Vibrio cholerae MO10]
 gi|255738405|gb|EET93795.1| diaminopimelate decarboxylase [Vibrio cholera CIRS 101]
 gi|262024548|gb|EEY43232.1| diaminopimelate decarboxylase [Vibrio cholerae RC27]
 gi|262031055|gb|EEY49680.1| diaminopimelate decarboxylase [Vibrio cholerae INDRE 91/1]
 gi|297533928|gb|EFH72768.1| diaminopimelate decarboxylase [Vibrio cholerae RC385]
 gi|297540141|gb|EFH76202.1| diaminopimelate decarboxylase [Vibrio cholerae MAK 757]
          Length = 417

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 186/418 (44%), Positives = 259/418 (61%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y E G L AE V L  LA+   TP Y YS   +E+++  F  +      ++CYA+
Sbjct: 1   MDYFNYQEDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGDYPHLICYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA LGSG DIVS GEL R LAA     ++VFSGVGKT  E+  ALQ  I
Sbjct: 61  KANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG KAPI+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELQRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDRAA 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y  A +LP + + G+D HIGSQ+  +  F  A   L  L   L++ G +I+H+DVGGG
Sbjct: 181 QVYRLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  S+YA +L+ +   +   ++I EPGR + A+ G+LVTKV  +K +  
Sbjct: 241 LGVVYR-DELPPQPSEYAKALLDRLERHRDLELIFEPGRAIAANAGVLVTKVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND +RP LY A+ +I   + P       + D+VGP+CET DF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLIRPALYQAWQDI-IPLRPRQGEAQTY-DLVGPVCETSDFLGKDRDLV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L + GDLL +  +GAYG   S  YN+R  + E+MV+G++ +++R R     L  L+S+
Sbjct: 358 L-QEGDLLAVRSSGAYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREELSSLWALESV 414


>gi|258625070|ref|ZP_05719989.1| diaminopimelate decarboxylase [Vibrio mimicus VM603]
 gi|258582621|gb|EEW07451.1| diaminopimelate decarboxylase [Vibrio mimicus VM603]
          Length = 449

 Score =  347 bits (889), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 187/420 (44%), Positives = 257/420 (61%), Gaps = 9/420 (2%)

Query: 2   SAFKYF----EGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCY 57
           S   YF    +G L AE V L  LA+   TP Y YS   +E+++  F  +      ++CY
Sbjct: 21  SILDYFNYQDDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGDYPHLICY 80

Query: 58  ALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQS 117
           A+KANSN  V+ TLA LGSG DIVS GEL R LAA     ++VFSGVGKT  E+  ALQ 
Sbjct: 81  AVKANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQL 140

Query: 118 GIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQ 177
            I CFNVESE EL  LN+ A  LG KAPI+ R+NPD++A TH  ISTG +++KFGI   +
Sbjct: 141 KIKCFNVESERELHRLNKVAAELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDR 200

Query: 178 IHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVG 237
              +Y  A +L  + + G+D HIGSQ+  +  F  A   L  L   L++ G +I+H+DVG
Sbjct: 201 AAEVYRLAHSLSNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVG 260

Query: 238 GGLGIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKS 296
           GGLG+ Y  D  PP  S+YA +L+ +   +   ++I EPGR + A+ G+LVTKV  +K +
Sbjct: 261 GGLGVVYR-DELPPQPSEYAKALLDRLERHRDLELIFEPGRAIAANAGVLVTKVEFLKHT 319

Query: 297 ADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRK 356
             K F I+D AMND +RP LY A+ +I   + P       + D+VGP+CET DF+  +R 
Sbjct: 320 EHKNFAIIDAAMNDLIRPALYQAWQDI-IPLRPRQGEAQTY-DLVGPVCETSDFLGKDRD 377

Query: 357 IALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           + L   GDLL +  +GAYG   S  YNSR  + E+MV+G++ H++R R T   L  L+S+
Sbjct: 378 LVL-EEGDLLAVRSSGAYGFTMSSNYNSRPRVAEVMVDGNKAHLVRQRETLSSLWALESV 436


>gi|325982948|ref|YP_004295350.1| diaminopimelate decarboxylase [Nitrosomonas sp. AL212]
 gi|325532467|gb|ADZ27188.1| diaminopimelate decarboxylase [Nitrosomonas sp. AL212]
          Length = 417

 Score =  347 bits (889), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 185/409 (45%), Positives = 256/409 (62%), Gaps = 4/409 (0%)

Query: 2   SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKA 61
           + F Y +  L  E+V L+++A    TP Y YS +A+ K Y  F  AF   D ++C+A+KA
Sbjct: 5   AEFIYHDDELFVESVPLKQIAEKFGTPCYVYSRSALTKAYQAFDTAFANRDHLICFAVKA 64

Query: 62  NSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYC 121
           NSN A++   A LGSG DIVS GEL+R + A     + VFSGVGK+  E+ +AL+  I C
Sbjct: 65  NSNIAILNLFAQLGSGFDIVSGGELQRVIKAGGDPGKTVFSGVGKSRYEMRMALEVNILC 124

Query: 122 FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSL 181
           FNVESE+EL  LN+ A  + K AP++ R+NPD++A TH  ISTG KE+KFGIP  +   +
Sbjct: 125 FNVESEAELIALNRIAKDMDKLAPVSLRINPDVDAKTHPYISTGLKENKFGIPAREAERI 184

Query: 182 YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG 241
           Y  A   P ++  G+D HIGSQ+ ++E F +A K +  L   L++    I+H+D+GGGLG
Sbjct: 185 YKSAHLYPNIRFIGLDCHIGSQLTELEPFMQASKKMLHLLDSLQAQNLEIEHLDLGGGLG 244

Query: 242 IAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTF 301
           I Y +D   PS SDY S +      ++ ++++EPGR LV + GIL+T++  +K +  + F
Sbjct: 245 IRY-NDEILPSISDYVSALCINTHQIKQRLLIEPGRSLVGNAGILLTRIEYLKHTPARNF 303

Query: 302 VILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPR 361
            I+D AMND MRP LYDAYHEI  +   +G+       IVGP+CETGDF+  +R+I L  
Sbjct: 304 AIVDAAMNDLMRPALYDAYHEILPVHKNSGEIKDYQ--IVGPVCETGDFLGHDRRIGLI- 360

Query: 362 PGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
            G+LL I   GAYG   S  YNSR    EIMV+    HIIR R T  +L
Sbjct: 361 DGNLLAIMSAGAYGMSMSSNYNSRPRAAEIMVDKDTTHIIRQRETIDQL 409


>gi|297787806|pdb|3N2B|A Chain A, 1.8 Angstrom Resolution Crystal Structure Of
           Diaminopimelate Decarboxylase (Lysa) From Vibrio
           Cholerae.
 gi|297787807|pdb|3N2B|B Chain B, 1.8 Angstrom Resolution Crystal Structure Of
           Diaminopimelate Decarboxylase (Lysa) From Vibrio
           Cholerae.
 gi|297787808|pdb|3N2B|C Chain C, 1.8 Angstrom Resolution Crystal Structure Of
           Diaminopimelate Decarboxylase (Lysa) From Vibrio
           Cholerae.
 gi|297787809|pdb|3N2B|D Chain D, 1.8 Angstrom Resolution Crystal Structure Of
           Diaminopimelate Decarboxylase (Lysa) From Vibrio
           Cholerae
          Length = 441

 Score =  347 bits (889), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 186/418 (44%), Positives = 259/418 (61%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y E G L AE V L  LA+   TP Y YS   +E+++  F  +      ++CYA+
Sbjct: 25  MDYFNYQEDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGDYPHLICYAV 84

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA LGSG DIVS GEL R LAA     ++VFSGVGKT  E+  ALQ  I
Sbjct: 85  KANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKI 144

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG KAPI+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 145 KCFNVESEPELQRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDRAA 204

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y  A +LP + + G+D HIGSQ+  +  F  A   L  L   L++ G +I+H+DVGGG
Sbjct: 205 QVYRLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVGGG 264

Query: 240 LGIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  S+YA +L+ +   +   ++I EPGR + A+ G+LVTKV  +K +  
Sbjct: 265 LGVVYR-DELPPQPSEYAKALLDRLERHRDLELIFEPGRAIAANAGVLVTKVEFLKHTEH 323

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND +RP LY A+ +I   + P       + D+VGP+CET DF+  +R + 
Sbjct: 324 KNFAIIDAAMNDLIRPALYQAWQDI-IPLRPRQGEAQTY-DLVGPVCETSDFLGKDRDLV 381

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L + GDLL +  +GAYG   S  YN+R  + E+MV+G++ +++R R     L  L+S+
Sbjct: 382 L-QEGDLLAVRSSGAYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREELSSLWALESV 438


>gi|225871912|ref|YP_002753366.1| diaminopimelate decarboxylase [Acidobacterium capsulatum ATCC
           51196]
 gi|225794282|gb|ACO34372.1| diaminopimelate decarboxylase [Acidobacterium capsulatum ATCC
           51196]
          Length = 436

 Score =  346 bits (888), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 190/413 (46%), Positives = 255/413 (61%), Gaps = 11/413 (2%)

Query: 8   EGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAV 67
             +LH E VSLE LA    TP Y YS   I + +  F+ AF  +  ++C+A+KANS  A+
Sbjct: 21  RAALHVEGVSLEALARRHGTPLYVYSADHIAQRFDLFARAFAPVSHLICFAVKANSALAI 80

Query: 68  IKTLAHLGSGLDIVSEGELRRALAA-PVPAERIVFSGVGKTIDEIDLALQSGIYCFNVES 126
           ++ L   G+G DIVS GEL R LA     AER+VFSGVGKT  E+DLAL+SGI  F+VES
Sbjct: 81  LQLLEKRGAGFDIVSGGELERVLAVNKKAAERVVFSGVGKTAPEMDLALRSGILLFHVES 140

Query: 127 ESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYAS 186
           E EL+ L +RA  L K+A ++ RVNPD+ A TH  ISTG +E KFGI + +   +Y   +
Sbjct: 141 EGELELLAERASKLRKRAAVSLRVNPDVFAETHPYISTGLREHKFGIEMARARKVYRAVA 200

Query: 187 TLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHS 246
               ++  GV +HIGSQI   E F  A + +  L  QLR +GH I+ +D GGGLGI Y +
Sbjct: 201 RHKYLEARGVSVHIGSQIRMAEPFGAAAERVAALIGQLRKDGHGIRFLDAGGGLGIEYQA 260

Query: 247 DHRPPSSSDYASLIHQYFGNL--------QCKIILEPGRFLVADVGILVTKVISIKKSAD 298
                +S D A  + QY   L        +  ++LEPGRFLVA  G LVT+V+  K++  
Sbjct: 261 GLE-DASFDPAERVQQYAAALLHAVATVPEITLLLEPGRFLVAQAGALVTRVLYRKQNGA 319

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K FVI+D AMND +RP LY A+HE+  ++   G R  + ADIVGP+CETGDF A +R +A
Sbjct: 320 KHFVIVDAAMNDLIRPALYQAHHEVVPVLPRRGARSMV-ADIVGPVCETGDFFARDRAMA 378

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELI 411
             R G+LL I   GAYG   S  YNSR+   E++V+G +  +IR R T  +L+
Sbjct: 379 AVREGELLAILDAGAYGMSLSSNYNSRVRPAEVLVSGKRARLIRRRETINDLL 431


>gi|258622843|ref|ZP_05717860.1| diaminopimelate decarboxylase [Vibrio mimicus VM573]
 gi|258584904|gb|EEW09636.1| diaminopimelate decarboxylase [Vibrio mimicus VM573]
          Length = 439

 Score =  346 bits (888), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 187/420 (44%), Positives = 257/420 (61%), Gaps = 9/420 (2%)

Query: 2   SAFKYF----EGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCY 57
           S   YF    +G L AE V L  LA+   TP Y YS   +E+++  F  +      ++CY
Sbjct: 21  SILDYFNYQDDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGDYPHLICY 80

Query: 58  ALKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQS 117
           A+KANSN  V+ TLA LGSG DIVS GEL R LAA     ++VFSGVGKT  E+  ALQ 
Sbjct: 81  AVKANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQL 140

Query: 118 GIYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQ 177
            I CFNVESE EL  LN+ A  LG KAPI+ R+NPD++A TH  ISTG +++KFGI   +
Sbjct: 141 KIKCFNVESERELHRLNKVAAELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDR 200

Query: 178 IHSLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVG 237
              +Y  A +L  + + G+D HIGSQ+  +  F  A   L  L   L++ G +I+H+DVG
Sbjct: 201 AAEVYRLAHSLSHLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVG 260

Query: 238 GGLGIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKS 296
           GGLG+ Y  D  PP  S+YA +L+ +   +   ++I EPGR + A+ G+LVTKV  +K +
Sbjct: 261 GGLGVVYR-DELPPQPSEYAKALLDRLERHRDLELIFEPGRAIAANAGVLVTKVEFLKHT 319

Query: 297 ADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRK 356
             K F I+D AMND +RP LY A+ +I  +    G+      D+VGP+CET DF+  +R 
Sbjct: 320 EHKNFAIIDAAMNDLIRPALYQAWQDIIPLRPRQGEAQTY--DLVGPVCETSDFLGKDRD 377

Query: 357 IALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           + L   GDLL +  +GAYG   S  YNSR  + E+MV+G++ H++R R T   L  L+S+
Sbjct: 378 LVL-EEGDLLAVRSSGAYGFTMSSNYNSRPRVAEVMVDGNKAHLVRQRETLSSLWALESV 436


>gi|307546848|ref|YP_003899327.1| diaminopimelate decarboxylase [Halomonas elongata DSM 2581]
 gi|307218872|emb|CBV44142.1| diaminopimelate decarboxylase [Halomonas elongata DSM 2581]
          Length = 429

 Score =  346 bits (888), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 177/414 (42%), Positives = 257/414 (62%), Gaps = 7/414 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LH E+V L  +A    TP Y YS   + +++  ++ A  G   ++CYA+K
Sbjct: 1   MDHFDYRDGVLHGEDVDLTSVAEAFGTPCYVYSKATLARHFRAYTEALGGHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           AN+N AV+  LA LG+G DIVS GEL R L A     ++VFSGV K  +E+  AL+ GI 
Sbjct: 61  ANANLAVLGLLARLGAGFDIVSVGELERVLVAGGDPAKVVFSGVAKQENEMARALEVGIK 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ L+  A  LGK A ++ RVNPD++A TH  ISTG K++KFGIP+ +   
Sbjct: 121 CFNVESRAELERLDAVARGLGKVASVSLRVNPDVDAGTHPYISTGLKDNKFGIPVDEAFE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ +  V+++G+D HIGSQ+ ++  F  A   L  L +QLR  G  ++H+D+GGGL
Sbjct: 181 VYRQAAGMDNVRVAGLDCHIGSQLTELSPFLDALDRLLALLEQLRDAGIEVEHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYAS----LIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKS 296
           G+ Y  D  PP   DYA+     + ++ G+ +  ++ EPGR + A+ G+L+T+V  +K  
Sbjct: 241 GVPYQ-DENPPQPFDYATSLLERLSRWPGSERLTLLFEPGRSIAANAGVLLTRVEFLKPG 299

Query: 297 ADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRK 356
             K F I+D AMND +RP LY A+  I   V+    R     D+VGP+CETGDF+   R+
Sbjct: 300 ETKNFAIVDAAMNDLIRPALYQAWQAI-LPVDTRQPRETDTYDVVGPVCETGDFLGKQRR 358

Query: 357 IALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
           +A+   GDLL +   GAYG V +  YNSR   PE+MV+G + H++R R   ++L
Sbjct: 359 LAIA-AGDLLAVRSAGAYGFVMASNYNSRPRPPEVMVDGDRMHLVRRRERLEDL 411


>gi|88705498|ref|ZP_01103208.1| Diaminopimelate decarboxylase [Congregibacter litoralis KT71]
 gi|88700011|gb|EAQ97120.1| Diaminopimelate decarboxylase [Congregibacter litoralis KT71]
          Length = 414

 Score =  346 bits (888), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 176/409 (43%), Positives = 256/409 (62%), Gaps = 4/409 (0%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
            F Y EG L AE +  E LA    TP Y YS  A+E     + +A  G + +VCYA+KAN
Sbjct: 2   GFSYREGRLFAEELDCETLAEEYGTPCYLYSRAAMEAALAEYHDALSGCEHLVCYAVKAN 61

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+ TLA  G+G DIVS GEL R LAA     ++VFSGV K  +E+  AL+ GI CF
Sbjct: 62  SNLAVLDTLARQGAGFDIVSVGELERVLAAGGDPGKVVFSGVVKRREEMHRALELGIRCF 121

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVESE+EL+ L + A +LGK+AP++ RVNPD++A TH  ISTG +E+KFG+       L 
Sbjct: 122 NVESEAELEVLQEVAAALGKRAPVSVRVNPDVDAGTHPYISTGLRENKFGVATDVAMKLL 181

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
            +  TLP + + G+D HIGSQ+  +    ++ + L  +   L + G  I H+D+GGG+G+
Sbjct: 182 RHGKTLPNIDVIGLDCHIGSQLTDMAPLLESLRQLLVMVDTLEAEGIRIHHLDLGGGIGV 241

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y  D  PP+ +DY + + +  G+ +  ++ EPGR +VA+ G+L+T+V   K++   +F 
Sbjct: 242 RY-KDEEPPAIADYIAAVRKALGDRKLCLVFEPGRSIVANAGVLLTRVHYTKETDAHSFA 300

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           ++D AMNDF+RP LY A+ +I     P+ + +    +IVGP+CETGDF+  +R +AL  P
Sbjct: 301 LVDAAMNDFIRPALYQAWVDIQ-TTAPSEEPIRTW-NIVGPVCETGDFLGKDRDLALA-P 357

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELI 411
           G LL I   GAYG V S  YN+R    E+M++GS   ++R R +  +L+
Sbjct: 358 GTLLAIHGAGAYGFVMSSNYNTRPRAAEVMIDGSSSQLVRERESIGDLL 406


>gi|149908508|ref|ZP_01897170.1| diaminopimelate decarboxylase [Moritella sp. PE36]
 gi|149808342|gb|EDM68279.1| diaminopimelate decarboxylase [Moritella sp. PE36]
          Length = 418

