PSIBLAST alignment of GI: 254780371 and protein with PDB id: 2nv9

>gi|145579900|pdb|2NV9|A Chain A, The X-Ray Crystal Structure Of The Paramecium Bursaria Chlorella Virus Arginine Decarboxylase Length = 372
>gi|145579901|pdb|2NV9|B Chain B, The X-Ray Crystal Structure Of The Paramecium Bursaria Chlorella Virus Arginine Decarboxylase Length = 372
 Score =  138 bits (346), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 80/359 (22%), Positives = 143/359 (39%), Gaps = 15/359 (4%)

Query: 29  FYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRR 88
           FY  S   +E     ++  F        YA+K N+++ ++KT+       D  S  E+++
Sbjct: 19  FYVSSPKIVEDLIDQWTILFPR--VTPHYAVKCNNDEVLLKTMCDKNVNFDCASSSEIKK 76

Query: 89  ALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAF 148
            +   V   RI+F+   KTID++  A   G+     +S  EL  ++    +      I  
Sbjct: 77  VIQIGVSPSRIIFAHTMKTIDDLIFAKDQGVDIATFDSSFELDKIHTYHPNCKMILRIRC 136

Query: 149 RVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISGVDMHIGSQIDQIE 208
                         +  +  +KFG    +I  L  YA  L   ++ G+  H+GS     E
Sbjct: 137 D----------DPNAAVQLGNKFGANEDEIRHLLEYAKQLDI-EVIGISFHVGSGSRNPE 185

Query: 209 SFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASL-IHQYFGNL 267
           ++++A K  ++   +  S GH    +D+GGGL             SDY +  I  +F   
Sbjct: 186 AYYRAIKSSKEAFNEAISVGHKPYILDIGGGLHADIDEGELSTYMSDYINDAIKDFFPED 245

Query: 268 QCKIILEPGRFLVADVGILVTKVISIKKSADKTFVILDVAMNDFMRPTLYDAYHEINYIV 327
              I+ EPGRF      +L T+VI  +          + +        +++       ++
Sbjct: 246 TVTIVAEPGRFFAEHYSVLATQVIGKRVRDGLYEYFFNESTYGGFSNVIFEKSVPTPQLL 305

Query: 328 NP-AGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAYGAVQSGTYNSR 385
                D  ++ + + G  C+  D I  N  +     GD +Y    GAY  V + ++N  
Sbjct: 306 RDVPDDEEYVPSVLYGCTCDGVDVINHNVALPELHIGDWVYFPSWGAYTNVLTTSFNGF 364