RPSBLAST alignment for GI: 254780371 and conserved domain: cd00430

>gnl|CDD|143481 cd00430, PLPDE_III_AR, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Alanine Racemase. This family includes predominantly bacterial alanine racemases (AR), some serine racemases (SerRac), and putative bifunctional enzymes containing N-terminal UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase (murF) and C-terminal AR domains. These proteins are fold type III PLP-dependent enzymes that play essential roles in peptidoglycan biosynthesis. AR catalyzes the interconversion between L- and D-alanine, which is an essential component of the peptidoglycan layer of bacterial cell walls. SerRac converts L-serine into its D-enantiomer (D-serine) for peptidoglycan synthesis. murF catalyzes the addition of D-Ala-D-Ala to UDPMurNAc-tripeptide, the final step in the synthesis of the cytoplasmic precursor of bacterial cell wall peptidoglycan. Members of this family contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. AR and other members of this family require dimer formation and the presence of the PLP cofactor for catalytic activity. Fungal ARs and eukaryotic serine racemases, which are fold types I and II PLP-dependent enzymes respectively, are excluded from this family. Length = 367
 Score = 39.4 bits (93), Expect = 0.002
 Identities = 44/209 (21%), Positives = 73/209 (34%), Gaps = 38/209 (18%)

Query: 36  AIEKNYLTFSNAFDGMDTMVCYALKANSNQA-------VIKTLAHLGS---GLDIVSEG- 84
           A+  N         G  T +   +KA+   A       V K L   G+    +  + E  
Sbjct: 10  ALRHNLRVIRRLL-GPGTKIMAVVKAD---AYGHGAVEVAKALEEAGADYFAVATLEEAL 65

Query: 85  ELRRA-LAAPVPAERIVFSGVGKTIDEIDLALQSGIYCFNVESESELKTLNQRAVSLGKK 143
           ELR A + AP+    +V  G     +E + A++  +    V S  + + L+  A  LGK 
Sbjct: 66  ELREAGITAPI----LVLGGT--PPEEAEEAIEYDLTPT-VSSLEQAEALSAAAARLGKT 118

Query: 144 APIAFRVNPDINANTHKKISTGKKEDKFGIPIHQIHSLYAYASTLPGVKISGVDMHIG-S 202
             +            H KI TG    + G    +   L      LPG+++ GV  H   +
Sbjct: 119 LKV------------HLKIDTGM--GRLGFRPEEAEELLEALKALPGLELEGVFTHFATA 164

Query: 203 QIDQIESFHKAFKLLRDLTQQLRSNGHNI 231
                    +  +   +   +L   G   
Sbjct: 165 DEPDKAYTRRQLERFLEALAELEEAGIPP 193