PSIBLAST alignment of GI: 254780371 and protein with PDB id: 1twi

>gi|51247766|pdb|1TWI|A Chain A, Crystal Structure Of Diaminopimelate Decarboxylase From M. Jannaschii In Co-Complex With L-Lysine Length = 434
>gi|51247767|pdb|1TWI|B Chain B, Crystal Structure Of Diaminopimelate Decarboxylase From M. Jannaschii In Co-Complex With L-Lysine Length = 434
 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 154/429 (35%), Positives = 231/429 (53%), Gaps = 16/429 (3%)

Query: 5   KYFEGSLHAENVSLEKLAHVVQTPFYCYSTTAIEKNYLTFSNAFD------GMDTMVCYA 58
           +  +G    +     +LA    TP Y  S   I+ NY  +  AF       G + +V YA
Sbjct: 8   EIKDGRFFIDGYDAIELAEKFGTPLYVMSEEQIKINYNRYIEAFKRWEEETGKEFIVAYA 67

Query: 59  LKANSNQAVIKTLAHLGSGLDIVSEGELRRALAAPVPAERIVFSGVGKTIDEIDLALQSG 118
            KAN+N A+ + LA LG G D+VS GEL  A  + VP+++IVF+G  KT +EI + +++ 
Sbjct: 68  YKANANLAITRLLAKLGCGADVVSGGELYIAKLSNVPSKKIVFNGNCKTKEEIIMGIEAN 127

Query: 119 IYCFNVESESELKTLNQRAVSLGKKAPIAFRVNPDINANTHKKISTGKKEDKFGIPIHQI 178
           I  FNV+S SEL  +N+ A  LG+ A +AFR+NP++N  TH KISTG K++KFG+ +   
Sbjct: 128 IRAFNVDSISELILINETAKELGETANVAFRINPNVNPKTHPKISTGLKKNKFGLDVESG 187

Query: 179 HSL--YAYASTLPGVKISGVDMHIGSQIDQIESFHKAFKLLRDLTQQLRSNGHNIQHIDV 236
            ++     A  +  V + GV  HIGSQ+  I  F +  + + D   +L+  G  I+ +++
Sbjct: 188 IAMKAIKMALEMEYVNVVGVHCHIGSQLTDISPFIEETRKVMDFVVELKEEGIEIEDVNL 247

Query: 237 GGGLGIAYHSDHRPPSSSDYAS-----LIHQYFGNLQCKIILEPGRFLVADVGILVTKVI 291
           GGGLGI Y+ D + P+  D A      ++          +ILEPGR LVA  G L+ KV 
Sbjct: 248 GGGLGIPYYKDKQIPTQKDLADAIINTMLKYKDKVEMPNLILEPGRSLVATAGYLLGKVH 307

Query: 292 SIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFI 351
            IK++    +V++D  MND MRP +Y+AYH I    N           I G +CE+ D  
Sbjct: 308 HIKETPVTKWVMIDAGMNDMMRPAMYEAYHHII---NCKVKNEKEVVSIAGGLCESSDVF 364

Query: 352 ALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSRLLIPEIMVNGSQFHIIRPRMTFQELI 411
             +R++     GD+L I   GAYG   +  YN+R     ++ +     +IR R T+ +LI
Sbjct: 365 GRDRELDKVEVGDVLAIFDVGAYGISMANNYNARGRPRMVLTSKKGVFLIRERETYADLI 424

Query: 412 ELDSIPAWL 420
             D +P  L
Sbjct: 425 AKDIVPPHL 433