 Score =  346 bits (887), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 189/417 (45%), Positives = 261/417 (62%), Gaps = 4/417 (0%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE  ++  +A    TP Y YS   IE+++  F++A      +VCYA+
Sbjct: 1   MDYFNYQDDGQLFAEQCAVADVADKFGTPTYVYSRATIERHWHAFNDAAGAHPHLVCYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN AV+  LA LGSG DIVS GEL R +AA     +IVFSGVGKT+ EI+LAL   I
Sbjct: 61  KANSNIAVLNVLARLGSGFDIVSGGELLRVIAAGGDPSKIVFSGVGKTVAEINLALDHNI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
           +CFNVES  EL+ +N  A+S G +API+ RVNP+I+A TH  ISTG KE+KFGI I    
Sbjct: 121 HCFNVESTPELERINDIALSRGVQAPISIRVNPNIDAGTHPYISTGLKENKFGIDIDLAE 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y  AS +PG+K+ GVD HIGSQ+ ++  F  A   L  L  +L + G  ++H+DVGGG
Sbjct: 181 GVYQVASKMPGIKLKGVDCHIGSQLTELSPFLDAVDKLLLLIDKLSAQGIVLEHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           LG+ Y+ +  PP  ++YA  +       +  +I EPGR ++A+ GILV+KV  IK +  K
Sbjct: 241 LGVPYNGE-TPPQPAEYAQALKAKLAGRKLALIFEPGRAIMANAGILVSKVEYIKLTEHK 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I+D AMND +RP LY A+  I   VN + +R  ++ D+VGPICETGDF+  NR + +
Sbjct: 300 NFAIVDAAMNDLIRPALYSAWQAI-APVNKSLERECLNYDVVGPICETGDFLGKNRDLTI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
               D + +   GAYG+  S  YNSR    E+MV+G   H++R R    E+ + ++I
Sbjct: 359 AM-DDYIVVRSAGAYGSTMSSNYNSRSRPAEVMVDGDVAHLVRRREGLAEIWKDEAI 414


>gi|119899943|ref|YP_935156.1| LysA2 protein [Azoarcus sp. BH72]
 gi|119672356|emb|CAL96270.1| LysA2 protein [Azoarcus sp. BH72]
          Length = 424

 Score =  345 bits (886), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 185/400 (46%), Positives = 247/400 (61%), Gaps = 4/400 (1%)

Query: 11  LHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKT 70
           L  E V L  LA    TP Y YS  A+   +  +  A  G  ++VCYA+KAN+N  V+  
Sbjct: 21  LMLEEVPLATLAERFGTPTYVYSRAALTAAFRDWQAALAGRRSLVCYAVKANANLGVLSV 80

Query: 71  LAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESEL 130
            A LG+G DIVS GEL R +AA   A+R+VFSGVGK+  E+  AL +GI CFNVES  EL
Sbjct: 81  FAQLGAGFDIVSGGELARVIAAGGRADRVVFSGVGKSRAEMRQALAAGIRCFNVESAPEL 140

Query: 131 KTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPG 190
           + LN+ A  LG++APIA RVNPD++  TH  ISTG K +KFG+   +   LY  A+TLP 
Sbjct: 141 ERLNEVAGELGQRAPIALRVNPDVDPKTHPYISTGLKSNKFGVAFGEALELYRRAATLPH 200

Query: 191 VKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRP 250
           ++ISG+  HIGSQ+       +A   +  L  QL + G  + HID+GGGLGI Y  D  P
Sbjct: 201 LRISGIACHIGSQLLDPAPVAEAAAKVLGLVDQLSAEGIVLDHIDLGGGLGIRYR-DETP 259

Query: 251 PSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMND 310
           PS + Y + +   FG+ + +I  EPGR LV + G+L+T+V  +K   +K F I+D AMND
Sbjct: 260 PSVAAYLAPLLAAFGDRREEICFEPGRSLVGNAGLLLTRVEYLKHGEEKNFAIVDAAMND 319

Query: 311 FMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEK 370
             RP LYDAYHE   +      R     +IVGPICE+GDF+A +R++AL R GDL+ +  
Sbjct: 320 LARPALYDAYHEAVAVCRSDAPRQRY--EIVGPICESGDFLAHDRELAL-RDGDLVALLS 376

Query: 371 TGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
            GAYG   S  YN+R    E+MV+G Q H++R R T + L
Sbjct: 377 AGAYGMTMSSNYNTRPRAAEVMVDGGQVHLVRERETVEAL 416


>gi|254226601|ref|ZP_04920182.1| diaminopimelate decarboxylase [Vibrio cholerae V51]
 gi|125620873|gb|EAZ49226.1| diaminopimelate decarboxylase [Vibrio cholerae V51]
          Length = 417

 Score =  345 bits (886), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 185/418 (44%), Positives = 259/418 (61%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y E G L AE V L  LA+   TP Y YS   +E+++  F  +      ++CYA+
Sbjct: 1   MDYFNYQEDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGEYPHLICYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA LGSG DIVS GEL R LAA     ++VFSGVGKT  E+  ALQ  I
Sbjct: 61  KANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL+ LN+ A  LG KAPI+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELQRLNKVAGELGVKAPISLRINPDVDAQTHPYISTGLRDNKFGITFDRAA 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y  A +LP + + G+D HIGSQ+  +  F  A   L  L   L++ G +I+H+DVGGG
Sbjct: 181 QVYRLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  S+YA +L+ +   +   ++I EPGR + A+ G+L+TKV  +K +  
Sbjct: 241 LGVVYR-DELPPQPSEYAKALLDRLERHRDLELIFEPGRAIAANAGVLLTKVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND +RP LY A+ +I   + P       + D+VGP+CET DF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLIRPALYQAWQDI-IPLRPRQGEAQTY-DLVGPVCETSDFLGKDRDLV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L + GDLL +  +GAYG   S  YN+R  + E+MV+G++ +++R R     L  L+S+
Sbjct: 358 L-QEGDLLAVRSSGAYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREELSSLWALESV 414


>gi|78486188|ref|YP_392113.1| diaminopimelate decarboxylase [Thiomicrospira crunogena XCL-2]
 gi|78364474|gb|ABB42439.1| diaminopimelate decarboxylase [Thiomicrospira crunogena XCL-2]
          Length = 418

 Score =  345 bits (886), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 183/408 (44%), Positives = 245/408 (60%), Gaps = 3/408 (0%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
           F Y    LHAE   L+ LA    TP Y YS  A E  +  F  AF     +VCYA+K NS
Sbjct: 7   FHYQNNILHAEGCPLDTLAQKYGTPLYVYSRQAFEDRWREFDQAFGRQPHLVCYAVKTNS 66

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFN 123
           N A++  LA LGSG DIVS+GEL R L A     ++VFSGV K   EI+ AL  GI CFN
Sbjct: 67  NIAILNLLARLGSGFDIVSQGELERVLRAGGDPSKVVFSGVAKKSSEIERALTVGIRCFN 126

Query: 124 VESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA 183
           VES +EL  +   A  L K API+ RVNPD++A TH  ISTG K++KFG+ I+   +LYA
Sbjct: 127 VESHAELDRIQAVAKKLNKIAPISIRVNPDVDAKTHPYISTGLKDNKFGVDINTAPALYA 186

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIA 243
            A  L  + I G+D HIGSQ+ +I  F  A   + +L + L   G NI H+D+GGGLGI 
Sbjct: 187 DAQALSHIDIIGIDCHIGSQLTEITPFVDALDRVLELKKTLTDQGINIHHLDLGGGLGIQ 246

Query: 244 YHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVI 303
           Y +D  PP  +DY   + +   +   ++I+EPGR +  + G+LVT+V  +K +  K F I
Sbjct: 247 Y-TDETPPEIADYIQALMKKLDDPSIEVIIEPGRAIAGNAGVLVTEVEYLKPTEHKNFAI 305

Query: 304 LDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPG 363
           +D AMND +RP LY ++  I   V P  D   +  D+VGP+CETGDF+   RK+ L + G
Sbjct: 306 IDAAMNDLIRPALYQSHQTIQ-PVTPRTDGEDVEWDLVGPVCETGDFLGKQRKLNL-KAG 363

Query: 364 DLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELI 411
           D L +  +GAYG   S  YN+R    EI+V+  Q + IRPR T+ +L+
Sbjct: 364 DYLAVMSSGAYGFTMSSNYNTRTRAAEILVDHKQAYEIRPRETYNDLM 411


>gi|332524336|ref|ZP_08400557.1| diaminopimelate decarboxylase [Rubrivivax benzoatilyticus JA2]
 gi|332107666|gb|EGJ08890.1| diaminopimelate decarboxylase [Rubrivivax benzoatilyticus JA2]
          Length = 424

 Score =  345 bits (886), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 174/414 (42%), Positives = 256/414 (61%), Gaps = 6/414 (1%)

Query: 8   EGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAV 67
           +G L  E  SL  LA    TP Y YS TA+      +  A +G+  ++CYA+KANSN AV
Sbjct: 14  DGELRLEGHSLADLARRHGTPLYVYSRTAMLDALAGYQRALEGLPHLICYAIKANSNLAV 73

Query: 68  IKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESE 127
           ++T A  G G DIVS GEL R LAA     +IVFSGVGKT  E+  AL+ G++CFNVES 
Sbjct: 74  LQTFARAGCGFDIVSGGELERVLAAGAEPSKIVFSGVGKTAAEMRRALEVGVHCFNVESL 133

Query: 128 SELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYAST 187
            EL+ L + A ++G++AP++ RVNPD++A TH  ISTG K++KFGIP  +  ++Y  A+ 
Sbjct: 134 GELERLAEVAAAMGRRAPVSLRVNPDVDAGTHPYISTGLKDNKFGIPHDEALAVYRRAAA 193

Query: 188 LPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSD 247
           LP +++ G+D HIGSQI Q+E +  A   + DL + + + G  + H+DVGGGLGI Y +D
Sbjct: 194 LPSLQVVGIDCHIGSQITQLEPYLDALGRVLDLVEAVEAEGIALAHVDVGGGLGITY-TD 252

Query: 248 HRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVIL 304
             PPS       +       G+   ++++EPGR LV + G+L+ +V  +K    K F I+
Sbjct: 253 EAPPSPETLVRGLADLMRARGHGHRQLLVEPGRSLVGNAGVLLAEVQYLKPGETKNFCIV 312

Query: 305 DVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGD 364
           D AMND +RP +Y+A+  I     P  D +    D+VGP+CE+GD++  +R++A+  PGD
Sbjct: 313 DAAMNDLVRPAMYEAWMAIEP-CRPGADTVAATWDVVGPVCESGDWLGRDRRLAVA-PGD 370

Query: 365 LLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPA 418
           ++ +   GAYG   +G YNSR    EI+++G   H++R R   + L  L+ + A
Sbjct: 371 IVAVLSAGAYGMAMAGNYNSRPRAAEILLDGDAVHVVREREDTRALFALERLLA 424


>gi|327483026|gb|AEA77433.1| Diaminopimelate decarboxylase [Vibrio cholerae LMA3894-4]
          Length = 417

 Score =  345 bits (886), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 186/418 (44%), Positives = 258/418 (61%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y E G L AE V L  LA+   TP Y YS   +E+++  F  +      ++CYA+
Sbjct: 1   MDYFNYQEDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGDYPHLICYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA LGSG DIVS GEL R LAA     ++VFSGVGKT  E+  ALQ  I
Sbjct: 61  KANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL  LN+ A  LG KAPI+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELLRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDRAA 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y  A +LP + + G+D HIGSQ+  +  F  A   L  L   L++ G +I+H+DVGGG
Sbjct: 181 QVYRLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  S+YA +L+ +   +   ++I EPGR + A+ G+LVTKV  +K +  
Sbjct: 241 LGVVYR-DELPPQPSEYAKALLDRLERHRDLELIFEPGRAIAANAGVLVTKVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND +RP LY A+ +I   + P       + D+VGP+CET DF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLIRPALYQAWQDI-IPLRPRQGEAQTY-DLVGPVCETSDFLGKDRDLV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L + GDLL +  +GAYG   S  YN+R  + E+MV+G++ +++R R     L  L+S+
Sbjct: 358 L-QEGDLLAVRSSGAYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREELSSLWALESV 414


>gi|304412536|ref|ZP_07394142.1| diaminopimelate decarboxylase [Shewanella baltica OS183]
 gi|307307195|ref|ZP_07586933.1| diaminopimelate decarboxylase [Shewanella baltica BA175]
 gi|304349178|gb|EFM13590.1| diaminopimelate decarboxylase [Shewanella baltica OS183]
 gi|306910434|gb|EFN40865.1| diaminopimelate decarboxylase [Shewanella baltica BA175]
          Length = 414

 Score =  345 bits (885), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 186/412 (45%), Positives = 256/412 (62%), Gaps = 4/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y + +L AE   +  LA    TP Y YS   +E+++  F+NA      ++CYA+K
Sbjct: 1   MDHFLYQQNALQAEGCQVADLAQTYGTPLYIYSRATLERHWHAFNNAVADHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           AN+N AV+  LA LGSG DIVS GEL R + A     ++VFSGVGKT  E++ AL  GIY
Sbjct: 61  ANANLAVLNVLARLGSGFDIVSGGELARVMEAGGDPAKVVFSGVGKTAAEMEQALNLGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN  A  LGK AP++ R+NPD++A TH  ISTG KE+KFGI + +   
Sbjct: 121 CFNVESSAELEQLNLVAGRLGKVAPVSLRINPDVDAGTHPYISTGLKENKFGIAMDEAEI 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++A A  LP + + GVD HIGSQ+ +I+ F  A   +  L  +L   G  I+H DVGGGL
Sbjct: 181 VFARAHALPHLNVKGVDCHIGSQLTEIKPFLDAMDRMLALIDRLAEQGIVIEHFDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y ++  PP    YA+ I    G+ Q K+I EPGR + A+ GI VT+V+ +K+++DK 
Sbjct: 241 GVTYDAE-TPPHPDVYAAAILARLGDRQLKLIFEPGRAIAANAGIFVTQVLYLKENSDKR 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+  I  +V    D      DIVGP+CETGDF+  NR++AL 
Sbjct: 300 FAIVDGAMNDLIRPALYSAWQNIIPVV--PRDSEAYEFDIVGPVCETGDFLGKNRQLALA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
              DLL +  +GAYG   +  YN+R    E+MV+G Q  ++R R    +L +
Sbjct: 358 AG-DLLAVRSSGAYGFAMASNYNTRPRAAEVMVDGEQAFLVREREKLSQLWQ 408


>gi|254282311|ref|ZP_04957279.1| diaminopimelate decarboxylase [gamma proteobacterium NOR51-B]
 gi|219678514|gb|EED34863.1| diaminopimelate decarboxylase [gamma proteobacterium NOR51-B]
          Length = 417

 Score =  345 bits (885), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 183/411 (44%), Positives = 256/411 (62%), Gaps = 10/411 (2%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           AF Y    LH E+V++  +A  V TP Y YS   IE  +  + +A      ++CYA+KAN
Sbjct: 2   AFTYKNDVLHCEDVAISTIAEQVGTPVYVYSRADIEAAFGEYQSALANRPHLICYAVKAN 61

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+  LA LG+G DIVSEGEL R +AA     ++VFSGVGK+ + I  AL +GI CF
Sbjct: 62  SNLAVLNLLARLGAGFDIVSEGELARVIAAGGDPSKVVFSGVGKSCEGIRQALDAGIRCF 121

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVESE+EL  LN+ A   GK AP++ RVNPD++ANTH  ISTG KE+KFG+ I +   LY
Sbjct: 122 NVESEAELNVLNEIAAECGKVAPVSLRVNPDVDANTHPYISTGLKENKFGVDIERAKDLY 181

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
             A+ +  ++  GVD HIGSQ+  I  F  A   L  L   L S+G  ++H+D+GGGLG+
Sbjct: 182 EQAAAMSFIEPVGVDCHIGSQLLSITPFIDAVDRLLALVDALESSGITLKHLDLGGGLGV 241

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y  + + P+ S Y + +    G+ + ++I EPGR +VA  G LVT+V  +K +  + F 
Sbjct: 242 QY-GEEQAPAISAYIAALTDRLGDREFELIFEPGRSVVAMAGALVTRVNYLKPTEHRNFA 300

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHA---DIVGPICETGDFIALNRKIAL 359
           ++D AMND +RP LYDA+ +I     PA  R H  A   D+VGP+CETGDF+  +R++AL
Sbjct: 301 LVDAAMNDLIRPALYDAWMDI----LPATQR-HDTAHRWDVVGPVCETGDFLGKDRELAL 355

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
            +P DLL +   GAYG V +  YN+R    E++V+    H++R R   + L
Sbjct: 356 -QPDDLLVVTGAGAYGFVMASNYNTRPRPAEVVVDKGTLHVVRQREALESL 405


>gi|261210168|ref|ZP_05924465.1| diaminopimelate decarboxylase [Vibrio sp. RC341]
 gi|260840708|gb|EEX67257.1| diaminopimelate decarboxylase [Vibrio sp. RC341]
          Length = 417

 Score =  345 bits (885), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 185/418 (44%), Positives = 257/418 (61%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE V L  LA+   TP Y YS   +E+++  F  +      ++CYA+
Sbjct: 1   MDYFNYQDDGQLWAEQVPLADLANQYGTPLYIYSRATLERHWHAFDKSVGDYPHLICYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA LGSG DIVS GEL R LAA     ++VFSGVGKT  E+  ALQ  I
Sbjct: 61  KANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL  LN+ A  LG KAPI+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELHRLNKVAAELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDRAA 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y  A +LP + + G+D HIGSQ+  +  F  A   L  L   L++ G +I+H+DVGGG
Sbjct: 181 EVYRLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAQGIHIRHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  S+YA +L+ +   +   ++I EPGR + A+ G+LVTKV  +K +  
Sbjct: 241 LGVVYR-DELPPQPSEYAKALLDRLERHRDLELIFEPGRAIAANAGVLVTKVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND +RP LY A+ +I   + P       + D+VGP+CET DF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLIRPALYQAWQDI-IPLRPRQGEAQTY-DLVGPVCETSDFLGKDRDLV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L   GDLL +  +GAYG   S  YN+R  + E+MV+G++ +++R R     L  L+S+
Sbjct: 358 L-EEGDLLAVRSSGAYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREELSSLWALESV 414


>gi|148652160|ref|YP_001279253.1| diaminopimelate decarboxylase [Psychrobacter sp. PRwf-1]
 gi|148571244|gb|ABQ93303.1| diaminopimelate decarboxylase [Psychrobacter sp. PRwf-1]
          Length = 445

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 188/416 (45%), Positives = 255/416 (61%), Gaps = 5/416 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           +    Y +G+L  E  S+++LA    TP Y YS  AI   Y  ++ +F  +D  VCYA+K
Sbjct: 29  LPTLSYQQGTLFVEQASVQQLAEQYGTPLYVYSKQAILDAYTAYTTSFAAIDHQVCYAVK 88

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA  G+G D+VS GEL R LA      +IVFSGVGKT+ E+  AL++GI 
Sbjct: 89  ANSNLAVLSVLAKAGAGFDLVSSGELARVLAVGADPSKIVFSGVGKTVTELTAALKAGIG 148

