PSIBLAST alignment of GI: 254780371 and protein with PDB id: 2oo0

>gi|152149219|pdb|2OO0|A Chain A, A Structural Insight Into The Inhibition Of Human And Leishmania Donovani Ornithine Decarboxylases By 3-Aminooxy- 1-Aminopropane Length = 471
>gi|152149220|pdb|2OO0|B Chain B, A Structural Insight Into The Inhibition Of Human And Leishmania Donovani Ornithine Decarboxylases By 3-Aminooxy- 1-Aminopropane Length = 471
 Score =  164 bits (416), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 85/382 (22%), Positives = 140/382 (36%), Gaps = 30/382 (7%)

Query: 29  FYCYSTTAIEKNYLTFSNAFDGMDTMVCYALKANSNQAVIKTLAHLGSGLDIVSEGELRR 88
           FY      I K +L +  A         YA+K N ++A++KTLA  G+G D  S+ E++ 
Sbjct: 50  FYVADLGDILKKHLRWLKALPR--VTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQL 107

Query: 89  ALAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKKAPIAF 148
             +  VP ERI+++   K + +I  A  +G+     +SE EL  + +          IA 
Sbjct: 108 VQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIA- 166

Query: 149 RVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISGVDMHIGSQIDQIE 208
                    T    +  +   KFG  +     L   A  L  + + GV  H+GS     E
Sbjct: 167 ---------TDDSKAVCRLSVKFGATLRTSRLLLERAKEL-NIDVVGVSFHVGSGCTDPE 216

Query: 209 SFHKAFKLLRDLTQQLRSNGHNIQHIDVGGGLGIAYHSDHRPPSSSDYASL--IHQYFGN 266
           +F +A    R +       G ++  +D+GGG   +     +    +   +      +  +
Sbjct: 217 TFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVINPALDKYFPSD 276

Query: 267 LQCKIILEPGRFLVADVGILVTKV---------------ISIKKSADKTFVILDVAMNDF 311
              +II EPGR+ VA    L   +                         + + D     F
Sbjct: 277 SGVRIIAEPGRYYVASAFTLAVNIIAKKIVLKEQTGSDDEDESSEQTFMYYVNDGVYGSF 336

Query: 312 MRPTLYDAYHEINYIVNPAGDRLHIHADIVGPICETGDFIALNRKIALPRPGDLLYIEKT 371
                  A+ +      P  D  +  + I GP C+  D I     +     GD +  E  
Sbjct: 337 NCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENM 396

Query: 372 GAYGAVQSGTYNSRLLIPEIMV 393
           GAY    + T+N         V
Sbjct: 397 GAYTVAAASTFNGFQRPTIYYV 418