PSIBLAST alignment of GI: 254780371 and protein with PDB id: 1hkw

>gi|29726282|pdb|1HKW|A Chain A, Mycobacterium Diaminopimelate Dicarboxylase (Lysa) Length = 453
>gi|29726283|pdb|1HKW|B Chain B, Mycobacterium Diaminopimelate Dicarboxylase (Lysa) Length = 453
 Score =  243 bits (620), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 114/427 (26%), Positives = 192/427 (44%), Gaps = 22/427 (5%)

Query: 9   GSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVI 68
           G +    + L +LA    TP +              + AF G    V YA KA     V 
Sbjct: 22  GVVCIAGIPLTQLAQEYGTPLFVIDEDDFRSRCRETAAAF-GSGANVHYAAKAFLCSEVA 80

Query: 69  KTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESES 128
           + ++  G  LD+ + GEL  AL A  P ERI   G  K++ E+  A+++G+    V+S +
Sbjct: 81  RWISEEGLCLDVCTGGELAVALHASFPPERITLHGNNKSVSELTAAVKAGVGHIVVDSXT 140

Query: 129 ELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTL 188
           E++ L+  A   G    +  R+   + A+TH+ IST  ++ KFG+ +    +  A     
Sbjct: 141 EIERLDAIAGEAGIVQDVLVRLTVGVEAHTHEFISTAHEDQKFGLSVASGAAXAAVRRVF 200

Query: 189 --PGVKISGVDMHIGSQIDQIESFHKAFKLLR-----DLTQQLRSNGHNIQHIDVGGGLG 241
               +++ G+  HIGSQI  ++ F  A   +       + +        I  +D+GGGLG
Sbjct: 201 ATDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGLLRDVVGEFGPEKTAQIATVDLGGGLG 260

Query: 242 IAYHSDHRPPSSSDYA-------SLIHQYFGNLQCKIILEPGRFLVADVGILVTKV---- 290
           I+Y     PP  ++ A       S      G    K+++EPGR +     I + +V    
Sbjct: 261 ISYLPSDDPPPIAELAAKLGTIVSDESTAVGLPTPKLVVEPGRAIAGPGTITLYEVGTVK 320

Query: 291 -ISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGD 349
            + +  +A + +V +D   +D +R  LY A +++  +     D   + A +VG  CE+GD
Sbjct: 321 DVDVSATAHRRYVSVDGGXSDNIRTALYGAQYDVRLVSR-VSDAPPVPARLVGKHCESGD 379

Query: 350 FIALNRKIAL-PRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQ 408
            I  +  +    RPGDL+ +  TGAY    S  YN       + V+     ++  R T  
Sbjct: 380 IIVRDTWVPDDIRPGDLVAVAATGAYCYSLSSRYNXVGRPAVVAVHAGNARLVLRRETVD 439

Query: 409 ELIELDS 415
           +L+ L+ 
Sbjct: 440 DLLSLEV 446