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SEL TLN  A  L  KAPI+ RVNPD++A TH  ISTG K++KFGI      +
Sbjct: 149 CFNVESLSELDTLNAVAAELNVKAPISIRVNPDVDAKTHPYISTGLKDNKFGISHDIAVA 208

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y +A++L  ++I G+D HIGSQ+ +I+ F  A   + +L + L+  G  +QHID+GGGL
Sbjct: 209 AYQHAASLEHLQIVGIDCHIGSQLTEIDPFVAALDKVCELIEALKQVGIELQHIDLGGGL 268

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D      S++A+ +      L  K+  EPGR +VA+ G+LVTKV  +K +  + 
Sbjct: 269 GVIY-IDEEVAKVSEFAAALLPKLQELGLKVFFEPGRSIVANAGMLVTKVEVLKPTEHRD 327

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYI-VNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           F I+D AMND +RP LY A  E+  I V  A        DIVG +CETGDF+A  R ++L
Sbjct: 328 FAIVDAAMNDLIRPALYQA--EMAVIPVQTASQASQKSWDIVGAVCETGDFLAKKRLLSL 385

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
              GD+L I   GAYG V S  YNSR    E+MV+G +  ++R R T  +L E +S
Sbjct: 386 AV-GDILAITGAGAYGFVMSSNYNSRPRPAEVMVSGDKHQVVRARETVAQLFETES 440


>gi|323527565|ref|YP_004229718.1| diaminopimelate decarboxylase [Burkholderia sp. CCGE1001]
 gi|323384567|gb|ADX56658.1| diaminopimelate decarboxylase [Burkholderia sp. CCGE1001]
          Length = 420

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 188/420 (44%), Positives = 255/420 (60%), Gaps = 13/420 (3%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           AF Y +G LHAE VS   LA    TP Y YS  A+   +  ++ A  G    V  A+KAN
Sbjct: 5   AFDYVDGVLHAEGVSAVSLAEQFGTPLYVYSRAALTDAWNAYAGACAGRRASVHVAVKAN 64

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+   A LG+G DIVS GEL R LAA   AE  VFSGVGK  DE+  AL +G+ CF
Sbjct: 65  SNLAVLNVFARLGAGFDIVSGGELARVLAAGGKAENTVFSGVGKHADEMREALAAGVKCF 124

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES  EL  LN  A  + +KAP++ RVNPD++A TH  ISTG K +KFG+      + Y
Sbjct: 125 NVESIPELDRLNAVAAQMDRKAPVSLRVNPDVDAKTHPYISTGLKSNKFGVAFEDARATY 184

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
             A+ +  +++ G+D HIGSQI ++  +  A   L +L +Q+  +G  I+HIDVGGGLGI
Sbjct: 185 QAAAAMANLEVVGIDCHIGSQITEVAPYLDAVDKLLELVEQIEQDGLTIRHIDVGGGLGI 244

Query: 243 AYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
            Y  D  PP   D+ S +       G+   ++  EPGR LV + G+L+T+V  +K  A+K
Sbjct: 245 TY-DDETPPDIGDFVSTVLDRIEARGHGHREVYFEPGRSLVGNAGVLLTRVEFLKPGAEK 303

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVN---PAGDRLHIHADIVGPICETGDFIALNRK 356
            F I+D AMND  RP +Y+AYH I+  V    PA    H++ D+VGP+CE+GD++   R 
Sbjct: 304 NFAIVDAAMNDLARPAMYEAYHVIDAAVQREVPA----HVY-DVVGPVCESGDWLGRERL 358

Query: 357 IALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +++  PGDLL I   GAYG V S  YN+R    E+MV+G+Q H++R R   Q+L   +SI
Sbjct: 359 LSV-EPGDLLAIRSAGAYGFVMSSNYNTRPRAAEVMVDGTQAHVVRAREEVQQLFAGESI 417


>gi|15677805|ref|NP_274969.1| diaminopimelate decarboxylase [Neisseria meningitidis MC58]
 gi|13124076|sp|Q9JXM2|DCDA_NEIMB RecName: Full=Diaminopimelate decarboxylase; Short=DAP
           decarboxylase
 gi|7227237|gb|AAF42304.1| diaminopimelate decarboxylase [Neisseria meningitidis MC58]
 gi|316985611|gb|EFV64558.1| diaminopimelate decarboxylase [Neisseria meningitidis H44/76]
 gi|325139296|gb|EGC61837.1| diaminopimelate decarboxylase [Neisseria meningitidis CU385]
 gi|325201024|gb|ADY96479.1| diaminopimelate decarboxylase [Neisseria meningitidis H44/76]
          Length = 414

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 177/400 (44%), Positives = 247/400 (61%), Gaps = 4/400 (1%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V   +LA    TP Y YS +A+ + +  +  AF  ++ +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFEHYQTAFAALNPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK AP++ R+NPD++A TH  ISTG K +KFGI        Y YA+  P
Sbjct: 122 IDRIQKVAARLGKTAPVSLRINPDVDAKTHPYISTGLKANKFGIAYADALEAYHYAAQQP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L   L + G  ++H+D+GGG+GI Y  D  
Sbjct: 182 NLKIIGIDCHIGSQLTDLSPLVEACERILILVDALAAEGIVLEHLDLGGGVGIVYQ-DEN 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGSLLTRVEFVKYGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIE 369
           D MRP LYDAYH I  +     D   + A+IVGPICETGDF+  +R IA    GDLL I 
Sbjct: 301 DLMRPALYDAYHHIEAVETK--DIATLTANIVGPICETGDFLGKDRTIAC-EEGDLLLIR 357

Query: 370 KTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
             GAYGA  +  YN+R    E++V+G+++ +IR R T ++
Sbjct: 358 SAGAYGASMASNYNARNRAAEVLVDGNEYRLIRRRETLEQ 397


>gi|325266603|ref|ZP_08133280.1| diaminopimelate decarboxylase [Kingella denitrificans ATCC 33394]
 gi|324982046|gb|EGC17681.1| diaminopimelate decarboxylase [Kingella denitrificans ATCC 33394]
          Length = 407

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 174/397 (43%), Positives = 250/397 (62%), Gaps = 3/397 (0%)

Query: 14  ENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAH 73
           EN+   +LA    TP Y YS   + + Y  +  AF  ++ ++CYA+KANSN ++I+  A 
Sbjct: 5   ENIEFGQLAAQFGTPLYVYSENELTQAYARYQTAFVALNPLICYAVKANSNLSIIRHFAR 64

Query: 74  LGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTL 133
           LGSG D VS GE+ R LAA   A++I+FSGVGK+  EI+ AL +GI CFNVES  EL  +
Sbjct: 65  LGSGFDTVSGGEIARVLAAGGSADKIIFSGVGKSEVEIEFALNAGIKCFNVESLPELDRI 124

Query: 134 NQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKI 193
           N  A  LGK AP++ R+NPD++A TH  ISTG K +KFGI +      Y +A +L  ++I
Sbjct: 125 NAVAQRLGKTAPVSLRINPDVDAKTHPYISTGLKANKFGIAMADAEQAYRHAGSLHHLRI 184

Query: 194 SGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSS 253
            G+D HIGSQ+  +    +A + L  LT +L   G  ++HID+GGG+GIAY ++  P  +
Sbjct: 185 VGIDCHIGSQLMDLSPLIEACERLLQLTDRLAGQGIVLEHIDLGGGIGIAYQNEQSPDLA 244

Query: 254 SDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMR 313
           + YA+ +          ++LEPGR LV + G L+T+V  +K+  +K FVI+D AMND MR
Sbjct: 245 A-YAAAVQTLLAGRPQSLVLEPGRSLVGNAGTLLTRVEYVKRGEEKNFVIVDAAMNDLMR 303

Query: 314 PTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGA 373
           P LY AYH I          + + ADIVGPICETGDF+A +R I+  + GDLL +   GA
Sbjct: 304 PALYQAYHNIENAETSERQPVFL-ADIVGPICETGDFLARDRMIS-AQAGDLLLVRSAGA 361

Query: 374 YGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
           Y +  +  YN+R    E++V+G +  +IRPR T++++
Sbjct: 362 YASSMASNYNTRGRAAEVLVSGDKVRLIRPRETWEDV 398


>gi|262404862|ref|ZP_06081416.1| diaminopimelate decarboxylase [Vibrio sp. RC586]
 gi|262348946|gb|EEY98085.1| diaminopimelate decarboxylase [Vibrio sp. RC586]
          Length = 417

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 186/418 (44%), Positives = 255/418 (61%), Gaps = 6/418 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M  F Y + G L AE V L  L +   TP Y YS   +E+++  F  +      ++CYA+
Sbjct: 1   MDYFNYQDDGQLWAEQVPLADLVNQYGTPLYVYSRATLERHWHAFDKSVGDYPHLICYAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN  V+ TLA LGSG DIVS GEL R LAA     ++VFSGVGKT  E+  ALQ  I
Sbjct: 61  KANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVESE EL  LN+ A  LG KAPI+ R+NPD++A TH  ISTG +++KFGI   +  
Sbjct: 121 KCFNVESEPELHRLNKVAAELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDRAA 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
            +Y  A +L  + + G+D HIGSQ+  +  F  A   L  L   L++ G +I+H+DVGGG
Sbjct: 181 EVYRLAHSLQNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKTEGIHIRHLDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           LG+ Y  D  PP  S+YA +L+ +   +   ++I EPGR + A+ G+LVTKV  +K +  
Sbjct: 241 LGVVYR-DELPPQPSEYAKALLDRLERHRDLELIFEPGRAIAANAGVLVTKVEFLKHTEH 299

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIA 358
           K F I+D AMND +RP LY A+ +I  +    G+      D+VGP+CET DF+  +R + 
Sbjct: 300 KNFAIIDAAMNDLIRPALYQAWQDIIPLRPRQGEAQTY--DLVGPVCETSDFLGKDRDLV 357

Query: 359 LPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           L   GDLL +  +GAYG   S  YNSR  + E+MV+G + H++R R T   L  L+S+
Sbjct: 358 L-EEGDLLAVRSSGAYGFTMSSNYNSRPRVAEVMVDGIKAHLVRQRETLSSLWALESV 414


>gi|304388543|ref|ZP_07370644.1| diaminopimelate decarboxylase [Neisseria meningitidis ATCC 13091]
 gi|304337463|gb|EFM03631.1| diaminopimelate decarboxylase [Neisseria meningitidis ATCC 13091]
          Length = 406

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 177/400 (44%), Positives = 247/400 (61%), Gaps = 4/400 (1%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V   +LA    TP Y YS +A+ + +  +  AF  ++ +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFEHYQTAFAALNPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK AP++ R+NPD++A TH  ISTG K +KFGI        Y YA+  P
Sbjct: 122 IDRIQKVAARLGKTAPVSLRINPDVDAKTHPYISTGLKANKFGIAYADALEAYHYAAQQP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L   L + G  ++H+D+GGG+GI Y  D  
Sbjct: 182 NLKIIGIDCHIGSQLTDLSPLVEACERILILVDALAAEGIVLEHLDLGGGVGIVYQ-DEN 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGSLLTRVEFVKYGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIE 369
           D MRP LYDAYH I  +     D   + A+IVGPICETGDF+  +R IA    GDLL I 
Sbjct: 301 DLMRPALYDAYHHIEAVETK--DIATLTANIVGPICETGDFLGKDRTIAC-EEGDLLLIR 357

Query: 370 KTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
             GAYGA  +  YN+R    E++V+G+++ +IR R T ++
Sbjct: 358 SAGAYGASMASNYNARNRAAEVLVDGNEYRLIRRRETLEQ 397


>gi|53804982|ref|YP_113352.1| diaminopimelate decarboxylase [Methylococcus capsulatus str. Bath]
 gi|53758743|gb|AAU93034.1| diaminopimelate decarboxylase [Methylococcus capsulatus str. Bath]
          Length = 415

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 184/410 (44%), Positives = 247/410 (60%), Gaps = 3/410 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G LH E+V L  +A    TP Y YS   +E+++  F  A      +VCYA+K
Sbjct: 1   MDHFNYRDGILHVEDVPLSAIAEQHGTPCYVYSRATLERHWHAFDAALGDCPHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN A++  LA LGSG DIVS GEL R LAA     R+VFSGVGK  DE+  AL +GI 
Sbjct: 61  ANSNIAILNLLARLGSGFDIVSVGELERVLAAGGDPSRVVFSGVGKREDELARALDTGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVE   EL  L++ A   G KAP++ RVNPD++A TH  ISTG  E+KFGI + +   
Sbjct: 121 CFNVEVAEELDRLDRLAGERGVKAPVSLRVNPDVDAGTHPYISTGLSENKFGIEVEEALV 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A+ +P +++ G+D HIGSQ+     F  A   +  L  +LR  G  I+H+D+GGGL
Sbjct: 181 QYRRAARMPNLEVVGIDCHIGSQLTSSMPFIDALDRVLALVARLRGEGIAIRHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  D  PP  ++YA  + +  G    +I++EPGR +  + GIL+T++  +K +  K 
Sbjct: 241 GIRYR-DEDPPHPTEYAEQLFRRLGRHDFEILIEPGRAVAGNAGILLTRLEYLKANQTKH 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND +RP LY A+ EI   V P  D      D+VGP+CETGDF+  +R++ L 
Sbjct: 300 FAIVDAAMNDLLRPALYGAWQEI-VPVAPRNDVESHSYDVVGPVCETGDFLGKSRELRLV 358

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
            PGDLL +   GAYG   S  YNSR    EI+V+GS  ++IR R     L
Sbjct: 359 -PGDLLAVRSAGAYGFSMSSNYNSRPRPAEILVDGSAVYLIRERENVARL 407


>gi|254483250|ref|ZP_05096482.1| diaminopimelate decarboxylase [marine gamma proteobacterium
           HTCC2148]
 gi|214036473|gb|EEB77148.1| diaminopimelate decarboxylase [marine gamma proteobacterium
           HTCC2148]
          Length = 416

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 177/412 (42%), Positives = 255/412 (61%), Gaps = 5/412 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F + +G L AE+ S+  +A    TP Y YS   +E  +  + +A  G + +VCYA+K
Sbjct: 1   MENFPFRDGELFAEDTSVSDIADRFGTPCYIYSRAGLEGAFRQYQDALAGCEHLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+ TLA LG+G DIVS GEL R +AA     ++VFSGVGK  DE+  AL+  I 
Sbjct: 61  ANSNLAVLDTLARLGAGFDIVSAGELHRVIAAGGDPGKVVFSGVGKKPDEMAQALELDIA 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ES +EL+ L   A   GK A ++ RVNPD++A TH  ISTG +E+KFG+ + +   
Sbjct: 121 CFNLESAAELEVLAGVAAHAGKTARVSVRVNPDVDAQTHPYISTGLRENKFGVTMEEALL 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ LP +++ GVD HIGSQ+ QI  F  A K L  L  +L   G  ++H+D+GGGL
Sbjct: 181 VYQRAAKLPNIEVVGVDCHIGSQLTQISPFIDALKRLLALIDELAEQGIVLRHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PPS + Y + + +  G+   +++ EPGR + A+ G+L+T V  +K + D  
Sbjct: 241 GVCY-KDEEPPSIAQYVAAVREELGDRPLQLVFEPGRSIAANAGLLLTTVEYLKTTPDHN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEI-NYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
           F ++D AMND +RP LY A+ +I N   N  G       D+VGP+CETGDF+   R+++L
Sbjct: 300 FALVDAAMNDMIRPALYQAWLDIRNTRENNVGQ--SASWDVVGPVCETGDFLGKQRQLSL 357

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELI 411
            + GDLL +   GAYG   S  YNSR    E+MV+G + H++R R +  ++I
Sbjct: 358 -QQGDLLALFGAGAYGFTMSSNYNSRPRAAEVMVDGEKVHLVRERESIADII 408


>gi|317153254|ref|YP_004121302.1| diaminopimelate decarboxylase [Desulfovibrio aespoeensis Aspo-2]
 gi|316943505|gb|ADU62556.1| diaminopimelate decarboxylase [Desulfovibrio aespoeensis Aspo-2]
          Length = 412

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 176/412 (42%), Positives = 255/412 (61%), Gaps = 3/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y +G+L AE V +  LA    TP Y YS   + +++  F +AFDG+D + CY++K
Sbjct: 1   MHHFEYRDGALFAEEVPVTALAGQYGTPLYVYSAATLTRHFQAFDSAFDGLDHLTCYSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN +V+K LA LG+G+DIVS GEL RAL A V  ++IV+SGVGK   EI  AL +GI 
Sbjct: 61  ANSNLSVLKLLAGLGAGMDIVSGGELYRALKAGVSPDKIVYSGVGKRPSEIREALDAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FN+ES +EL  +N+ A   GK A ++FR+NPD++  TH  ISTG K++KFG+ I     
Sbjct: 121 MFNIESVAELLKINEVAGEAGKVAKVSFRINPDVDPQTHPYISTGMKKNKFGLDIENSLE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y   + L  ++  G+D HIGSQ+  I  F +A   L D   +L+  G  I+++D+GGGL
Sbjct: 181 AYRMCADLANIEPIGMDCHIGSQLTSIAPFMEALDKLLDFYGRLKDMGIGIKYLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  +  PP  +++   + +    +  K+ILEPGR +  + GILVT+V+  K +  + 
Sbjct: 241 GITY-DEEEPPHPTEFGQALKEKLTGVPLKVILEPGRVIAGNAGILVTEVVYTKSNPSRN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F+I+D AMND +RP+LY +YH I  +     D L    D+VGPICE+GDF+A  R +   
Sbjct: 300 FLIVDAAMNDLVRPSLYGSYHRIAEVTPKERDSLTY--DVVGPICESGDFLARERALPAV 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
             G+LL +   GAYG   S  YNSR    E++V+G    + R R T+++LI+
Sbjct: 358 NQGELLAVFSAGAYGFTMSSNYNSRPRACELLVDGDTVTVARKRETYEDLID 409


>gi|299137487|ref|ZP_07030669.1| diaminopimelate decarboxylase [Acidobacterium sp. MP5ACTX8]
 gi|298600892|gb|EFI57048.1| diaminopimelate decarboxylase [Acidobacterium sp. MP5ACTX8]
          Length = 423

 Score =  343 bits (881), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 184/416 (44%), Positives = 251/416 (60%), Gaps = 5/416 (1%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
           F Y    L      L +LA    TP Y YS  AI +        F G+   +CYA+KANS
Sbjct: 10  FVYAGSRLECSGADLSELAAQFGTPLYVYSGDAIAERARMLQQEFAGVLHTICYAVKANS 69

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRAL-AAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           + AV++ L  LG G DIVS GEL R   AAP    R+VFSGVGK   E+D AL +GI  F
Sbjct: 70  SLAVMRMLGELGCGFDIVSGGELERVRRAAPEALGRVVFSGVGKQAWEMDAALDAGILLF 129

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVESE+EL+ L +RA +LGK A IA RVNPD+ A TH  ISTG +E KFGI I +   +Y
Sbjct: 130 NVESEAELEVLAERAQALGKIARIALRVNPDVFAETHPYISTGLREHKFGIAIERAREVY 189

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
             A  + G++ +GV +HIGSQI  +E F +A + +R L + LR +G +I+++D GGG GI
Sbjct: 190 QRAVRMQGIEPAGVSVHIGSQIRSVEPFAEAVRRVRSLVEDLRGDGMDIRYVDAGGGFGI 249

Query: 243 AYHSDHRPPSS--SDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
            Y      P++  ++YA  + +    L   ++LEPGRFLVA  G L+T+V+  K++  K 
Sbjct: 250 EYGKAEFDPAARVAEYARALREVLDGLNAHLLLEPGRFLVAQAGALLTRVLYTKQNGKKH 309

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FVI D AMND +RP LY A+HEI  +V    +R    ADIVGP+CE+GDF A +R+    
Sbjct: 310 FVITDAAMNDLIRPALYQAHHEIVPVVKD--ERAVQVADIVGPVCESGDFFARDRETQEL 367

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           R GDL+ +   GAYG   +  YN+R+   E++V   +  +IR R T  +L+  + I
Sbjct: 368 RQGDLVVLLDAGAYGMSLASHYNTRVRPAEVLVEQGRARLIRRRETLDDLLAAELI 423


>gi|258405461|ref|YP_003198203.1| diaminopimelate decarboxylase [Desulfohalobium retbaense DSM 5692]
 gi|257797688|gb|ACV68625.1| diaminopimelate decarboxylase [Desulfohalobium retbaense DSM 5692]
          Length = 418

 Score =  343 bits (880), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 179/415 (43%), Positives = 255/415 (61%), Gaps = 3/415 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +G L AE   + +LA    TP Y YST  + ++Y  F +AF+G+D + C++ K
Sbjct: 1   MHHFVYKDGRLQAEEFDVAELAATYGTPLYIYSTATLRRHYHAFDSAFEGLDHLTCFSAK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN +V++ L  +G+G+DIVS GEL RAL A +  E+IV+SGVGK   EI+ AL++ I 
Sbjct: 61  ANSNLSVLRLLGDMGAGVDIVSGGELYRALKAGIAPEKIVYSGVGKQRHEIEQALEADIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FN ES  EL+ +N+ A   G  A I+ R+NPD++  TH  ISTG K++KFG+ + Q   
Sbjct: 121 MFNCESVPELELINEVAQEKGLVARISLRINPDVDPQTHPYISTGLKKNKFGLNLEQSEE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A  LPGV   G+D HIGSQ+  IE F +A + L+    +L+  G  I+++D+GGGL
Sbjct: 181 AYRLARDLPGVDPIGMDCHIGSQLTSIEPFLEALERLKRFYAKLQDMGLAIRYLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  +  PP        + +   +L   +ILEPGR +  + GI+V+KV+  K S  K 
Sbjct: 241 GITY-DEETPPHPQQLGEALAESLKDLDVTLILEPGRVIAGNAGIMVSKVLYTKTSEAKH 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F ++D AMND +RP+LY AYH +   V P   R  +  DIVGPICETGDF+A +R +   
Sbjct: 300 FTVVDAAMNDLVRPSLYGAYHRLAE-VTPQ-KRQELPMDIVGPICETGDFLAQDRTLPEL 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
            PG+ +     GAYG   +  YNSR    EI+V+G Q  I+R R T+++LI L++
Sbjct: 358 APGECIAAFSAGAYGFTMASQYNSRPRAAEILVDGDQARIVRRRETYEDLIALET 412


>gi|149185865|ref|ZP_01864180.1| diaminopimelate decarboxylase [Erythrobacter sp. SD-21]
 gi|148830426|gb|EDL48862.1| diaminopimelate decarboxylase [Erythrobacter sp. SD-21]
          Length = 420

 Score =  343 bits (880), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 167/421 (39%), Positives = 262/421 (62%), Gaps = 4/421 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDT-MVCYAL 59
           M  F++ +G L AE+V L  +A  V TP Y YS   + ++   F +A   +    + +A+
Sbjct: 1   MDHFQHRDGILFAEDVPLPLIAEEVGTPVYVYSRATLVRHARVFRDALSELKQPHIAFAV 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KAN N AV++ LA+ G G D+VS GEL RAL A +  E IVFSGVGKT  E+   L+ GI
Sbjct: 61  KANPNLAVLRLLANEGYGADVVSGGELTRALKAGMKPEDIVFSGVGKTHAELQQGLEEGI 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
             FN+ESE E   L   A   GK+A  A RVNPD++A TH+KISTGK+E+KFG+P+ +  
Sbjct: 121 GQFNIESEEEGYELAAIARRFGKRAACALRVNPDVDARTHEKISTGKRENKFGVPLDRAA 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           ++Y   +   G+ + G+ +HIGSQ+  +E    AF  +  L ++LR+ G ++ H D+GGG
Sbjct: 181 AIYTALAKEEGLDMRGIAVHIGSQLADLEPLEAAFGKVGALIKELRAGGCSVTHADLGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           LG+ Y +    P+ ++Y +++ +   +   +++ EPGR +  + G+L+T+VI +K+  ++
Sbjct: 241 LGVPYKAGEELPAPAEYGAMVTRLTRDWNVQLMFEPGRVIAGNAGVLLTRVIRVKRGIER 300

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F+++D AMND  RP +Y A+H+    V P G++   H  IVGPICETGD  A++RKI +
Sbjct: 301 PFLVVDAAMNDLARPAMYGAWHDFE-AVEPTGEKTIAH--IVGPICETGDTFAMDRKIDV 357

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIPAW 419
             PGDL      GAYGA  + +YNSR  + E++V+G ++ ++  R+    +++ + +P W
Sbjct: 358 LAPGDLAVFRTAGAYGATMASSYNSRGFVAEVLVDGDRYAVVADRIAAGAIMDAERVPDW 417

Query: 420 L 420
           L
Sbjct: 418 L 418


>gi|182412489|ref|YP_001817555.1| diaminopimelate decarboxylase [Opitutus terrae PB90-1]
 gi|177839703|gb|ACB73955.1| diaminopimelate decarboxylase [Opitutus terrae PB90-1]
          Length = 434

 Score =  343 bits (879), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 180/436 (41%), Positives = 265/436 (60%), Gaps = 17/436 (3%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F+Y    LH E+V L  +A +  TP Y YS T I +NY     +  G+D  VCYA+K
Sbjct: 1   MHHFRYSGHDLHCESVDLAAVARLYGTPTYVYSATTITENYQRLQRSLSGLDLQVCYAMK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           AN N A+++  ++LG+G D+VS GE+RR +AA     + VF+GVGK+  EI LAL++ ++
Sbjct: 61  ANGNLALLRLFSNLGAGFDLVSGGEIRRVVAAGGNLRKSVFAGVGKSEAEIKLALENQVF 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            F+VESE EL  +N  A +LG KAPIA RVNPD++A TH KI+TGK ++KFGIP+ Q  +
Sbjct: 121 AFHVESEPELARINHVAGTLGVKAPIAIRVNPDVDAQTHAKITTGKSDNKFGIPLRQAGA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A+ L  +++ GV +HIGSQ+  +  F +A K L      L++N H I +  +GGG+
Sbjct: 181 AYEAAAKLKNIEVKGVQIHIGSQLTSVAPFVEAVKKLVPFVADLKAN-HGISYFSIGGGM 239

Query: 241 GIAYHS----------DHRPP-----SSSDYASLIHQYFGNLQCKIILEPGRFLVADVGI 285
           GI Y             ++P      +   Y   +      L  KI+LE GRF+V + G+
Sbjct: 240 GIVYRDALASGEQAWWSNQPAGQGMITPESYGEALTPLLAPLGLKILLEHGRFMVGNAGV 299

Query: 286 LVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPIC 345
           L+T+V  +K+ A K F+I+D AMND +RP +YD+YHEI  +   +  R  + ADIVGP+C
Sbjct: 300 LLTRVEHLKRGASKNFLIVDAAMNDLVRPAMYDSYHEIVPLHRDSSRRALV-ADIVGPVC 358

Query: 346 ETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRM 405
           E+ D  A +R++     G+LL     GAYG   +  YN+RL+  E++V GS F ++  R 
Sbjct: 359 ESTDCFAKDRQLQEVGEGELLAFMSAGAYGYAMANRYNARLMPAEVVVRGSSFELVNARE 418

Query: 406 TFQELIELDSIPAWLQ 421
           TF++ I  + IPA+L+
Sbjct: 419 TFEQTIANEKIPAFLK 434


>gi|119776382|ref|YP_929122.1| diaminopimelate decarboxylase [Shewanella amazonensis SB2B]
 gi|119768882|gb|ABM01453.1| diaminopimelate decarboxylase [Shewanella amazonensis SB2B]
          Length = 414

 Score =  343 bits (879), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 184/412 (44%), Positives = 255/412 (61%), Gaps = 4/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y E  L AE   +  LA    TP Y YS   +E+++  F  A      ++CYA+K
Sbjct: 1   MDHFLYREERLFAEECDVAGLAAEHGTPLYVYSRATLERHWHAFDGAVASHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R L A     ++VFSGVGKT+ E++LAL +GI 
Sbjct: 61  ANSNLAVLNVLARLGSGFDIVSGGELSRVLEAGGDPAKVVFSGVGKTVAEMELALNTGIM 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFN+ES +EL+ LN+ A  LGK AP++ RVNPD++A TH  ISTG KE+KFGIP+ +  +
Sbjct: 121 CFNLESGAELELLNEVAGRLGKVAPVSLRVNPDVDAGTHPYISTGLKENKFGIPMEEAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           L+A A+ LP + + GVD HIGSQ+ +++ F  A   +  L  +L   G  I+H DVGGGL
Sbjct: 181 LFARAAALPNLAVKGVDCHIGSQLTELKPFLDAMDRMLALIDRLAEQGIVIEHFDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y+ +  PP    YA+ I +       K+I EPGR + A+ GI VT+V+  K + DK 
Sbjct: 241 GVTYNGE-TPPHPDVYAAAILEKLNGRPLKLIFEPGRAIAANAGIFVTQVLYTKDNGDKR 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FVI+D AMND +RP+LY A+   N I     +      D+VGP+CETGDF+  +R++A  
Sbjct: 300 FVIVDGAMNDLIRPSLYGAWQ--NIIPAVKTNEPTTRCDVVGPVCETGDFLGKDRELA-A 356

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
             GDLL +   GAYG   +  YN+R    E+MV+G + +++R R    +L +
Sbjct: 357 GSGDLLVVRSAGAYGFTMASNYNTRPRAAELMVDGDKAYVVREREKLSQLWQ 408


>gi|187925578|ref|YP_001897220.1| diaminopimelate decarboxylase [Burkholderia phytofirmans PsJN]
 gi|187716772|gb|ACD17996.1| diaminopimelate decarboxylase [Burkholderia phytofirmans PsJN]
          Length = 420

 Score =  342 bits (878), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 185/421 (43%), Positives = 258/421 (61%), Gaps = 13/421 (3%)

Query: 2   SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKA 61
           SAF Y +G LHAE VS   LA    TP Y YS  A+ + +  ++ A  G    V  A+KA
Sbjct: 4   SAFDYVDGVLHAEGVSAVSLAEQFGTPLYVYSRAALTEAWNAYAGACAGRRASVHVAVKA 63

Query: 62  NSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYC 121
           NSN AV+   A LG+G DIVS GEL R LAA   AE  VFSGVGK  DE+  AL +G+ C
Sbjct: 64  NSNLAVLNVFARLGAGFDIVSGGELARVLAAGGRAENTVFSGVGKHADEMRDALAAGVKC 123

Query: 122 FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSL 181
           FNVES  EL  LN  A ++GKKAP++ RVNPD++A TH  ISTG K +KFG+      + 
Sbjct: 124 FNVESIPELDRLNAVAAAMGKKAPVSLRVNPDVDAKTHPYISTGLKSNKFGVAFEDARAT 183

Query: 182 YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG 241
           Y  A+ +  +++ G+D HIGSQI ++  +  A   + +L +Q+  +G  I+HIDVGGGLG
Sbjct: 184 YQAAAAMANLEVVGIDCHIGSQITEVAPYLDAVDKVLELVEQIEQDGVKIRHIDVGGGLG 243

Query: 242 IAYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           I Y  D  PP   ++   +       G+   ++  EPGR LV + G+L+T+V  +K  A+
Sbjct: 244 ITY-DDETPPEIGEFVRTVLDRIEARGHGHREVYFEPGRSLVGNAGMLLTRVEFLKPGAE 302

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVN---PAGDRLHIHADIVGPICETGDFIALNR 355
           K F I+D AM D  RP +Y+AYH I+ +V    PA    H++ D+VGP+CE+GD++   R
Sbjct: 303 KNFAIVDAAMTDLARPAMYEAYHAIDPVVKRDVPA----HVY-DVVGPVCESGDWLGRER 357

Query: 356 KIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
            +++  PGDLL I   GAYG V S  YN+R    E+MV+G+Q H++R R   ++L   ++
Sbjct: 358 LLSV-EPGDLLAIRSAGAYGFVMSSNYNTRPRAAEVMVDGTQVHVVRAREEVKQLFAGET 416

Query: 416 I 416
           I
Sbjct: 417 I 417


>gi|171060084|ref|YP_001792433.1| diaminopimelate decarboxylase [Leptothrix cholodnii SP-6]
 gi|170777529|gb|ACB35668.1| diaminopimelate decarboxylase [Leptothrix cholodnii SP-6]
          Length = 422

 Score =  342 bits (878), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 177/406 (43%), Positives = 250/406 (61%), Gaps = 13/406 (3%)

Query: 11  LHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKT 70
           L+ E+  L  LA    TP Y YS  ++      +  A  G   ++CYA+KANS+ AV++T
Sbjct: 16  LYLEDCQLATLAQQHGTPLYVYSQASMLDALAAYQRALAGRPHLICYAMKANSSLAVLQT 75

Query: 71  LAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESEL 130
            A  G G DIVS GEL+R LAA   A ++VFSGVGKT  E+  AL++G+ CFNVESESEL
Sbjct: 76  FARAGCGFDIVSGGELQRVLAAGASASKVVFSGVGKTRTEMRQALEAGVRCFNVESESEL 135

Query: 131 KTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPG 190
             L+Q AV LG +AP++ RVNPD++A TH  ISTG K +KFGI   Q  ++Y +A+ LPG
Sbjct: 136 ALLSQVAVELGVRAPVSLRVNPDVDAGTHPYISTGLKGNKFGIAHEQALAVYRHAAQLPG 195

Query: 191 VKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRP 250
           + + G+D HIGSQ+ ++  F  A   + DL + + + G  + H+D+GGGLGI Y +D  P
Sbjct: 196 IAVRGIDCHIGSQLTEVAPFLDALDRILDLVEAIEAAGITLHHLDLGGGLGITY-TDETP 254

Query: 251 PSSSDYASLIHQYFGNLQCK------IILEPGRFLVADVGILVTKVISIKKSADKTFVIL 304
           PS+ +   LI Q    +  +      I+ EPGR LV + G+L+T+V+ +K    K F I+
Sbjct: 255 PSADE---LIAQLLARIDARGHGHREIVFEPGRSLVGNAGVLLTEVLYLKPGETKNFCIV 311

Query: 305 DVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGD 364
           D AMND MRP +Y+A+  I  +     D   +  D+VGP+CE+GD++   R++A+  PGD
Sbjct: 312 DAAMNDLMRPAMYEAWMGI--VPCTERDAPAVTWDVVGPVCESGDWLGRERELAVA-PGD 368

Query: 365 LLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
            L I   GAYG   +  YN+R    E+MV G Q  +IR R +  EL
Sbjct: 369 HLAILSAGAYGMAMASNYNTRGRAAEVMVRGHQATLIRRRESAAEL 414


>gi|118602155|ref|YP_903370.1| diaminopimelate decarboxylase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|118567094|gb|ABL01899.1| diaminopimelate decarboxylase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 415

 Score =  342 bits (878), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 182/414 (43%), Positives = 258/414 (62%), Gaps = 3/414 (0%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
            F Y    L+AE+V++  L    ++P Y YS T IE N+  F  AF     +VCYA+KAN
Sbjct: 2   GFSYKNHILYAESVAITDLIDAYESPLYVYSRTDIENNWYEFDQAFGTHPHLVCYAVKAN 61

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+  L+ +GSG DIVS GEL R L A   A R VFSGV KT  EI  AL+ GI+CF
Sbjct: 62  SNLAVLNVLSKIGSGFDIVSIGELERVLFAGADASRCVFSGVAKTKFEIKRALEVGIFCF 121

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES +E+  + Q A  +G +A I+ R+NP+++A TH  ISTG KE+KFG+ I  +  +Y
Sbjct: 122 NVESMAEMNRIEQVAKDMGTQAQISLRINPNVDAKTHPYISTGLKENKFGVDIDDVVPIY 181

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
             A   P + + G++ HIGSQ+ ++  F  A   + +L  +L      I H+D+GGG+GI
Sbjct: 182 RMAHNSPYLAVKGLNCHIGSQLVEVSPFLDALDKVLELVAKLDKINIRITHLDLGGGIGI 241

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
            Y+++     ++  AS++ +   N   KIILEPGR +V + G+ VTKV  +K+++DK+F 
Sbjct: 242 KYNNEQIIDINAYIASILDKVKMN-DLKIILEPGRAVVGNAGVFVTKVEFLKQNSDKSFA 300

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D AMND +RP  Y  YH++   VN     +  + D+VGPICETGDF+A NRK++L   
Sbjct: 301 IIDGAMNDLLRPAFYQTYHQV-LPVNENAKGVDANWDLVGPICETGDFLAKNRKLSLSE- 358

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           GD L +  TGAYG   S  YNSR  + E+MV+G+Q  ++R R T Q+L   + I
Sbjct: 359 GDYLALMSTGAYGFTMSSNYNSRPRVAEVMVSGNQHTLVRERETIQDLFNKEHI 412


>gi|163748703|ref|ZP_02155956.1| diaminopimelate decarboxylase [Shewanella benthica KT99]
 gi|161331813|gb|EDQ02617.1| diaminopimelate decarboxylase [Shewanella benthica KT99]
          Length = 414

 Score =  342 bits (878), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 186/412 (45%), Positives = 258/412 (62%), Gaps = 4/412 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y    L AE+ S+ +LA    TP Y YS   +E+++  F  A      ++CYA+K
Sbjct: 1   MDHFLYKNNELLAEDCSVAELARTHGTPLYIYSRATLERHWHAFDRAVADHPHLICYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+  LA LGSG DIVS GEL R + A     ++VFSGVGKT  E+++AL   I 
Sbjct: 61  ANSNIAVLNVLARLGSGFDIVSGGELLRVIEAGGEPAKVVFSGVGKTAAEMEMALNLDIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES +EL+ LN  A  +GK AP++ R+NPD++A TH  ISTG K++KFGI + Q  +
Sbjct: 121 CFNVESAAELEQLNIVAGRIGKIAPVSLRINPDVDAGTHPYISTGLKDNKFGIAMEQAEA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           ++A A+ LP ++I GVD HIGSQ+ +I+ F  A   +  L  +L   G +I+H DVGGGL
Sbjct: 181 IFARAAALPNLEIKGVDCHIGSQLTEIQPFLDAMDRMLALIDRLAEQGIHIEHFDVGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G++Y  D  PP    YA+ + +  G+ + K+I EPGR + A+ GI VT+V+ +K + DK 
Sbjct: 241 GVSY-GDETPPQPDVYAAALLERLGSRKLKLIFEPGRAIAANAGIFVTQVLYLKSNDDKH 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F ++D AMND +RP LY A+  I   V P  D   ++ DIVGPICETGDF+  +R++ L 
Sbjct: 300 FALVDGAMNDLIRPALYSAWQNI-IPVKPR-DGKTLNYDIVGPICETGDFLGKDRELNLA 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIE 412
             GD L +  +GAYG   S  YNSR    E+MV+G Q  +IR R    +L +
Sbjct: 358 -AGDYLAVCSSGAYGFTMSSNYNSRPRSAEVMVDGEQAFVIREREKLTQLWQ 408


>gi|262198680|ref|YP_003269889.1| diaminopimelate decarboxylase [Haliangium ochraceum DSM 14365]
 gi|262082027|gb|ACY17996.1| diaminopimelate decarboxylase [Haliangium ochraceum DSM 14365]
          Length = 425

 Score =  342 bits (877), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 177/423 (41%), Positives = 257/423 (60%), Gaps = 7/423 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F Y +  L+ E+V L ++A  V TP Y YS   + ++   F  A  G+  +VC+++K
Sbjct: 1   MNHFAYRDDELYCEDVPLARIADEVGTPVYVYSHATLTRHLQVFDAALSGVPHLVCFSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           +N N AV++ L  LG+G DIVS GEL R L A     ++VFSGVGKT  EI  AL++GI 
Sbjct: 61  SNPNLAVLRLLFQLGAGADIVSGGELARVLRAGGDPAKVVFSGVGKTDAEIAAALRAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVESE EL  ++  A  +G +AP++ R+NPD++A TH  I+TG KE KFGI + +   
Sbjct: 121 AFNVESEEELHAIDAVAADMGARAPVSLRINPDVDAQTHPYIATGLKESKFGIAMAEARR 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +YA A TL  V I GVD HIGSQ+ + + F  A   L  L ++L ++G  ++++D+GGGL
Sbjct: 181 VYALARTLAHVDIVGVDCHIGSQLTRTDPFSDAVSRLLGLIEELHADGVALRYLDIGGGL 240

Query: 241 GIAYHSDHR--PPSSSDYASLIHQYFGNLQ----CKIILEPGRFLVADVGILVTKVISIK 294
           GI Y  D    PPS ++Y   I      L+      II EPGR +  + G L+T+V+  K
Sbjct: 241 GIPYEGDGAAPPPSPAEYGDAIKSALAPLKLPTPLTIICEPGRVITGNAGALLTRVLYRK 300

Query: 295 KSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALN 354
            +  K F ++D AMND +RP+LY +YH +  +V  A  R     D+VGPICE+GDF+A +
Sbjct: 301 HAEAKHFTVVDAAMNDLIRPSLYGSYHPMRPVVR-AAQRPQQVTDVVGPICESGDFLARD 359

Query: 355 RKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELD 414
           R++     G+LL I   GAYG   +  YNSR    E+MV G +F ++R R + ++L   +
Sbjct: 360 RELPALERGELLAIGAAGAYGFAMASNYNSRPRAAEVMVRGDRFAVVRARESVEQLFADE 419

Query: 415 SIP 417
           +IP
Sbjct: 420 AIP 422


>gi|148826629|ref|YP_001291382.1| diaminopimelate decarboxylase [Haemophilus influenzae PittEE]
 gi|148716789|gb|ABQ98999.1| diaminopimelate decarboxylase [Haemophilus influenzae PittEE]
          Length = 450

 Score =  342 bits (877), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 178/393 (45%), Positives = 255/393 (64%), Gaps = 4/393 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L+AE++ +++LA    TP Y YS   +E+++  F +AF     ++C+A+K
Sbjct: 1   MNFFQYKNNKLYAEDIPVQQLAEQFGTPLYVYSRATLERHWHAFDSAFGKHPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN  V+  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+ +EI  AL+ GI 
Sbjct: 61  SCSNIGVLNIMAKLGSGFDIVSQGELERVLAAGGDASKVVFSGVAKSREEIMRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SELK +NQ A  +GK API+ RVNPD++A+TH  ISTG KE+KFG+ +++   
Sbjct: 121 CFNVESVSELKHINQIAGEMGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVNEARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  ASTLP +KI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYKLASTLPNIKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGITLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNL-QCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  SDYA+ + +   N  + +IILEPGR + A+ GILV KV  +K +  +
Sbjct: 241 GVTY-TDETPPHPSDYANALLEKLKNYPELEIILEPGRAISANAGILVAKVQYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I D  MND +RP LY+AY  I  I +   +R     D+VGP+CET DF+   R++++
Sbjct: 300 NFAITDTGMNDMIRPALYEAYMNIVEI-DRTLEREKAIYDVVGPVCETSDFLGKQRELSI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIM 392
              GD +     GAYGA  S  YNSR    E+ 
Sbjct: 359 AE-GDYIAQCSAGAYGASMSSNYNSRARTAEVF 390


>gi|326796187|ref|YP_004314007.1| diaminopimelate decarboxylase [Marinomonas mediterranea MMB-1]
 gi|326546951|gb|ADZ92171.1| diaminopimelate decarboxylase [Marinomonas mediterranea MMB-1]
          Length = 417

 Score =  342 bits (876), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 182/407 (44%), Positives = 251/407 (61%), Gaps = 8/407 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y + +L AENVSLE +A    TP Y YS    E++Y  +++AF    T+VCYA+K
Sbjct: 1   MDFFNYTDQTLFAENVSLETVAEQFGTPTYVYSRATFERHYNAYADAFASHPTLVCYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SN A++  LA LG+G DIVS GEL R + A     +++FSG+GK   E+  AL+ GI+
Sbjct: 61  ACSNIAILNVLAKLGAGFDIVSIGELERVVRAGGDPSKVMFSGLGKQEHEMRRALELGIH 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE EL  LN+ A  LG KAP++ RVNPD++A TH  ISTG KE+KFGI I     
Sbjct: 121 CFNVESEPELYRLNKVAGELGVKAPVSMRVNPDVDAKTHPYISTGLKENKFGIDIKDAPR 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  A+ +  + + GVD HIGSQ+ +++ F   F  L  L  +L   G  I+H+D+GGGL
Sbjct: 181 IYQVANEMAHLNVMGVDCHIGSQLTELKPFLDTFDRLITLIDELAGLGIEIKHMDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D  PP  +DYA LI          +  EPGR + A+ G+L+TKV  +K +  K 
Sbjct: 241 GVRYR-DEVPPEPADYAQLILDKMKGRDISLAFEPGRSIAANAGLLLTKVEFLKCTEHKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEI---NYIVNPAGDRLHIHADIVGPICETGDFIALNRKI 357
           F ++D AMND +RP+LY A+  I   N      G R++   D+VGP+CETGDF+  +R++
Sbjct: 300 FAVIDGAMNDLIRPSLYSAWMNIVPVNLEATSEGKRIY---DLVGPVCETGDFLGKDREL 356

Query: 358 ALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPR 404
            + + GDLL +   GAYG   +  YNSR    E+MV+G   H+IR R
Sbjct: 357 DI-QAGDLLAVRSAGAYGFTMASNYNSRNRAAEVMVDGDVAHLIRER 402


>gi|148827915|ref|YP_001292668.1| diaminopimelate decarboxylase [Haemophilus influenzae PittGG]
 gi|148719157|gb|ABR00285.1| diaminopimelate decarboxylase [Haemophilus influenzae PittGG]
          Length = 450

 Score =  341 bits (875), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 178/393 (45%), Positives = 254/393 (64%), Gaps = 4/393 (1%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y    L+AE++ +++LA    TP Y YS   +E+++  F +AF     ++C+A+K
Sbjct: 1   MNFFQYKHNKLYAEDIPVQQLAEQFGTPLYVYSRATLERHWHAFDSAFGKRPHLICFAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           + SN  V+  +A LGSG DIVS+GEL R LAA   A ++VFSGV K+ +EI  AL+ GI 
Sbjct: 61  SCSNIGVLNIMAKLGSGFDIVSQGELERVLAAGGNASKVVFSGVAKSREEIMRALEVGIR 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SELK +NQ A  +GK API+ RVNPD++A+TH  ISTG KE+KFG+ +++   
Sbjct: 121 CFNVESVSELKHINQIAGEMGKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVNEARE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
           +Y  ASTLP +KI+G+D HIGSQ+ +++ F  A   L  L +QL+ +G  ++H+D+GGGL
Sbjct: 181 VYKLASTLPNIKITGMDCHIGSQLTELQPFLDATDRLIVLMEQLKEDGITLKHLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYA-SLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
           G+ Y +D  PP  SDYA +L+ +     + +IILEPGR + A+ GILV KV  +K +  +
Sbjct: 241 GVTY-TDETPPHPSDYANALLEKLKDYPELEIILEPGRAISANAGILVAKVQYLKSNESR 299

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIAL 359
            F I D  MND +RP LY+AY  I  I         I+ D+VGP+CET DF+   R++++
Sbjct: 300 NFAITDTGMNDMIRPALYEAYMNIVEIDRTLAREKAIY-DVVGPVCETSDFLGKQRELSI 358

Query: 360 PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIM 392
              GD +     GAYGA  S  YNSR    E+ 
Sbjct: 359 AE-GDYIAQCSAGAYGASMSSNYNSRARTAEVF 390


>gi|217969261|ref|YP_002354495.1| diaminopimelate decarboxylase [Thauera sp. MZ1T]
 gi|217506588|gb|ACK53599.1| diaminopimelate decarboxylase [Thauera sp. MZ1T]
          Length = 423

 Score =  341 bits (875), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 178/412 (43%), Positives = 253/412 (61%), Gaps = 8/412 (1%)

Query: 8   EGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAV 67
           +G+L  E + L ++A    TP Y YS  A+   +  + +A  G   +VCYA+KANSN  +
Sbjct: 17  DGALWLEELPLAEIAARFGTPTYVYSRAALAAAFAAWQDALAGRRALVCYAVKANSNLGI 76

Query: 68  IKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESE 127
           +   A LG+G DIVS GEL R LAA   A+++VFSGVGKT  E+  AL +GI CFNVES 
Sbjct: 77  LSVFARLGAGFDIVSGGELARVLAAGGRADKVVFSGVGKTRAEMRQALLAGIRCFNVESA 136

Query: 128 SELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYAST 187
           +EL+ L+  A  LG +AP++ RVNPD++  TH  ISTG K +KFG+      ++Y  A+ 
Sbjct: 137 AELEHLDAVAGELGVRAPVSLRVNPDVDPKTHPYISTGLKGNKFGVAFADAPAIYRRAAA 196

Query: 188 LPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSD 247
           LP + I+GV  HIGSQ+       +A + LRDL + L ++G  ++HID+GGGLGI Y  D
Sbjct: 197 LPNLHITGVACHIGSQLLDRAPIAEAAQKLRDLVEHLAADGMALEHIDLGGGLGIRYR-D 255

Query: 248 HRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVA 307
             PP  ++Y + + + F     ++  EPGR LV + G+L+T++  +K    K F I+D A
Sbjct: 256 ETPPPVAEYLAPLLEVFAGRAEELCFEPGRSLVGNAGLLLTRIEYLKPGETKNFAIVDAA 315

Query: 308 MNDFMRPTLYDAYHEINYIVNPAGDRLHIHA--DIVGPICETGDFIALNRKIALPRPGDL 365
           MND  RP LYDA+HE+  +      R H  +  D+VGPICE+GDF+A  R +A+   GDL
Sbjct: 316 MNDLARPALYDAWHEVVEVAA----RTHAPSTYDVVGPICESGDFLARERSLAVAE-GDL 370

Query: 366 LYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSIP 417
           L I   GAYG   +  YN+R    EI+V+G+  H++R R T +EL   +  P
Sbjct: 371 LAILSAGAYGMTMASNYNTRPRAAEILVDGASAHVVRERETVEELFARERTP 422


>gi|298528736|ref|ZP_07016140.1| diaminopimelate decarboxylase [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298512388|gb|EFI36290.1| diaminopimelate decarboxylase [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 415

 Score =  341 bits (875), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 172/415 (41%), Positives = 259/415 (62%), Gaps = 3/415 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M+ F+Y  G L+AE++S+++L     TP Y YS   + ++Y  F +AF+G   M C+++K
Sbjct: 1   MNFFEYRNGELYAEDISIKELVQEFDTPLYVYSAKTLRRHYEAFDSAFEGTRHMTCFSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN  V+K L  +G+G+DIVS GEL RAL A +  ++IV+SGVGK   EI  AL S I 
Sbjct: 61  ANSNICVLKLLGQMGAGVDIVSGGELFRALKAGIDPQKIVYSGVGKREHEIREALLSNIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL+ +NQ A  +  +A I+ R+NPD++  TH  ISTG K++KFG+ + Q   
Sbjct: 121 MFNVESRQELERINQVASEMEVQARISLRINPDVDPQTHPYISTGLKKNKFGLELEQAWE 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A  L  ++  G+D HIGSQ+  +E F +A + ++    +L+  G +I+++D+GGGL
Sbjct: 181 SYKLARELSNIEPVGIDCHIGSQLTSVEPFLEALERIKSFYGRLQELGLDIKYLDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y  +  PP  +++   + +   +    +ILEPGR +  + GI+VT+V+  K +  K 
Sbjct: 241 GITYDQEE-PPHPAEFGRAVKESLKDTDLTLILEPGRVIAGNAGIMVTRVLYTKGTPSKN 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FVI+D AMND MRP+LY +YH I  +   +G RL+  AD+VGPICETGDF+A  R++   
Sbjct: 300 FVIVDAAMNDLMRPSLYGSYHRIEPVQEKSG-RLYT-ADVVGPICETGDFLAQGRELPRL 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDS 415
              DLL +   GAYG   +  YNSR    E++V+  Q  + R R  + +L++L+ 
Sbjct: 358 EQDDLLAVHSAGAYGFTMASQYNSRPRPAEVLVDNDQAVLARRREVYFDLLQLEE 412


>gi|121635635|ref|YP_975880.1| diaminopimelate decarboxylase [Neisseria meningitidis FAM18]
 gi|120867341|emb|CAM11112.1| diaminopimelate decarboxylase [Neisseria meningitidis FAM18]
 gi|325131386|gb|EGC54095.1| diaminopimelate decarboxylase [Neisseria meningitidis M6190]
 gi|325137467|gb|EGC60053.1| diaminopimelate decarboxylase [Neisseria meningitidis ES14902]
 gi|325204928|gb|ADZ00382.1| diaminopimelate decarboxylase [Neisseria meningitidis M01-240355]
          Length = 414

 Score =  341 bits (874), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 178/400 (44%), Positives = 244/400 (61%), Gaps = 4/400 (1%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V   +LA    TP Y YS +A+ + +  +  AF  +  +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFEHYQTAFAELSPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK AP++ RVNPD++A TH  ISTG K +KFGI        Y +A+  P
Sbjct: 122 IDRIQKVAARLGKTAPVSLRVNPDVDAKTHPYISTGLKANKFGIAYADALEAYRHAAQQP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L   L + G  ++H+D+GGG+GI Y  D  
Sbjct: 182 NLKIIGIDCHIGSQLTDLSPLVEACERILILVDALAAEGIVLEHLDLGGGVGIVYQ-DED 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGSLLTRVEFVKYGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIE 369
           D MRP LYDAYH I  +     D   + A+IVGPICETGDF+  +R IA    GDLL I 
Sbjct: 301 DLMRPALYDAYHHIEAVETK--DIATLTANIVGPICETGDFLGKDRTIAC-EEGDLLLIR 357

Query: 370 KTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
             GAYGA  +  YN+R    E++VNG  + +IR R T ++
Sbjct: 358 SAGAYGASMASNYNARNRAAEVLVNGGGYKLIRRRETLEQ 397


>gi|209521076|ref|ZP_03269807.1| diaminopimelate decarboxylase [Burkholderia sp. H160]
 gi|209498495|gb|EDZ98619.1| diaminopimelate decarboxylase [Burkholderia sp. H160]
          Length = 420

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 184/420 (43%), Positives = 252/420 (60%), Gaps = 13/420 (3%)

Query: 3   AFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           AF Y +G LHAE VS   LA    TP Y YS  A+   +  ++ A  G       A+KAN
Sbjct: 5   AFDYVDGVLHAEGVSAVSLAEQFGTPLYVYSRAALTAAWNAYAGACAGRRASAHVAVKAN 64

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN AV+   A LG+G DIVS GEL R LAA   AE  VFSGVGK   E+  AL +G+ CF
Sbjct: 65  SNLAVLNVFARLGAGFDIVSGGELARVLAAGGKAENTVFSGVGKQASEMRDALAAGVKCF 124

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVES  EL  LN  A  +GKKAP++ RVNPD++A TH  ISTG K +KFG+      + Y
Sbjct: 125 NVESIPELDRLNAVAGEMGKKAPVSLRVNPDVDAKTHPYISTGLKSNKFGVAFDDARATY 184

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
             A+ +  +++ G+D HIGSQI ++  +  A   + +L +Q+  +G  I+HIDVGGGLGI
Sbjct: 185 QAAAAMANLEVVGIDCHIGSQITEVAPYLDAIDKVLELVEQIEQDGVTIRHIDVGGGLGI 244

Query: 243 AYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSADK 299
            Y  D  PP   ++   +       G+   ++  EPGR LV + G+L+T++  +K   DK
Sbjct: 245 TY-DDETPPEIGEFVRTVLDRIEARGHAHREVYFEPGRSLVGNAGVLLTRLEFLKPGEDK 303

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYIVN---PAGDRLHIHADIVGPICETGDFIALNRK 356
            F I+D AMND  RP +YDAYH I  +V    PA    H++ D+VGP+CE+GD++   R 
Sbjct: 304 NFAIVDAAMNDLARPAMYDAYHAIEPVVKRDVPA----HVY-DVVGPVCESGDWLGRERL 358

Query: 357 IALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           +A+  PGDLL I   GAYG V S  YN+R    E+MV+G+Q H++R R   ++L   ++I
Sbjct: 359 LAV-EPGDLLAIRSAGAYGFVMSSNYNTRARAAEVMVDGTQAHVVRAREEVEQLFAGETI 417


>gi|187735226|ref|YP_001877338.1| diaminopimelate decarboxylase [Akkermansia muciniphila ATCC
           BAA-835]
 gi|187425278|gb|ACD04557.1| diaminopimelate decarboxylase [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 429

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 184/431 (42%), Positives = 259/431 (60%), Gaps = 17/431 (3%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M +F Y  G+L+ ENV+L++LA    TP Y YS   I  ++     A   ++  V YA+K
Sbjct: 1   MHSFAYKNGTLYCENVNLQELADKESTPLYVYSKQTILNHFHRLREALAPLNAEVAYAVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SN A++  +A  G+G DIVS GEL R L A     +  ++GVGKT  EI  AL  GIY
Sbjct: 61  ACSNIAILNLMARNGAGFDIVSGGELFRVLKAGGDPSKCTYAGVGKTEQEIRYALAQGIY 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVESE+EL+ +N  A S+G KAP+A RVNP++ A THK I+TGK E+KFG+   +I S
Sbjct: 121 CFNVESEAELRAINAIAASMGVKAPVAVRVNPNVEAGTHKYITTGKAENKFGVDFERIES 180

Query: 181 LYAYAS-TLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
           LY  A+  LP + + G+ MHIGSQ+ Q + F +A + +  L   L+   H I+   +GGG
Sbjct: 181 LYEMAARELPNLHLKGLQMHIGSQLTQAKPFLEAVRKVAPLAASLKEK-HGIEFFSIGGG 239

Query: 240 LGIAY------------HSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILV 287
           +GI Y            + D    + S YA  +      L   II+EPGR +V + G L+
Sbjct: 240 IGIVYQGTLDSGVQEWWNEDCAQLTLSTYAQAVVPTLQPLGLHIIVEPGRLIVGNAGALI 299

Query: 288 TKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIV-NPAGDRLHIHADIVGPICE 346
           T+ +  K    KTF I+D  MND +RP LY  YHEI  +  +P+G    + AD+VGPICE
Sbjct: 300 TRCLYEKNGKAKTFKIVDAGMNDLIRPALYQGYHEIIPVREHPSGS--CVTADVVGPICE 357

Query: 347 TGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMT 406
           +GDF+A NR +   R G+LL +   GAYG   S  YNSR +  E++V+G Q+++IR R +
Sbjct: 358 SGDFLAQNRDMPDVRQGELLAVLSAGAYGFSMSSNYNSRPMAEEVLVDGDQWNVIRSRQS 417

Query: 407 FQELIELDSIP 417
           +++LI  +SIP
Sbjct: 418 WEDLIRGESIP 428


>gi|73542823|ref|YP_297343.1| diaminopimelate decarboxylase [Ralstonia eutropha JMP134]
 gi|72120236|gb|AAZ62499.1| diaminopimelate decarboxylase [Ralstonia eutropha JMP134]
          Length = 419

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 178/414 (42%), Positives = 257/414 (62%), Gaps = 8/414 (1%)

Query: 1   MSAFKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYAL 59
           M+AF + + G+L AE V L ++A    TP Y YS  A+   Y  ++ A  G    V YA+
Sbjct: 1   MTAFFHRQDGALMAEQVPLAQIAAEFGTPAYVYSRAALTAAYQGYAAACKGRKAQVQYAM 60

Query: 60  KANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGI 119
           KANSN AV++  A LG+G DIVS GEL+R LAA     ++VFSGVGK   E++LAL   +
Sbjct: 61  KANSNLAVLQVFAKLGAGFDIVSGGELKRVLAAGGDPRKVVFSGVGKNAAEMELALAHDV 120

Query: 120 YCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIH 179
            CFNVES  EL  LN  A  +GK+A ++ R+NPD++A TH  ISTG K +KFGI    + 
Sbjct: 121 RCFNVESIPELDRLNAVAGQIGKRARVSLRINPDVDAKTHPYISTGLKGNKFGIAFEDVL 180

Query: 180 SLYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGG 239
             Y  A+ LP ++++G+D HIGSQI ++  + +A   + D+ + L   G  ++HIDVGGG
Sbjct: 181 PTYRAAAALPNIEVTGIDCHIGSQITEVAPYLEALDKVLDVVEALEREGIVLEHIDVGGG 240

Query: 240 LGIAYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKS 296
           LGI Y +D  PP  + +A+ +       G+   +++ EPGR LV + G+L+T+V  +K  
Sbjct: 241 LGITY-TDETPPDITGFATTLLDRVAARGHAHREVLFEPGRSLVGNAGVLLTQVEFLKPG 299

Query: 297 ADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRK 356
           A K F I+D AMND  RP +Y+AYH I  +    G    +  DIVGP+CE+GD++  +R 
Sbjct: 300 AAKNFCIVDAAMNDLARPAMYEAYHRIEPVKANGGS--QVVYDIVGPVCESGDWLGRDRA 357

Query: 357 IALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
           +A+ +PGDLL +   GAYG V S  YN+R    E+MV+G + H++R R   ++L
Sbjct: 358 LAV-QPGDLLAVMSAGAYGFVMSSNYNTRPRAAEVMVDGGKVHLVRERELVEDL 410


>gi|330815285|ref|YP_004358990.1| Diaminopimelate decarboxylase [Burkholderia gladioli BSR3]
 gi|327367678|gb|AEA59034.1| Diaminopimelate decarboxylase [Burkholderia gladioli BSR3]
          Length = 423

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 178/416 (42%), Positives = 261/416 (62%), Gaps = 6/416 (1%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
           F Y  G+LHAE +  +KLA    TP Y YS  A+   Y  ++ A +G    +  A+KANS
Sbjct: 6   FDYVNGTLHAEGIPTDKLAEHFDTPLYVYSRAALTAAYQAYAQACEGRRAAIHVAVKANS 65

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFN 123
           N  V+   A LG+G DIVS GEL R LAA   AE +VFSGVGK+ +E+ +ALQ+G+ CFN
Sbjct: 66  NLGVLNVFARLGAGFDIVSGGELARVLAAGGKAENVVFSGVGKSAEEMRVALQAGVKCFN 125

Query: 124 VESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA 183
           VES  EL  L++ A SLGK+AP++ RVNPD++  TH  ISTG K +KFG+   +  + Y 
Sbjct: 126 VESIPELDRLDEVAGSLGKRAPVSLRVNPDVDPKTHPYISTGLKANKFGVAFAEARASYR 185

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIA 243
            A+ LP +++ G+D HIGSQI ++  +  A   + DL +Q+ ++G  I H+D+GGGLGI 
Sbjct: 186 AAAALPNLQVVGIDCHIGSQITELSPYLDALDKVLDLVEQIEADGIPIHHVDIGGGLGIT 245

Query: 244 YHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           Y +D  PP+  ++ + +       G+ Q ++  EPGR L  + GIL+T+V  +K   +K 
Sbjct: 246 Y-ADETPPAIGEFVAALFARLDARGHGQREVYFEPGRSLTGNAGILLTRVEFLKPGEEKN 304

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           F I+D AMND  RP +Y+AYH I  +   +G    ++ D+VGP+CE+GD++   R +A+ 
Sbjct: 305 FAIVDAAMNDLARPAMYEAYHAIVPVKEQSGHASAVY-DVVGPVCESGDWLGRERTLAIA 363

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
            PG+LL I   GAYG V S  YN+R    E++V+G   +++RPR T + L   ++I
Sbjct: 364 -PGELLAIRSAGAYGFVMSSNYNTRARAAEVLVDGVNAYLVRPRETIESLFGDEAI 418


>gi|325141466|gb|EGC63940.1| diaminopimelate decarboxylase [Neisseria meningitidis 961-5945]
 gi|325199068|gb|ADY94524.1| diaminopimelate decarboxylase [Neisseria meningitidis G2136]
          Length = 414

 Score =  340 bits (871), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 177/400 (44%), Positives = 244/400 (61%), Gaps = 4/400 (1%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V   +LA    TP Y YS +A+ + +  +  AF  +  +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFEHYQTAFAELSPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK AP++ R+NPD++A TH  ISTG K +KFGI        Y +A+  P
Sbjct: 122 IDRIQKVAAHLGKTAPVSLRINPDVDAKTHPYISTGLKANKFGIAYADALEAYRHAAQQP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L   L + G  ++H+D+GGG+GI Y  D  
Sbjct: 182 NLKIIGIDCHIGSQLTDLSPLVEACERILILVDALAAEGIVLEHLDLGGGVGIVYQ-DED 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGSLLTRVEFVKYGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIE 369
           D MRP LYDAYH I  +     D   + A+IVGPICETGDF+  +R IA    GDLL I 
Sbjct: 301 DLMRPALYDAYHHIEAVETK--DIATLTANIVGPICETGDFLGKDRTIAC-EEGDLLLIR 357

Query: 370 KTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
             GAYGA  +  YN+R    E++VNG  + +IR R T ++
Sbjct: 358 SAGAYGASMASNYNARNRAAEVLVNGGGYKLIRRRETLEQ 397


>gi|254674321|emb|CBA10105.1| Diaminopimelate decarboxylase [Neisseria meningitidis alpha275]
          Length = 406

 Score =  340 bits (871), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 177/400 (44%), Positives = 244/400 (61%), Gaps = 4/400 (1%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V   +LA    TP Y YS +A+ + +  +  AF  +  +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFEHYQTAFAELSPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK AP++ R+NPD++A TH  ISTG K +KFGI        Y +A+  P
Sbjct: 122 IDRIQKVAAHLGKTAPVSLRINPDVDAKTHPYISTGLKANKFGIAYADALEAYRHAAQQP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L   L + G  ++H+D+GGG+GI Y  D  
Sbjct: 182 NLKIIGIDCHIGSQLTDLSPLVEACERILILVDALAAEGIVLEHLDLGGGVGIVYQ-DED 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGSLLTRVEFVKYGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIE 369
           D MRP LYDAYH I  +     D   + A+IVGPICETGDF+  +R IA    GDLL I 
Sbjct: 301 DLMRPALYDAYHHIEAVETK--DIATLTANIVGPICETGDFLGKDRTIAC-EEGDLLLIR 357

Query: 370 KTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
             GAYGA  +  YN+R    E++VNG  + +IR R T ++
Sbjct: 358 SAGAYGASMASNYNARNRAAEVLVNGGGYKLIRRRETLEQ 397


>gi|319409711|emb|CBY90016.1| diaminopimelate decarboxylase (DAP decarboxylase) [Neisseria
           meningitidis WUE 2594]
          Length = 414

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 175/400 (43%), Positives = 246/400 (61%), Gaps = 4/400 (1%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V   +LA    TP Y YS +A+ + +  +  AF  +  +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFENYQTAFAELSPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK AP++ RVNPD++A TH  ISTG K +KFGI        Y +A+  P
Sbjct: 122 IDRIQKVAARLGKTAPVSLRVNPDVDAKTHPYISTGLKANKFGIAYADALEAYRHAAQQP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L   L + G  ++H+D+GGG+GI Y  D  
Sbjct: 182 NLKIIGIDCHIGSQLTDLSPLIEACERILILVDALAAEGIVLEHLDLGGGVGIVYQ-DEN 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYARAVQKLMGTRRLKLILEPGRSLVGNAGALLTRVEFVKHGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIE 369
           D MRP LYDAYH I  +     +   + A+IVGPICETGDF+  +R IA    GDLL I 
Sbjct: 301 DLMRPALYDAYHHIEAV--ETKNIAPLTANIVGPICETGDFLGKDRTIAC-EEGDLLLIR 357

Query: 370 KTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
             GAYG+  +  YN+R    E++V+G+++ +IR R T ++
Sbjct: 358 SAGAYGSSMASNYNTRNRAAEVLVDGNEYRLIRRRETLEQ 397


>gi|308390075|gb|ADO32395.1| diaminopimelate decarboxylase [Neisseria meningitidis alpha710]
          Length = 414

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 180/400 (45%), Positives = 246/400 (61%), Gaps = 4/400 (1%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V   +LA    TP Y YS +A+ + +  +  AF  ++ +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVPYPRLAEEFGTPLYVYSKSALTEAFENYQTAFATLNPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS+GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSDGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK AP++ RVNPD++A TH  ISTG K +KFGI        Y +AS   
Sbjct: 122 IDRIQKVAARLGKVAPVSLRVNPDVDAKTHPYISTGLKANKFGIAYADALEAYRHASRQS 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L  QL   G  ++H+D+GGG+GI Y  D  
Sbjct: 182 HLKIVGIDCHIGSQLTDLSPLVEACERILVLVDQLADEGIVLEHLDLGGGVGIVYQ-DEN 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGSLLTRVEFVKYGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIE 369
           D MRP LYDAYH I   V P  +   + A+IVGPICETGDF+  +R IA    GDLL I 
Sbjct: 301 DLMRPALYDAYHHIE-AVEPK-NIAPLTANIVGPICETGDFLGKDRTIAC-EEGDLLLIR 357

Query: 370 KTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
             GAYGA  +  YN+R    E++VNG  + +IR R T ++
Sbjct: 358 SAGAYGASMASNYNARNRAAEVLVNGGGYKLIRRRETLEQ 397


>gi|161869233|ref|YP_001598399.1| diaminopimelate decarboxylase [Neisseria meningitidis 053442]
 gi|161594786|gb|ABX72446.1| diaminopimelate decarboxylase [Neisseria meningitidis 053442]
 gi|325127395|gb|EGC50328.1| diaminopimelate decarboxylase [Neisseria meningitidis N1568]
 gi|325143686|gb|EGC66005.1| diaminopimelate decarboxylase [Neisseria meningitidis M01-240013]
          Length = 414

 Score =  339 bits (870), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 178/400 (44%), Positives = 247/400 (61%), Gaps = 4/400 (1%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V   +LA    TP Y YS +A+ + +  +  AF  +  +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFEHYQTAFAELSPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK AP++ RVNPD++A TH  ISTG K +KFGI        Y +A+  P
Sbjct: 122 IDRIQKVAARLGKTAPVSLRVNPDVDAKTHPYISTGLKANKFGIAYADALEAYRHAAQQP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L   L + G  ++H+D+GGG+GI Y ++ +
Sbjct: 182 NLKIIGIDCHIGSQLTDLSPLVEACERILILVDALAAEGIVLEHLDLGGGVGIVYQNE-K 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGALLTRVEFVKYGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIE 369
           D MRP LYDAYH I   V P  +   + A+IVGPICETGDF+  +R IA    GDLL I 
Sbjct: 301 DLMRPALYDAYHHIE-AVEPK-NIAPLTANIVGPICETGDFLGKDRTIAC-EEGDLLLIR 357

Query: 370 KTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
             GAYGA  +  YN+R    E++VNG  + +IR R T ++
Sbjct: 358 SAGAYGASMASNYNARNRAAEVLVNGGGYKLIRRRETLEQ 397


>gi|240013231|ref|ZP_04720144.1| hypothetical protein NgonD_01030 [Neisseria gonorrhoeae DGI18]
 gi|240015677|ref|ZP_04722217.1| hypothetical protein NgonFA_00668 [Neisseria gonorrhoeae FA6140]
 gi|240120302|ref|ZP_04733264.1| hypothetical protein NgonPI_00705 [Neisseria gonorrhoeae PID24-1]
          Length = 406

 Score =  339 bits (869), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 177/404 (43%), Positives = 246/404 (60%), Gaps = 12/404 (2%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V+  +LA    TP Y YS +A+   +  +  AF  ++ +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVAYPRLAEEFGTPLYVYSQSALTGAFENYQTAFAALNPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK AP++ RVNPD++A TH  ISTG K +KFGI        Y +A+  P
Sbjct: 122 IDRIQKIAARLGKTAPVSLRVNPDVDAKTHPYISTGLKANKFGIAYADALEAYRHAAQQP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L   L + G  ++H+D+GGG+GI Y  D  
Sbjct: 182 NLKIIGIDCHIGSQLTDLSPLVEACERILILVDALAAEGIVLEHLDLGGGVGIVY-KDEG 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYARAVQKLMGTRRLKLILEPGRSLVGNAGALLTRVEFVKHGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYI----VNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDL 365
           D MRP LYDAYH I  +    + P      + A+IVGPICETGDF+  +R IA    GDL
Sbjct: 301 DLMRPALYDAYHHIEAVETKNIEP------LTANIVGPICETGDFLGKDRTIAC-EEGDL 353

Query: 366 LYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
           L I   GAYGA  +  YN+R    E++V+G  + +IR R T ++
Sbjct: 354 LLIRSAGAYGASMASNYNTRNRAAEVLVDGGGYKLIRRRETLEQ 397


>gi|188996497|ref|YP_001930748.1| diaminopimelate decarboxylase [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931564|gb|ACD66194.1| diaminopimelate decarboxylase [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 419

 Score =  338 bits (868), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 183/407 (44%), Positives = 245/407 (60%), Gaps = 3/407 (0%)

Query: 4   FKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANS 63
           F Y E  L+ E VS+  LA  V TPF+ YS  AI      +  AF   DT++CYALKANS
Sbjct: 8   FGYIEKKLYCEEVSILNLASKVGTPFFVYSKKAILDKINQYKEAFKDYDTLICYALKANS 67

Query: 64  NQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFN 123
           N +++K     G G DIVS GEL +A  A   + +IV++GVGKT  EI  A+   I  FN
Sbjct: 68  NLSLLKIFEENGVGADIVSGGELYKAKKAGFSSNKIVYAGVGKTDFEISYAISENILSFN 127

Query: 124 VESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYA 183
           VES  EL  +N+ A    KKA ++ RVNP+++  TH  ISTG K+ KFGI I Q    Y 
Sbjct: 128 VESFMELDVINEIAGKQEKKANVSIRVNPNVDPKTHPYISTGLKKSKFGIDIDQALDAYK 187

Query: 184 YASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIA 243
            A+ L  + + GV  HIGSQI  I  F +A + + DL  +L+  G  ++ ID+GGGLG+ 
Sbjct: 188 KAAKLENLNVVGVHCHIGSQIMDISVFREAAEKVVDLVFKLKKEGIELKFIDMGGGLGVK 247

Query: 244 YHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVI 303
           YH D  PP+  D A  I         K+I+EPGR L+A+ G L+TKVI +K   +K FVI
Sbjct: 248 YHPDDNPPTPKDLADAIIPVVKQTGLKLIIEPGRSLIAEAGALITKVIFLKDKQEKHFVI 307

Query: 304 LDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPG 363
           +D  MND +RP +Y+AYH   +++N       + ADIVGPICETGDF+AL+RKI     G
Sbjct: 308 VDSGMNDLVRPAMYNAYH---HVLNVQEKDEEMIADIVGPICETGDFLALDRKIGKVERG 364

Query: 364 DLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
           DLL I   GAYG+  S  YN R    E++V+GS F +I+ R  ++ +
Sbjct: 365 DLLAIMTAGAYGSSMSSNYNVRPRALEVLVDGSNFKVIKEREDYKHI 411


>gi|319639010|ref|ZP_07993768.1| diaminopimelate decarboxylase [Neisseria mucosa C102]
 gi|317399914|gb|EFV80577.1| diaminopimelate decarboxylase [Neisseria mucosa C102]
          Length = 406

 Score =  338 bits (868), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 177/400 (44%), Positives = 246/400 (61%), Gaps = 4/400 (1%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E++    LA    TP Y YS +A+ + +  +  AF  ++ +VCYA+KAN N ++IK
Sbjct: 2   TLSCEHIPYSHLAEEFGTPLYVYSKSALTEAFDNYQTAFAALNPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK AP++ RVNPD++A TH  ISTG K +KFGI        Y +AS+  
Sbjct: 122 IDRIQKVAARLGKVAPVSLRVNPDVDAKTHPYISTGLKANKFGIAYADALEAYRHASSQS 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L  QL   G  ++H+D+GGG+GI Y  D  
Sbjct: 182 HLKIVGIDCHIGSQLTDLSPLIEACERILALVDQLVEEGIVLEHLDLGGGVGIVYQ-DEN 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGSYAQAVQKLIGTRRLKLILEPGRSLVGNAGALLTRVEFVKHGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIE 369
           D MRP LYDAYH I  +     D   + A+IVGPICETGDF+  +R IA    GDLL I 
Sbjct: 301 DLMRPALYDAYHHIEAV--ETKDIEPLTANIVGPICETGDFLGKDRTIAC-EEGDLLLIR 357

Query: 370 KTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
             GAYG+  +  YN+R    E++V+GS + +IR R T ++
Sbjct: 358 SAGAYGSSMASNYNTRNRAAEVLVDGSGYKLIRQRETVEQ 397


>gi|325206881|gb|ADZ02334.1| diaminopimelate decarboxylase [Neisseria meningitidis M04-240196]
          Length = 406

 Score =  338 bits (867), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 176/404 (43%), Positives = 248/404 (61%), Gaps = 12/404 (2%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V   +LA    TP Y YS +A+ + +  +  AF  +  +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFEHYQTAFAELSPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELVRVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK AP++ R+NPD++A TH  ISTG K +KFGI        Y +A+  P
Sbjct: 122 IDRIQKVAARLGKTAPVSLRINPDVDAKTHPYISTGLKANKFGIAYADALEAYRHAAQQP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L   L + G  ++H+D+GGG+GI Y  D  
Sbjct: 182 NLKIIGIDCHIGSQLTDLSPLIEACERILILVDALAAEGIVLEHLDLGGGVGIVY-KDES 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGSLLTRVEFVKHGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYI----VNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDL 365
           D MRP LYDAYH I  +    ++P      + A+IVGPICETGDF+  +R IA    GDL
Sbjct: 301 DLMRPALYDAYHHIEAVETKNISP------LTANIVGPICETGDFLGKDRTIAC-EEGDL 353

Query: 366 LYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
           L I   GAYGA  +  YN+R    E++V+G+++ +IR R T ++
Sbjct: 354 LLIRSAGAYGASMASNYNARNRAAEVLVDGNEYRLIRRRETLEQ 397


>gi|254804203|ref|YP_003082424.1| Diaminopimelate decarboxylase [Neisseria meningitidis alpha14]
 gi|254667745|emb|CBA03656.1| Diaminopimelate decarboxylase [Neisseria meningitidis alpha14]
          Length = 406

 Score =  338 bits (867), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 175/400 (43%), Positives = 248/400 (62%), Gaps = 4/400 (1%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V   +LA    TP Y YS +A+ + +  +  AF  ++ +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFEHYQTAFAALNPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK A ++ RVNPD++A TH  ISTG K +KFGI        Y +A+  P
Sbjct: 122 IDRIQKVAARLGKTASVSLRVNPDVDAKTHPYISTGLKANKFGIAYADALEAYRHAAQQP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L   L + G  ++H+D+GGG+GI Y ++ +
Sbjct: 182 NLKIIGIDCHIGSQLTDLSPLVEACERILILVDALAAEGIVLEHLDLGGGVGIVYQNE-K 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGALLTRVEFVKYGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIE 369
           D MRP LYDAYH I  +     D   + A+IVGPICETGDF+  +R IA    GDLL I 
Sbjct: 301 DLMRPALYDAYHHIEAVETK--DIEPLTANIVGPICETGDFLGKDRTIAC-EEGDLLLIR 357

Query: 370 KTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
             GAYGA  +  YN+R    E++V+G+++ +IR R T ++
Sbjct: 358 SAGAYGASMASNYNARNRAAEVLVDGNEYRLIRLRETLEQ 397


>gi|325294479|ref|YP_004280993.1| diaminopimelate decarboxylase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064927|gb|ADY72934.1| diaminopimelate decarboxylase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 420

 Score =  338 bits (867), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 182/414 (43%), Positives = 252/414 (60%), Gaps = 3/414 (0%)

Query: 4   FKYFE-GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKAN 62
           F Y+E G L  + +S+E+LA    TP Y YS +A+E  +  F +AF  ++ + C+A+K+N
Sbjct: 8   FIYYENGKLKIDGISVEELARKYGTPLYVYSQSALEHWFKEFDSAFSSIEHITCFAVKSN 67

Query: 63  SNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCF 122
           SN +V+K L  LG+G D VS GE+ RAL A +  ++IVF+GVGK IDEI+  L+ GI  F
Sbjct: 68  SNISVLKVLKELGAGADTVSMGEIFRALTAGIDPKKIVFAGVGKRIDEIEYGLEKGILMF 127

Query: 123 NVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLY 182
           NVESESEL  +N+ A  LGK APIAFRVNPD+N  TH  ISTG K  KFGI       LY
Sbjct: 128 NVESESELYAINRVAEKLGKVAPIAFRVNPDVNPKTHPYISTGLKTSKFGIAYEGAIELY 187

Query: 183 AYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGI 242
             A  L  +   G+  HIGSQI  +  F +A + ++++ ++L S G  I++ D GGGLGI
Sbjct: 188 KKAKNLKNINPIGIHFHIGSQITDVSVFGEAARKIKEIVKELYSVGIEIEYFDAGGGLGI 247

Query: 243 AYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFV 302
           +Y+ +  P  +   A  I     +L CK+ILEPGR L  + GIL+++VI  K+  +K F 
Sbjct: 248 SYNPNEPPVPARALADEIIPIIKDLGCKLILEPGRRLAGNAGILLSQVIYKKERHEKLFY 307

Query: 303 ILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRP 362
           I+D  MND  RP+LY AYH I       G+     AD+VGPICETGD +A +R++     
Sbjct: 308 IVDAGMNDLARPSLYKAYHHIVPASKKEGNLK--KADVVGPICETGDILAEDRELPPLNE 365

Query: 363 GDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELDSI 416
           GD++ +   GAYG   +  YNSR    E++    +  IIR R T  +LI  + I
Sbjct: 366 GDIIAVLSAGAYGFTMASNYNSRPRPAEVIAKEGRAEIIRQRETLGDLISKEEI 419


>gi|313669199|ref|YP_004049483.1| diaminopimelate decarboxylase [Neisseria lactamica ST-640]
 gi|313006661|emb|CBN88127.1| diaminopimelate decarboxylase [Neisseria lactamica 020-06]
          Length = 406

 Score =  338 bits (867), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 177/400 (44%), Positives = 245/400 (61%), Gaps = 4/400 (1%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V   +LA    TP Y YS +A+ + +  +  AF  ++ +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFEHYQTAFAALNPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK A ++ RVNPD++A TH  ISTG K +KFGI        Y +A+  P
Sbjct: 122 IDRIQKVAARLGKTASVSLRVNPDVDAKTHPYISTGLKANKFGIAYADALEAYRHAAQQP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L   L + G  ++H+D+GGG+GI Y  D  
Sbjct: 182 NLKIIGIDCHIGSQLTDLSPLVEACERILILVDALAAEGIVLEHLDLGGGVGIVYR-DEN 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGSLLTRVEFVKYGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIE 369
           D MRP LYDAYH I  +     D   + A+IVGPICETGDF+  +R IA    GDLL I 
Sbjct: 301 DLMRPALYDAYHHIESVETK--DIEPLTANIVGPICETGDFLGKDRTIAC-EEGDLLLIR 357

Query: 370 KTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
             GAYGA  +  YN+R    E++V+GS + +IR R T ++
Sbjct: 358 SAGAYGASMASNYNARNRAAEVLVDGSGYKLIRRRETLEQ 397


>gi|78357021|ref|YP_388470.1| diaminopimelate decarboxylase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219426|gb|ABB38775.1| diaminopimelate decarboxylase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 415

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 176/411 (42%), Positives = 254/411 (61%), Gaps = 3/411 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           M  F Y +  L  ENV++++L     TP Y YS    ++++  F +AF  +  + CY++K
Sbjct: 1   MHHFTYRDNELFVENVAVQELVATYGTPLYIYSKATFQRHFTAFDSAFGALPHLTCYSVK 60

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           A SN  +++ L  +G+G+DIVS GEL RAL A +   +IV+SGVGKT  EI  AL++GI 
Sbjct: 61  ACSNMHILRFLGKMGAGMDIVSGGELFRALRAGIQPAKIVYSGVGKTRTEILQALEAGIL 120

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
            FNVES  EL+ +++ A   G  A +A R+NPD++ +TH  ISTG KE+KFG+ + Q ++
Sbjct: 121 MFNVESMGELEKISEVANQTGHTANVALRINPDVDPHTHPYISTGLKENKFGLDMEQSYA 180

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y  A  LP +   G+D HIGSQ+  +  F +A + +    ++L S G  I +ID+GGGL
Sbjct: 181 AYMRAMELPAITPMGIDCHIGSQLTSLSPFREAVEKILLFREKLCSAGLCIDYIDLGGGL 240

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           GI Y ++  PP   ++  L+      L   +ILEPGR +  + GILVTKV   KK+A K 
Sbjct: 241 GIPYDTE-EPPHPQEFGKLLTDMLSGLGITLILEPGRVIAGNAGILVTKVQYTKKTATKE 299

Query: 301 FVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALP 360
           FVI+D AMND +RP+LY ++H I   V+P G   H   D+VGPICE+GDF+A +R +   
Sbjct: 300 FVIVDAAMNDLIRPSLYQSHHHIAE-VSPRGRAKHT-VDVVGPICESGDFLARDRLMPAV 357

Query: 361 RPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELI 411
            P +LL +   GAYG   S  YNSR    E++V G   H+IR R T+++LI
Sbjct: 358 EPRELLAVFSAGAYGFTMSSQYNSRPRAAEVLVRGDTAHLIRRRETYEDLI 408


>gi|59802399|ref|YP_209111.1| hypothetical protein NGO2098 [Neisseria gonorrhoeae FA 1090]
 gi|239998049|ref|ZP_04717973.1| hypothetical protein Ngon3_00993 [Neisseria gonorrhoeae 35/02]
 gi|240079813|ref|ZP_04724356.1| hypothetical protein NgonF_00641 [Neisseria gonorrhoeae FA19]
 gi|240114768|ref|ZP_04728830.1| hypothetical protein NgonPID1_00673 [Neisseria gonorrhoeae PID18]
 gi|240116968|ref|ZP_04731030.1| hypothetical protein NgonPID_00658 [Neisseria gonorrhoeae PID1]
 gi|240122606|ref|ZP_04735562.1| hypothetical protein NgonP_01441 [Neisseria gonorrhoeae PID332]
 gi|240124794|ref|ZP_04737680.1| hypothetical protein NgonSK_00970 [Neisseria gonorrhoeae SK-92-679]
 gi|240127312|ref|ZP_04739973.1| hypothetical protein NgonS_01425 [Neisseria gonorrhoeae SK-93-1035]
 gi|260441419|ref|ZP_05795235.1| hypothetical protein NgonDG_10117 [Neisseria gonorrhoeae DGI2]
 gi|268593898|ref|ZP_06128065.1| diaminopimelate decarboxylase [Neisseria gonorrhoeae 35/02]
 gi|268595955|ref|ZP_06130122.1| diaminopimelate decarboxylase [Neisseria gonorrhoeae FA19]
 gi|268600416|ref|ZP_06134583.1| diaminopimelate decarboxylase [Neisseria gonorrhoeae PID18]
 gi|268602648|ref|ZP_06136815.1| diaminopimelate decarboxylase [Neisseria gonorrhoeae PID1]
 gi|268681197|ref|ZP_06148059.1| diaminopimelate decarboxylase [Neisseria gonorrhoeae PID332]
 gi|268683367|ref|ZP_06150229.1| diaminopimelate decarboxylase [Neisseria gonorrhoeae SK-92-679]
 gi|268685676|ref|ZP_06152538.1| diaminopimelate decarboxylase [Neisseria gonorrhoeae SK-93-1035]
 gi|291044781|ref|ZP_06570490.1| diaminopimelate decarboxylase [Neisseria gonorrhoeae DGI2]
 gi|293397871|ref|ZP_06642077.1| diaminopimelate decarboxylase [Neisseria gonorrhoeae F62]
 gi|59719294|gb|AAW90699.1| putative diaminopimelate decarboxylase [Neisseria gonorrhoeae FA
           1090]
 gi|268547287|gb|EEZ42705.1| diaminopimelate decarboxylase [Neisseria gonorrhoeae 35/02]
 gi|268549743|gb|EEZ44762.1| diaminopimelate decarboxylase [Neisseria gonorrhoeae FA19]
 gi|268584547|gb|EEZ49223.1| diaminopimelate decarboxylase [Neisseria gonorrhoeae PID18]
 gi|268586779|gb|EEZ51455.1| diaminopimelate decarboxylase [Neisseria gonorrhoeae PID1]
 gi|268621481|gb|EEZ53881.1| diaminopimelate decarboxylase [Neisseria gonorrhoeae PID332]
 gi|268623651|gb|EEZ56051.1| diaminopimelate decarboxylase [Neisseria gonorrhoeae SK-92-679]
 gi|268625960|gb|EEZ58360.1| diaminopimelate decarboxylase [Neisseria gonorrhoeae SK-93-1035]
 gi|291011675|gb|EFE03671.1| diaminopimelate decarboxylase [Neisseria gonorrhoeae DGI2]
 gi|291611817|gb|EFF40886.1| diaminopimelate decarboxylase [Neisseria gonorrhoeae F62]
 gi|317165492|gb|ADV09033.1| hypothetical protein NGTW08_2082 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 406

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 177/404 (43%), Positives = 245/404 (60%), Gaps = 12/404 (2%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V   +LA    TP Y YS +A+   +  +  AF  ++ +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVPYPRLAEEFGTPLYVYSQSALTGAFENYQTAFAALNPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK AP++ RVNPD++A TH  ISTG K +KFGI        Y +A+  P
Sbjct: 122 IDRIQKIAARLGKTAPVSLRVNPDVDAKTHPYISTGLKANKFGIAYADALEAYRHAAQQP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L   L + G  ++H+D+GGG+GI Y  D  
Sbjct: 182 NLKIIGIDCHIGSQLTDLSPLVEACERILILVDALAAEGIVLEHLDLGGGVGIVY-KDEG 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYARAVQKLMGTRRLKLILEPGRSLVGNAGALLTRVEFVKHGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYI----VNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDL 365
           D MRP LYDAYH I  +    + P      + A+IVGPICETGDF+  +R IA    GDL
Sbjct: 301 DLMRPALYDAYHHIEAVETKNIEP------LTANIVGPICETGDFLGKDRTIAC-EEGDL 353

Query: 366 LYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
           L I   GAYGA  +  YN+R    E++V+G  + +IR R T ++
Sbjct: 354 LLIRSAGAYGASMASNYNTRNRAAEVLVDGGGYKLIRRRETLEQ 397


>gi|261365975|ref|ZP_05978858.1| diaminopimelate decarboxylase [Neisseria mucosa ATCC 25996]
 gi|288565436|gb|EFC86996.1| diaminopimelate decarboxylase [Neisseria mucosa ATCC 25996]
          Length = 406

 Score =  337 bits (865), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 178/404 (44%), Positives = 246/404 (60%), Gaps = 12/404 (2%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +LH E V   +LA    TP Y YS +A+ + +  +  AF  +  +VCYA+KAN N ++IK
Sbjct: 2   TLHCEQVPYSRLAEEFGTPLYVYSQSALTEAFENYQTAFAALSPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALHAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK A ++ RVNPD++A TH  ISTG K +KFGI        Y +A+   
Sbjct: 122 IDRIQKVAERLGKTASVSLRVNPDVDAKTHPYISTGLKANKFGIAYADALEAYRHAARQS 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L  QL   G  ++H+D+GGG+GI Y  D  
Sbjct: 182 HLKIIGIDCHIGSQLTDLSPLIEACERILILVDQLADEGIVLEHLDLGGGVGIVYQ-DET 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGSLLTRVEFVKHGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYI----VNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDL 365
           D MRP LYDAYH I  +    + P      + A+IVGPICETGDF+  +R IA    GDL
Sbjct: 301 DLMRPALYDAYHHIEAVEPKNIPP------LTANIVGPICETGDFLGKDRTIAC-EEGDL 353

Query: 366 LYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
           L I   GAYGA  +  YN+R    E++V+GS++ +IR R T ++
Sbjct: 354 LVIRSAGAYGASMASNYNTRNRAAEVLVDGSEYRLIRRRETLEQ 397


>gi|261393306|emb|CAX50938.1| diaminopimelate decarboxylase (DAP decarboxylase) [Neisseria
           meningitidis 8013]
          Length = 406

 Score =  337 bits (865), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 176/400 (44%), Positives = 245/400 (61%), Gaps = 4/400 (1%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V   +LA    TP Y YS +A+ + +  +  AF  ++ +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFEHYQTAFAALNPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK A ++ RVNPD++A TH  ISTG K +KFGI        Y  A+  P
Sbjct: 122 IDRIQKVAARLGKTASVSLRVNPDVDAKTHPYISTGLKANKFGIAYADALEAYRRAAQQP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L   L + G  ++H+D+GGG+GI Y  D  
Sbjct: 182 NLKIIGIDCHIGSQLTDLSPLIEACERILILVDALAAEGIVLEHLDLGGGVGIVYQ-DED 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYAQAVQKLMGTRRLKLILEPGRSLVGNAGSLLTRVEFVKYGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIE 369
           D MRP LYDAYH I  +     D   + A+IVGPICETGDF+  +R IA    GDLL I 
Sbjct: 301 DLMRPALYDAYHHIEAVETK--DIEPLTANIVGPICETGDFLGKDRTIAC-EEGDLLLIR 357

Query: 370 KTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
             GAYGA  +  YN+R    E++V+G+++ +IR R T ++
Sbjct: 358 SAGAYGASMASNYNARNRAAEVLVDGNEYRLIRRRETLEQ 397


>gi|261378590|ref|ZP_05983163.1| diaminopimelate decarboxylase [Neisseria cinerea ATCC 14685]
 gi|269144922|gb|EEZ71340.1| diaminopimelate decarboxylase [Neisseria cinerea ATCC 14685]
          Length = 406

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 177/400 (44%), Positives = 244/400 (61%), Gaps = 4/400 (1%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V    LA    TP Y YS +A+ + +  +  AF  +  +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVPYPHLAEEFGTPLYVYSQSALTEAFEHYQTAFAELSPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  L K AP++ RVNPD++A TH  ISTG K +KFGI        Y +A+  P
Sbjct: 122 IDRIQKVAARLSKTAPVSLRVNPDVDAKTHPYISTGLKANKFGIAYADALEAYRHAAQQP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L   L + G  ++H+D+GGG+GI Y  +H 
Sbjct: 182 NLKIIGIDCHIGSQLTDLSPLVEACERILILVDALAAEGIVLEHLDLGGGVGIVYQDEHV 241

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
           P   + YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 242 PDLGA-YAQAVQKLIGTRRLKLILEPGRSLVGNAGSLLTRVEFVKHGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIE 369
           D MRP LYDAYH I  +     D   + A+IVGPICETGDF+  +R IA    GDLL I 
Sbjct: 301 DLMRPALYDAYHHIEAVETK--DIEPLTANIVGPICETGDFLGKDRTIAC-EEGDLLLIR 357

Query: 370 KTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
             GAYGA  +  YN+R    E++VNG  + +IR R T ++
Sbjct: 358 SAGAYGASMASNYNARNRAAEVLVNGGGYKLIRRRETLEQ 397


>gi|309378898|emb|CBX22485.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 406

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 177/404 (43%), Positives = 246/404 (60%), Gaps = 12/404 (2%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V   +LA    TP Y YS +A+ K +  +  AF  ++ +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVPYPRLAEEFGTPLYVYSQSALTKAFEHYQTAFAALNPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK A ++ RVNPD++A TH  ISTG K +KFGI        Y +A+  P
Sbjct: 122 IDRIQKVAARLGKTASVSLRVNPDVDAKTHPYISTGLKANKFGIAYADALEAYRHAAQQP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L   L + G  ++H+D+GGG+GI Y  D  
Sbjct: 182 NLKIIGIDCHIGSQLTDLSPLIEACERILILVDALAAEGIVLEHLDLGGGVGIVY-KDES 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGALLTRVEFVKHGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYI----VNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDL 365
           D MRP LYDAYH I  +    ++P      + A+IVGPICETGDF+  +R IA    GDL
Sbjct: 301 DLMRPALYDAYHHIEAVETKNISP------LTANIVGPICETGDFLGKDRTIAC-EEGDL 353

Query: 366 LYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
           L I   GAYGA  +  YN+R    E++V+G  + +IR R T ++
Sbjct: 354 LLIRSAGAYGASMASNYNARNRAAEVLVDGGGYRLIRRRETLEQ 397


>gi|261401778|ref|ZP_05987903.1| diaminopimelate decarboxylase [Neisseria lactamica ATCC 23970]
 gi|269208091|gb|EEZ74546.1| diaminopimelate decarboxylase [Neisseria lactamica ATCC 23970]
          Length = 406

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 175/400 (43%), Positives = 245/400 (61%), Gaps = 4/400 (1%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V   +LA    TP Y YS +A+ + +  +  AF  ++ +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFEHYQTAFAALNPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK A ++ RVNPD++A TH  ISTG K +KFGI        Y +A+  P
Sbjct: 122 IDRIQKVAARLGKTASVSLRVNPDVDAKTHPYISTGLKANKFGIAYADALEAYRHAAQQP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L   L + G  ++H+D+GGG+GI Y  D +
Sbjct: 182 NLKIVGIDCHIGSQLTDLSPLVEACERILILVDSLAAEGIVLEHLDLGGGVGIVYQ-DEK 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGSLLTRVEFVKHGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIE 369
           D MRP LY+AYH I  +     D   + A+IVGPICETGDF+  +R IA    GDLL I 
Sbjct: 301 DLMRPALYNAYHHIEAVETK--DIEPLTANIVGPICETGDFLGKDRTIAC-EEGDLLLIR 357

Query: 370 KTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
             GAYGA  +  YN+R    E++V+G  + +IR R T ++
Sbjct: 358 SAGAYGASMASNYNARNRAAEVLVDGGGYRLIRRRETLEQ 397


>gi|295677895|ref|YP_003606419.1| diaminopimelate decarboxylase [Burkholderia sp. CCGE1002]
 gi|295437738|gb|ADG16908.1| diaminopimelate decarboxylase [Burkholderia sp. CCGE1002]
          Length = 420

 Score =  337 bits (863), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 183/415 (44%), Positives = 250/415 (60%), Gaps = 13/415 (3%)

Query: 2   SAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKA 61
           S F Y +G LHAE VS   LA    TP Y YS  A+   +  ++ A  G    V  A+KA
Sbjct: 4   SVFDYVDGVLHAEGVSAVSLAEQFGTPLYVYSRAALTAAWNAYAGACAGRRASVHVAVKA 63

Query: 62  NSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYC 121
           NSN AV+   A LG+G DIVS GEL R LAA   AE  VFSGVGK   E+  AL +G+ C
Sbjct: 64  NSNLAVLNVFARLGAGFDIVSGGELARVLAAGGKAENTVFSGVGKQASEMRDALVAGVKC 123

Query: 122 FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSL 181
           FNVES  EL  LN  A  +GKKAP++ RVNPD++A TH  ISTG K +KFG+      + 
Sbjct: 124 FNVESIPELDRLNAVAGEMGKKAPVSLRVNPDVDAKTHPYISTGLKTNKFGVAFEDARAT 183

Query: 182 YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG 241
           Y  A+ +  +++ G+D HIGSQI ++  +  A   + +L +Q+  +G +I+HIDVGGGLG
Sbjct: 184 YQAAAAMANLEVVGIDCHIGSQITEVAPYLDAIDKVLELVEQIEQDGVSIRHIDVGGGLG 243

Query: 242 IAYHSDHRPPSSSDYASLIHQYF---GNLQCKIILEPGRFLVADVGILVTKVISIKKSAD 298
           I Y  D  PP   ++   +       G+   ++  EPGR LV + G+L+T++  +K   D
Sbjct: 244 ITY-DDETPPEIGEFVRTVLDRIEARGHGHREVYFEPGRSLVGNAGVLLTRLEFLKPGED 302

Query: 299 KTFVILDVAMNDFMRPTLYDAYHEINYIVN---PAGDRLHIHADIVGPICETGDFIALNR 355
           K F I+D AM D  RP +YDAYH I  +V    PA    H++ D+VGP+CE+GD++   R
Sbjct: 303 KNFAIVDAAMTDLARPAMYDAYHAIEPVVKRDVPA----HVY-DVVGPVCESGDWLGRER 357

Query: 356 KIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQEL 410
            +A+  PGDLL I   GAYG V S  YN+R    E+MV+G+Q H++R R   ++L
Sbjct: 358 LLAV-EPGDLLAIRSAGAYGFVMSSNYNTRARAAEVMVDGTQAHVVRAREEVKQL 411


>gi|194100049|ref|YP_002003189.1| LysA [Neisseria gonorrhoeae NCCP11945]
 gi|193935339|gb|ACF31163.1| LysA [Neisseria gonorrhoeae NCCP11945]
          Length = 406

 Score =  337 bits (863), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 176/404 (43%), Positives = 246/404 (60%), Gaps = 12/404 (2%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V+  +LA    TP Y YS +A+   +  +  AF  ++ +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVAYPRLAEEFGTPLYVYSQSALTGAFENYQTAFAALNPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK AP++ RVNPD++A TH  ISTG K +KFGI        Y +A+  P
Sbjct: 122 IDRIQKIAARLGKTAPVSLRVNPDVDAKTHPYISTGLKANKFGIAYADALEAYRHAAQQP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L   L + G  ++H+D+GGG+GI Y  D  
Sbjct: 182 NLKIIGIDCHIGSQLTDLSPLVEACERILILVDALAAEGIVLEHLDLGGGVGIVY-KDEG 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYARAVQKLMGTRRLKLILEPGRSLVGNAGALLTRVEFVKHGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYI----VNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDL 365
           D MRP LYDAYH I  +    + P      + A+IVGPICETGDF+  +R IA    GDL
Sbjct: 301 DLMRPALYDAYHHIEAVETKNIEP------LTANIVGPICETGDFLGKDRTIAC-EEGDL 353

Query: 366 LYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
           L +   GAYGA  +  YN+R    E++V+G  + +IR R T ++
Sbjct: 354 LDLRSAGAYGASMASNYNTRNRAAEVLVDGGGYKLIRRRETLEQ 397


>gi|296314185|ref|ZP_06864126.1| diaminopimelate decarboxylase [Neisseria polysaccharea ATCC 43768]
 gi|296839164|gb|EFH23102.1| diaminopimelate decarboxylase [Neisseria polysaccharea ATCC 43768]
          Length = 406

 Score =  337 bits (863), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 176/400 (44%), Positives = 244/400 (61%), Gaps = 4/400 (1%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V   +LA    TP Y YS +A+ + +  +  AF  ++ +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFEHYQTAFAALNPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK A ++ RVNPD++A TH  ISTG K +KFGI        Y +A+  P
Sbjct: 122 IDRIQKVAARLGKTASVSLRVNPDVDAKTHPYISTGLKANKFGIAYADALEAYRHAAQQP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L   L + G  ++H+D+GGG+GI Y  D  
Sbjct: 182 NLKIIGIDCHIGSQLTDLSPLVEACERILILVDALAAEGIVLEHLDLGGGVGIVYQ-DEN 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGSLLTRVEFVKYGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIE 369
           D MRP LYDAYH I  +     D   + A+IVGPICETGDF+  +R IA    GDLL I 
Sbjct: 301 DLMRPALYDAYHHIEAVETK--DIEPLTANIVGPICETGDFLGKDRTIAC-EEGDLLLIR 357

Query: 370 KTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
             GAYGA  +  YN+R    E++V+G  + +IR R T ++
Sbjct: 358 SAGAYGASMASNYNARNRAAEVLVDGDGYKLIRRRETLEQ 397


>gi|325135569|gb|EGC58187.1| diaminopimelate decarboxylase [Neisseria meningitidis M0579]
 gi|325201385|gb|ADY96839.1| diaminopimelate decarboxylase [Neisseria meningitidis M01-240149]
 gi|325207366|gb|ADZ02818.1| diaminopimelate decarboxylase [Neisseria meningitidis NZ-05/33]
          Length = 414

 Score =  337 bits (863), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 176/400 (44%), Positives = 244/400 (61%), Gaps = 4/400 (1%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V   +LA    TP Y YS +A+ + +  +  AF  +  +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFEHYQTAFAELSPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK   EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDATKTIFSGVGKNEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK A ++ RVNPD++A TH  ISTG K +KFGI        Y +A+  P
Sbjct: 122 IDRIQKVAARLGKTASVSLRVNPDVDAKTHPYISTGLKANKFGIAYADALEAYRHAAQQP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L   L + G  ++H+D+GGG+GI Y  D  
Sbjct: 182 NLKIIGIDCHIGSQLTDLSPLVEACERILILVDALAAEGIVLEHLDLGGGVGIVYQ-DEN 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGSLLTRVEFVKYGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIE 369
           D MRP LYDAYH I  +     D   + A+IVGPICETGDF+  +R IA    GDLL I 
Sbjct: 301 DLMRPALYDAYHHIEAV--ETKDIEPLTANIVGPICETGDFLGKDRTIAC-EEGDLLLIR 357

Query: 370 KTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
             GAYGA  +  YN+R    E++V+G+++ +IR R T ++
Sbjct: 358 SAGAYGASMASNYNARNRAAEVLVDGNEYRLIRRRETLEQ 397


>gi|325133435|gb|EGC56099.1| diaminopimelate decarboxylase [Neisseria meningitidis M13399]
          Length = 406

 Score =  337 bits (863), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 177/400 (44%), Positives = 245/400 (61%), Gaps = 4/400 (1%)

Query: 10  SLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIK 69
           +L  E V   +LA    TP Y YS +A+ + +  +  AF  +  +VCYA+KAN N ++IK
Sbjct: 2   TLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFEHYQTAFAELSPLVCYAVKANGNLSIIK 61

Query: 70  TLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESE 129
             A LGSG DIVS GEL R LAA   A + +FSGVGK+  EI+ AL +G+ CFN+ES  E
Sbjct: 62  HFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIPE 121

Query: 130 LKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLP 189
           +  + + A  LGK A ++ RVNPD++A TH  ISTG K +KFGI        Y + +  P
Sbjct: 122 IDRIQKVAARLGKTASVSLRVNPDVDAKTHPYISTGLKANKFGIAYADALKAYRHVAQQP 181

Query: 190 GVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHR 249
            +KI G+D HIGSQ+  +    +A + +  L  QL   G  ++H+D+GGG+GI Y  D  
Sbjct: 182 NLKIIGIDCHIGSQLTDLSPLVEACERILVLVDQLADEGIVLEHLDLGGGVGIVYQ-DEN 240

Query: 250 PPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMN 309
            P    YA  + +  G  + K+ILEPGR LV + G L+T+V  +K   +K FV++D AMN
Sbjct: 241 VPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGALLTRVEFVKYGEEKNFVMVDAAMN 300

Query: 310 DFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIE 369
           D MRP LYDAYH I   V P  +   + A+IVGPICETGDF+  +R IA    GDLL I 
Sbjct: 301 DLMRPALYDAYHHIE-AVEPK-NIAPLTANIVGPICETGDFLGKDRTIAC-EEGDLLLIR 357

Query: 370 KTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQE 409
             GAYGA  +  YN+R    E++V+G+++ +IR R T ++
Sbjct: 358 SAGAYGASMASNYNARNRAAEVLVDGNEYRLIRRRETLEQ 397


>gi|330994277|ref|ZP_08318205.1| Diaminopimelate decarboxylase [Gluconacetobacter sp. SXCC-1]
 gi|329758744|gb|EGG75260.1| Diaminopimelate decarboxylase [Gluconacetobacter sp. SXCC-1]
          Length = 460

 Score =  337 bits (863), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 181/429 (42%), Positives = 263/429 (61%), Gaps = 21/429 (4%)

Query: 10  SLHA------ENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAF--DGMDTMVCYALKA 61
           S+HA      E V L  +A  + TP +  S   +   Y   + AF   G    + +A+KA
Sbjct: 30  SMHAMDGLVLEEVPLNTIADALGTPTWVMSAGTLRARYQRLATAFRATGRPVSIHFAVKA 89

Query: 62  NSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYC 121
           N + AV++ LA  G+G D+VS GEL+RAL A +PA RIVFSGVGKT+ E+  AL++GI  
Sbjct: 90  NDHLAVLRVLAAQGAGADVVSGGELQRALMAGIPAARIVFSGVGKTMPEMQAALRAGIAQ 149

Query: 122 FNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSL 181
            NVES  EL+ L+  A + G +AP+A R+NPD++A TH KI+TG   +KFGIP ++   L
Sbjct: 150 INVESAEELELLSTVAQAEGLEAPVALRINPDVDAGTHAKITTGLATNKFGIPYNRAVDL 209

Query: 182 YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLG 241
           YA+A+TLPG++  G+ MHIGSQI +++ +  A+  L DL + +R+ G +I+ +D GGGLG
Sbjct: 210 YAHAATLPGIRPVGLAMHIGSQIVRMQPYRTAYARLADLVRAIRARGLHIEALDCGGGLG 269

Query: 242 IAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSAD--K 299
           I+Y  D    +    A+ IH   G L  ++ +EPGR+L    G+L++ VI  K+  +   
Sbjct: 270 ISYR-DETEGAPEALAAAIHGELGGLGTRLAIEPGRWLAGPAGLLLSTVILRKRGYEGMP 328

Query: 300 TFVILDVAMNDFMRPTLYDAYHEINYI-----VNPAGDRLHIHADIVGPICETGDFIALN 354
            F++LD AMND MRP+LYDA+H I  +     V PA +++H    +VGP+CE+GD    +
Sbjct: 329 PFLVLDAAMNDLMRPSLYDAWHGIIPLSARDAVAPA-EQVH----VVGPVCESGDTFGHD 383

Query: 355 RKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELIELD 414
           R +     G  L +   GAYG V S TYN+R L  ++MV+G  + +IR R    EL   D
Sbjct: 384 RTLPHMDAGARLALLDCGAYGMVMSSTYNARPLAAQVMVDGGHWAVIRERQAITELWAAD 443

Query: 415 SIPAWLQKT 423
           SIP W+ +T
Sbjct: 444 SIPPWVDET 452


>gi|332977415|gb|EGK14192.1| diaminopimelate decarboxylase [Psychrobacter sp. 1501(2011)]
          Length = 447

 Score =  337 bits (863), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 181/416 (43%), Positives = 254/416 (61%), Gaps = 3/416 (0%)

Query: 1   MSAFKYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALK 60
           +    Y +G L  E VS ++L     TP Y YS  AI + Y  +S++F  +D  VCYA+K
Sbjct: 29  LPTLSYQQGVLSIEAVSAQQLVEQYGTPLYVYSKKAILEAYQAYSDSFAEIDHQVCYAVK 88

Query: 61  ANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIY 120
           ANSN AV+K LA  G+G D+VS GEL R LA     ++IVFSGVGKT+ E+  ALQ+GI 
Sbjct: 89  ANSNLAVLKVLAEAGAGFDLVSSGELARVLAVGADPKKIVFSGVGKTVSEMKAALQAGIG 148

Query: 121 CFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHS 180
           CFNVES SEL  LN+ A  +  KAPI+ RVNPD++A TH  ISTG K++KFGI       
Sbjct: 149 CFNVESLSELDRLNEVAAEMQVKAPISIRVNPDVDAKTHPYISTGLKDNKFGISHDVAVE 208

Query: 181 LYAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGL 240
            Y +A++L  ++I G+D HIGSQ+ +I+ F  A   + +L   L+  G  ++HID+GGGL
Sbjct: 209 AYKHANSLANLQIVGIDCHIGSQLTEIDPFVAALDKVCELIDALKQAGIELEHIDLGGGL 268

Query: 241 GIAYHSDHRPPSSSDYASLIHQYFGNLQCKIILEPGRFLVADVGILVTKVISIKKSADKT 300
           G+ Y  D +    S++A+ +      L  K+  EPGR +VA+ G+L+T+V  +K +  K 
Sbjct: 269 GVIY-IDEQVAEVSEFANALLPKLKQLGLKVFFEPGRSIVANAGVLLTQVEV